fer3l-1 protein

Overview
Namefer3l-1 protein (AGZ94909.1)
Smed IDSMED30016826
Length (bp)1839
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of fer3l-1 protein (SMED30016826) t-SNE clustered cells

Violin plots show distribution of expression levels for fer3l-1 protein (SMED30016826) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of fer3l-1 protein (SMED30016826) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for fer3l-1 protein (SMED30016826) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016826

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30016826SMESG000028999.1 SmedASXL_007316SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
cephalic gangliaSMED30016826SMESG000029000.1 dd_Smed_v4_8096_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30016826SMESG000029000.1 dd_Smed_v4_8096_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30016826SMESG000029000.1 dd_Smed_v4_8096_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30016826SMESG000029000.1 dd_Smed_v4_8096_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016826SMESG000029000.1 Contig34355newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016826SMESG000029000.1 Contig34355uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
prepharyngeal regionSMED30016826SMESG000029000.1 dd_Smed_v6_8096_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
central nervous systemSMED30016826SMESG000029000.1 KF487094smed_ncbi_20200123PMID:24173799
Cowles et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
progenitor cellSMED30016826SMESG000029000.1 KF487094smed_ncbi_20200123PMID:24173799
Cowles et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
stem cellSMED30016826SMESG000029000.1 KF487094smed_ncbi_20200123PMID:24173799
Cowles et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30016826SMESG000029000.1 OX_Smed_1.0.16769ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30016826SMESG000028999.1 dd_Smed_v4_16851_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of fer3l-1 protein vs. Ensembl Human
Match: FERD3L (Fer3 like bHLH transcription factor [Source:HGNC Symbol;Acc:HGNC:16660])

HSP 1 Score: 88.1965 bits (217), Expect = 8.522e-20
Identity = 54/69 (78.26%), Postives = 62/69 (89.86%), Query Frame = 2
Query: 1490 NKPKRKRISTVXXXXXXXXXXXXXMYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELLN 1696
             +PKRKR+ T AQR+AANIRER+RM++LNEAFD LR++VPTFAYEKRLSRIETLRLAI YI FMTELL 
Sbjct:   90 GRPKRKRVITYAQRQAANIRERKRMFNLNEAFDQLRRKVPTFAYEKRLSRIETLRLAIVYISFMTELLE 158          
BLAST of fer3l-1 protein vs. Ensembl Human
Match: PTF1A (pancreas associated transcription factor 1a [Source:HGNC Symbol;Acc:HGNC:23734])

HSP 1 Score: 62.3882 bits (150), Expect = 7.702e-10
Identity = 26/45 (57.78%), Postives = 36/45 (80.00%), Query Frame = 2
Query: 1562 MYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELLN 1696
            M S+N+AF+ LR  +PT  YEKRLS+++TLRLAI YI F++EL+ 
Sbjct:  176 MQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSELVQ 220          
BLAST of fer3l-1 protein vs. Ensembl Human
Match: NEUROD1 (neuronal differentiation 1 [Source:HGNC Symbol;Acc:HGNC:7762])

HSP 1 Score: 57.7658 bits (138), Expect = 2.768e-8
Identity = 28/56 (50.00%), Postives = 41/56 (73.21%), Query Frame = 2
Query: 1562 MYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELL-NGKNADNISLV 1726
            M+ LN A D+LRK VP ++  ++LS+IETLRLA  YI  ++E+L +GK+ D +S V
Sbjct:  114 MHGLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSGKSPDLVSFV 169          
BLAST of fer3l-1 protein vs. Ensembl Human
Match: NEUROD6 (neuronal differentiation 6 [Source:HGNC Symbol;Acc:HGNC:13804])

HSP 1 Score: 55.0694 bits (131), Expect = 1.601e-7
Identity = 27/56 (48.21%), Postives = 40/56 (71.43%), Query Frame = 2
Query: 1562 MYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELLN-GKNADNISLV 1726
            M+ LN+A D+LRK VP ++  ++LS+IETLRLA  YI  ++E+L  GK  D ++ V
Sbjct:  107 MHGLNDALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRIGKRPDLLTFV 162          
BLAST of fer3l-1 protein vs. Ensembl Human
Match: NEUROD2 (neuronal differentiation 2 [Source:HGNC Symbol;Acc:HGNC:7763])

HSP 1 Score: 55.0694 bits (131), Expect = 2.481e-7
Identity = 28/56 (50.00%), Postives = 40/56 (71.43%), Query Frame = 2
Query: 1562 MYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELL-NGKNADNISLV 1726
            M+ LN A D+LRK VP ++  ++LS+IETLRLA  YI  ++E+L +GK  D +S V
Sbjct:  134 MHDLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSGKRPDLVSYV 189          
BLAST of fer3l-1 protein vs. Ensembl Celegans
Match: hlh-13 (Helix-loop-helix protein 13 [Source:UniProtKB/Swiss-Prot;Acc:Q20561])

HSP 1 Score: 50.447 bits (119), Expect = 2.723e-7
Identity = 25/44 (56.82%), Postives = 32/44 (72.73%), Query Frame = 2
Query: 1562 MYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELL 1693
            M S+N AF  LR  +PTF YEKRLS+I+TL LAI YI  + ++L
Sbjct:   54 MCSINVAFIELRNYIPTFPYEKRLSKIDTLNLAIAYINMLDDVL 97          
BLAST of fer3l-1 protein vs. Ensembl Celegans
Match: hlh-15 (Helix Loop Helix [Source:UniProtKB/TrEMBL;Acc:Q18590])

HSP 1 Score: 44.669 bits (104), Expect = 8.993e-6
Identity = 22/43 (51.16%), Postives = 27/43 (62.79%), Query Frame = 2
Query: 1568 SLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELLN 1696
            S N AF  LR  +PT   EK+LS+IE LR +I YI F+  LL 
Sbjct:   47 SFNMAFSQLRALLPTLPVEKKLSKIEILRFSIAYISFLDNLLQ 89          
BLAST of fer3l-1 protein vs. Ensembl Fly
Match: Fer3 (gene:FBgn0037937 transcript:FBtr0082435)

HSP 1 Score: 88.5817 bits (218), Expect = 8.110e-20
Identity = 53/66 (80.30%), Postives = 63/66 (95.45%), Query Frame = 2
Query: 1502 RKRISTVXXXXXXXXXXXXXMYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELLNG 1699
            R+R++++AQRRAANIRERRRM++LNEAFD LR++VPTFAYEKRLSRIETLRLAITYI FM ELL+G
Sbjct:   79 RRRVASMAQRRAANIRERRRMFNLNEAFDKLRRKVPTFAYEKRLSRIETLRLAITYIGFMAELLSG 144          
BLAST of fer3l-1 protein vs. Ensembl Fly
Match: Fer1 (gene:FBgn0037475 transcript:FBtr0081567)

HSP 1 Score: 63.929 bits (154), Expect = 5.665e-11
Identity = 39/71 (54.93%), Postives = 58/71 (81.69%), Query Frame = 2
Query: 1487 SNKPKRKRIST--VXXXXXXXXXXXXXMYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELL 1693
            S+KP+R + ++    QR+AAN+RERRRM S+NEAF+ LR  +PT  YEKRLS+++TL+LAI+YI F++E++
Sbjct:   67 SHKPRRLKCASQMAQQRQAANLRERRRMQSINEAFEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMV 137          
BLAST of fer3l-1 protein vs. Ensembl Fly
Match: Fer1 (gene:FBgn0037475 transcript:FBtr0334670)

HSP 1 Score: 63.5438 bits (153), Expect = 7.132e-11
Identity = 39/71 (54.93%), Postives = 58/71 (81.69%), Query Frame = 2
Query: 1487 SNKPKRKRIST--VXXXXXXXXXXXXXMYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELL 1693
            S+KP+R + ++    QR+AAN+RERRRM S+NEAF+ LR  +PT  YEKRLS+++TL+LAI+YI F++E++
Sbjct:   72 SHKPRRLKCASQMAQQRQAANLRERRRMQSINEAFEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMV 142          
BLAST of fer3l-1 protein vs. Ensembl Fly
Match: Fer2 (gene:FBgn0038402 transcript:FBtr0344012)

HSP 1 Score: 61.6178 bits (148), Expect = 4.155e-10
Identity = 28/42 (66.67%), Postives = 33/42 (78.57%), Query Frame = 2
Query: 1568 SLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELL 1693
            S+N AFD LR  VPTF YEKRLS+I+TLRLAI YI  + E+L
Sbjct:  163 SINSAFDELRVHVPTFPYEKRLSKIDTLRLAIAYISLLREVL 204          
BLAST of fer3l-1 protein vs. Ensembl Fly
Match: Fer2 (gene:FBgn0038402 transcript:FBtr0301709)

HSP 1 Score: 61.6178 bits (148), Expect = 4.275e-10
Identity = 28/42 (66.67%), Postives = 33/42 (78.57%), Query Frame = 2
Query: 1568 SLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELL 1693
            S+N AFD LR  VPTF YEKRLS+I+TLRLAI YI  + E+L
Sbjct:  163 SINSAFDELRVHVPTFPYEKRLSKIDTLRLAIAYISLLREVL 204          
BLAST of fer3l-1 protein vs. Ensembl Zebrafish
Match: ferd3l (Fer3-like bHLH transcription factor [Source:ZFIN;Acc:ZDB-GENE-081104-461])

HSP 1 Score: 89.7373 bits (221), Expect = 1.706e-21
Identity = 53/67 (79.10%), Postives = 61/67 (91.04%), Query Frame = 2
Query: 1493 KPKRKRISTVXXXXXXXXXXXXXMYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELL 1693
            KPKRKR+ +  QR+AANIRER+RM+SLNEAFD LR+RVPTFAYEKRLSRIETLRLAI YI FMT++L
Sbjct:   14 KPKRKRVISTVQRQAANIRERKRMFSLNEAFDRLRRRVPTFAYEKRLSRIETLRLAIVYIAFMTDIL 80          
BLAST of fer3l-1 protein vs. Ensembl Zebrafish
Match: si:dkey-34f9.3 (si:dkey-34f9.3 [Source:ZFIN;Acc:ZDB-GENE-081104-410])

HSP 1 Score: 61.6178 bits (148), Expect = 9.202e-11
Identity = 28/44 (63.64%), Postives = 34/44 (77.27%), Query Frame = 2
Query: 1562 MYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELL 1693
            M S+N AF+ LR  VPTF YEKRLS+I+TLRLAI YI  + E+L
Sbjct:   78 MLSINSAFEELRCHVPTFPYEKRLSKIDTLRLAIAYIALLREIL 121          
BLAST of fer3l-1 protein vs. Ensembl Zebrafish
Match: ptf1a (pancreas associated transcription factor 1a [Source:NCBI gene;Acc:368662])

HSP 1 Score: 62.003 bits (149), Expect = 3.843e-10
Identity = 26/44 (59.09%), Postives = 35/44 (79.55%), Query Frame = 2
Query: 1562 MYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELL 1693
            M S+N+AF+ LR  +PT  YEKRLS+++TLRLAI YI F+ EL+
Sbjct:  128 MQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLAELV 171          
BLAST of fer3l-1 protein vs. Ensembl Zebrafish
Match: neurod2 (neuronal differentiation 2 [Source:NCBI gene;Acc:114435])

HSP 1 Score: 57.7658 bits (138), Expect = 1.948e-8
Identity = 29/56 (51.79%), Postives = 40/56 (71.43%), Query Frame = 2
Query: 1562 MYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELL-NGKNADNISLV 1726
            M+ LN A D+LRK VP ++  ++LS+IETLRLA  YI  ++E+L NGK  D +S V
Sbjct:  120 MHDLNSALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRNGKRPDVVSYV 175          
BLAST of fer3l-1 protein vs. Ensembl Zebrafish
Match: neurod1 (neuronal differentiation 1 [Source:NCBI gene;Acc:30169])

HSP 1 Score: 57.3806 bits (137), Expect = 2.218e-8
Identity = 28/56 (50.00%), Postives = 42/56 (75.00%), Query Frame = 2
Query: 1562 MYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELL-NGKNADNISLV 1726
            M+ LN+A +SLRK VP ++  ++LS+IETLRLA  YI  ++E+L +GK+ D +S V
Sbjct:  109 MHGLNDALESLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSGKSPDLMSFV 164          
BLAST of fer3l-1 protein vs. Ensembl Xenopus
Match: ferd3l (Fer3-like bHLH transcription factor [Source:NCBI gene;Acc:100124312])

HSP 1 Score: 92.8189 bits (229), Expect = 7.113e-22
Identity = 58/78 (74.36%), Postives = 69/78 (88.46%), Query Frame = 2
Query: 1481 NPSNKPKRKRISTVXXXXXXXXXXXXXMYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELLNGKNADN 1714
            +P  +PKRKR+ T AQR+AANIRER+RM++LNEAFD LRK+VPTFAYEKRLSRIETLRLAI YI FMTE+L  KN++N
Sbjct:   51 SPMGRPKRKRVITYAQRQAANIRERKRMFNLNEAFDLLRKKVPTFAYEKRLSRIETLRLAIVYISFMTEML--KNSEN 126          
BLAST of fer3l-1 protein vs. Ensembl Xenopus
Match: ENSXETT00000031930.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:9:55646956:55647657:1 gene:ENSXETG00000008961.1 transcript:ENSXETT00000031930.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.3142 bits (155), Expect = 2.054e-11
Identity = 28/45 (62.22%), Postives = 37/45 (82.22%), Query Frame = 2
Query: 1562 MYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELLN 1696
            M S+N AF+ LR RVPTF YEKRLS+I+TLRLAI YI  ++++L+
Sbjct:   96 MLSINSAFEELRGRVPTFPYEKRLSKIDTLRLAIAYIALLSDILS 140          
BLAST of fer3l-1 protein vs. Ensembl Xenopus
Match: PTF1A (pancreas associated transcription factor 1a [Source:NCBI gene;Acc:100494161])

HSP 1 Score: 62.003 bits (149), Expect = 9.475e-10
Identity = 26/44 (59.09%), Postives = 36/44 (81.82%), Query Frame = 2
Query: 1562 MYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELL 1693
            M S+N+AF+ LR  +PT  YEKRLS+++TLRLAI YI F++EL+
Sbjct:  182 MQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSELV 225          
BLAST of fer3l-1 protein vs. Ensembl Xenopus
Match: neurod1 (neuronal differentiation 1 [Source:NCBI gene;Acc:100038290])

HSP 1 Score: 57.3806 bits (137), Expect = 3.258e-8
Identity = 28/56 (50.00%), Postives = 41/56 (73.21%), Query Frame = 2
Query: 1562 MYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELL-NGKNADNISLV 1726
            M+ LN A D+LRK VP ++  ++LS+IETLRLA  YI  ++E+L +GK+ D +S V
Sbjct:  121 MHGLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSGKSPDLVSFV 176          
BLAST of fer3l-1 protein vs. Ensembl Xenopus
Match: neurod6 (neuronal differentiation 6 [Source:NCBI gene;Acc:779726])

HSP 1 Score: 55.4546 bits (132), Expect = 1.270e-7
Identity = 27/56 (48.21%), Postives = 40/56 (71.43%), Query Frame = 2
Query: 1562 MYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELLN-GKNADNISLV 1726
            M+ LN+A D+LRK VP ++  ++LS+IETLRLA  YI  ++E+L  GK  D ++ V
Sbjct:  107 MHGLNDALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRIGKRPDLLTFV 162          
BLAST of fer3l-1 protein vs. Ensembl Mouse
Match: Ferd3l (Fer3 like bHLH transcription factor [Source:MGI Symbol;Acc:MGI:2150010])

HSP 1 Score: 90.8929 bits (224), Expect = 7.212e-21
Identity = 56/77 (72.73%), Postives = 64/77 (83.12%), Query Frame = 2
Query: 1490 NKPKRKRISTVXXXXXXXXXXXXXMYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELLNGKNADNIS 1720
             +PKRKR+ T AQR+AANIRER+RM++LNEAFD LR++VPTFAYEKRLSRIETLRLAI YI FMTELL  K     S
Sbjct:   92 GRPKRKRVITYAQRQAANIRERKRMFNLNEAFDQLRRKVPTFAYEKRLSRIETLRLAIVYISFMTELLQSKEEKEAS 168          
BLAST of fer3l-1 protein vs. Ensembl Mouse
Match: Ptf1a (pancreas specific transcription factor, 1a [Source:MGI Symbol;Acc:MGI:1328312])

HSP 1 Score: 62.003 bits (149), Expect = 6.446e-10
Identity = 26/44 (59.09%), Postives = 36/44 (81.82%), Query Frame = 2
Query: 1562 MYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELL 1693
            M S+N+AF+ LR  +PT  YEKRLS+++TLRLAI YI F++EL+
Sbjct:  173 MQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSELV 216          
BLAST of fer3l-1 protein vs. Ensembl Mouse
Match: Neurod1 (neurogenic differentiation 1 [Source:MGI Symbol;Acc:MGI:1339708])

HSP 1 Score: 57.7658 bits (138), Expect = 1.716e-8
Identity = 28/56 (50.00%), Postives = 41/56 (73.21%), Query Frame = 2
Query: 1562 MYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELL-NGKNADNISLV 1726
            M+ LN A D+LRK VP ++  ++LS+IETLRLA  YI  ++E+L +GK+ D +S V
Sbjct:  114 MHGLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSGKSPDLVSFV 169          
BLAST of fer3l-1 protein vs. Ensembl Mouse
Match: Neurod6 (neurogenic differentiation 6 [Source:MGI Symbol;Acc:MGI:106593])

HSP 1 Score: 55.4546 bits (132), Expect = 1.070e-7
Identity = 27/56 (48.21%), Postives = 40/56 (71.43%), Query Frame = 2
Query: 1562 MYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELLN-GKNADNISLV 1726
            M+ LN+A D+LRK VP ++  ++LS+IETLRLA  YI  ++E+L  GK  D ++ V
Sbjct:  107 MHGLNDALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRIGKRPDLLTFV 162          
BLAST of fer3l-1 protein vs. Ensembl Mouse
Match: Neurod2 (neurogenic differentiation 2 [Source:MGI Symbol;Acc:MGI:107755])

HSP 1 Score: 55.0694 bits (131), Expect = 1.621e-7
Identity = 28/56 (50.00%), Postives = 40/56 (71.43%), Query Frame = 2
Query: 1562 MYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELL-NGKNADNISLV 1726
            M+ LN A D+LRK VP ++  ++LS+IETLRLA  YI  ++E+L +GK  D +S V
Sbjct:  135 MHDLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSGKRPDLVSYV 190          
BLAST of fer3l-1 protein vs. UniProt/SwissProt
Match: sp|Q923Z4|FER3L_MOUSE (Fer3-like protein OS=Mus musculus OX=10090 GN=Ferd3l PE=1 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 5.045e-20
Identity = 56/77 (72.73%), Postives = 64/77 (83.12%), Query Frame = 2
Query: 1490 NKPKRKRISTVXXXXXXXXXXXXXMYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELLNGKNADNIS 1720
             +PKRKR+ T AQR+AANIRER+RM++LNEAFD LR++VPTFAYEKRLSRIETLRLAI YI FMTELL  K     S
Sbjct:   92 GRPKRKRVITYAQRQAANIRERKRMFNLNEAFDQLRRKVPTFAYEKRLSRIETLRLAIVYISFMTELLQSKEEKEAS 168          
BLAST of fer3l-1 protein vs. UniProt/SwissProt
Match: sp|Q96RJ6|FER3L_HUMAN (Fer3-like protein OS=Homo sapiens OX=9606 GN=FERD3L PE=1 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 4.092e-19
Identity = 54/69 (78.26%), Postives = 62/69 (89.86%), Query Frame = 2
Query: 1490 NKPKRKRISTVXXXXXXXXXXXXXMYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELLN 1696
             +PKRKR+ T AQR+AANIRER+RM++LNEAFD LR++VPTFAYEKRLSRIETLRLAI YI FMTELL 
Sbjct:   90 GRPKRKRVITYAQRQAANIRERKRMFNLNEAFDQLRRKVPTFAYEKRLSRIETLRLAIVYISFMTELLE 158          
BLAST of fer3l-1 protein vs. UniProt/SwissProt
Match: sp|Q9VGJ5|FER3_DROME (Protein Fer3 OS=Drosophila melanogaster OX=7227 GN=fer3 PE=2 SV=2)

HSP 1 Score: 88.5817 bits (218), Expect = 8.130e-19
Identity = 53/66 (80.30%), Postives = 63/66 (95.45%), Query Frame = 2
Query: 1502 RKRISTVXXXXXXXXXXXXXMYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELLNG 1699
            R+R++++AQRRAANIRERRRM++LNEAFD LR++VPTFAYEKRLSRIETLRLAITYI FM ELL+G
Sbjct:   79 RRRVASMAQRRAANIRERRRMFNLNEAFDKLRRKVPTFAYEKRLSRIETLRLAITYIGFMAELLSG 144          
BLAST of fer3l-1 protein vs. UniProt/SwissProt
Match: sp|Q7ZSX3|PTF1A_DANRE (Pancreas transcription factor 1 subunit alpha OS=Danio rerio OX=7955 GN=ptf1a PE=2 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 2.901e-9
Identity = 26/44 (59.09%), Postives = 35/44 (79.55%), Query Frame = 2
Query: 1562 MYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELL 1693
            M S+N+AF+ LR  +PT  YEKRLS+++TLRLAI YI F+ EL+
Sbjct:  128 MQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLAELV 171          
BLAST of fer3l-1 protein vs. UniProt/SwissProt
Match: sp|Q7RTS3|PTF1A_HUMAN (Pancreas transcription factor 1 subunit alpha OS=Homo sapiens OX=9606 GN=PTF1A PE=1 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 3.699e-9
Identity = 26/45 (57.78%), Postives = 36/45 (80.00%), Query Frame = 2
Query: 1562 MYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELLN 1696
            M S+N+AF+ LR  +PT  YEKRLS+++TLRLAI YI F++EL+ 
Sbjct:  176 MQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSELVQ 220          
BLAST of fer3l-1 protein vs. TrEMBL
Match: U5YTA6 (Fer3l-1 protein (Fragment) OS=Schmidtea mediterranea OX=79327 GN=fer3l-1 PE=2 SV=1)

HSP 1 Score: 313.538 bits (802), Expect = 8.323e-101
Identity = 180/182 (98.90%), Postives = 182/182 (100.00%), Query Frame = 2
Query: 1154 LSQNQEPQFMFFDQCYIPYSAINNADNPSDRSGVTIPRSSVLQYPVFDENCQISLQELYTXXXXXXXXXXQIPAVMNDNNSRYSSASSEFYTSPDNKIIIQSNIAENSPNPSNKPKRKRISTVXXXXXXXXXXXXXMYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELLNG 1699
            LSQNQEPQFMFFDQCYIPYSAINNADNPSDRSGVTIPRSSVLQYPVFDENCQISL+ELYTNNNESNISNSQIPAVMNDNNSR+SSASSEFYTSPDNKIIIQSNIAENSPNPSNKPKRKRISTVAQRRAANIRERRRMYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELLNG
Sbjct:    1 LSQNQEPQFMFFDQCYIPYSAINNADNPSDRSGVTIPRSSVLQYPVFDENCQISLEELYTNNNESNISNSQIPAVMNDNNSRFSSASSEFYTSPDNKIIIQSNIAENSPNPSNKPKRKRISTVAQRRAANIRERRRMYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELLNG 182          
BLAST of fer3l-1 protein vs. TrEMBL
Match: A0A5N4A372 (Uncharacterized protein OS=Photinus pyralis OX=7054 GN=PPYR_03552 PE=4 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 5.852e-21
Identity = 62/88 (70.45%), Postives = 75/88 (85.23%), Query Frame = 2
Query: 1451 IQSNIAENSPNPSNKPKRKRISTVXXXXXXXXXXXXXMYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELLNGKNADN 1714
            I  N + N+P  S K  R+R++T+AQRRAANIRERRRM++LNEAFD LR++VPTFAYEKRLSRIETLRLAITYI FMTELL+G N ++
Sbjct:   78 ISRNGSPNNPTQSQKKPRRRVATIAQRRAANIRERRRMFNLNEAFDKLRRKVPTFAYEKRLSRIETLRLAITYISFMTELLHGTNPEH 165          
BLAST of fer3l-1 protein vs. TrEMBL
Match: A0A444TVV6 (Fer3-like protein OS=Acipenser ruthenus OX=7906 GN=EOD39_7857 PE=4 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 2.958e-20
Identity = 64/107 (59.81%), Postives = 76/107 (71.03%), Query Frame = 2
Query: 1400 YSSASSEFYTSPDNKIIIQSNIAENSPNPS-----NKPKRKRISTVXXXXXXXXXXXXXMYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELLNGKN 1705
            Y  AS   +   ++K+ + S   ENSP+ S      + KRKR+ T  QR AANIRER+RM+SLNEAFD LRK+VPTFAYEKRLSRIETLRLAI YI FM+ELL  K 
Sbjct:   50 YDFASIHGFADAESKVSLGSLGMENSPDCSMSSLTGRSKRKRVITSNQRHAANIRERKRMFSLNEAFDDLRKKVPTFAYEKRLSRIETLRLAIVYISFMSELLKNKK 156          
BLAST of fer3l-1 protein vs. TrEMBL
Match: A0A402ENE0 (BHLH domain-containing protein OS=Paroedura picta OX=143630 GN=parPi_0005291 PE=4 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 3.784e-20
Identity = 58/76 (76.32%), Postives = 66/76 (86.84%), Query Frame = 2
Query: 1478 PNPSNKPKRKRISTVXXXXXXXXXXXXXMYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELLNGKN 1705
            P+P  +PKRKR+ T AQR+AANIRER+RM++LNEAFD LRK+VPTFAYEKRLSRIETLRLAI YI FMTELL G  
Sbjct:   83 PSPLGRPKRKRVITSAQRQAANIRERKRMFNLNEAFDQLRKKVPTFAYEKRLSRIETLRLAIVYISFMTELLGGGG 158          
BLAST of fer3l-1 protein vs. TrEMBL
Match: A0A0U2T2J5 (Hlh transcription factor fer3-like 116 OS=Saccoglossus kowalevskii OX=10224 PE=2 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 5.300e-20
Identity = 58/81 (71.60%), Postives = 72/81 (88.89%), Query Frame = 2
Query: 1493 KPKRKRISTVXXXXXXXXXXXXXMYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELLNGKNADNISLVNYK 1735
            KPKR+R++TVAQRRAANIRER+RM++LNEAFD LRKRVPTFAYEKRLSRIETLRLAI YI FM ++++GK+  ++ L+  K
Sbjct:  157 KPKRRRVATVAQRRAANIRERKRMFNLNEAFDELRKRVPTFAYEKRLSRIETLRLAIVYIAFMGDIVSGKDEKDVKLMQIK 237          
BLAST of fer3l-1 protein vs. Ensembl Cavefish
Match: ferd3l (Fer3-like bHLH transcription factor [Source:ZFIN;Acc:ZDB-GENE-081104-461])

HSP 1 Score: 88.5817 bits (218), Expect = 2.512e-21
Identity = 53/68 (77.94%), Postives = 60/68 (88.24%), Query Frame = 2
Query: 1487 SNKPKRKRISTVXXXXXXXXXXXXXMYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTEL 1690
            S + +RKR+ T  QR+AANIRER+RM+SLNEAFD LRK+VPTFAYEKRLSRIETLRLAI YI FMTEL
Sbjct:    3 SGRSRRKRVITTVQRQAANIRERKRMFSLNEAFDELRKKVPTFAYEKRLSRIETLRLAIVYISFMTEL 70          
BLAST of fer3l-1 protein vs. Ensembl Cavefish
Match: si:dkey-34f9.3 (neurogenic differentiation factor 1-like [Source:NCBI gene;Acc:107197807])

HSP 1 Score: 61.6178 bits (148), Expect = 2.149e-10
Identity = 28/44 (63.64%), Postives = 34/44 (77.27%), Query Frame = 2
Query: 1562 MYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELL 1693
            M S+N AF+ LR  VPTF YEKRLS+I+TLRLAI YI  + E+L
Sbjct:  133 MLSINSAFEQLRCHVPTFPYEKRLSKIDTLRLAIAYIALLREIL 176          
BLAST of fer3l-1 protein vs. Ensembl Cavefish
Match: ptf1a (pancreas associated transcription factor 1a [Source:NCBI gene;Acc:103046795])

HSP 1 Score: 60.8474 bits (146), Expect = 5.672e-10
Identity = 26/44 (59.09%), Postives = 35/44 (79.55%), Query Frame = 2
Query: 1562 MYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELL 1693
            M S+N+AF+ LR  +PT  YEKRLS+++TLRLAI YI F+ EL+
Sbjct:  105 MQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLAELV 148          
BLAST of fer3l-1 protein vs. Ensembl Cavefish
Match: neurod6a (neuronal differentiation 6a [Source:NCBI gene;Acc:114414])

HSP 1 Score: 57.3806 bits (137), Expect = 1.689e-8
Identity = 29/57 (50.88%), Postives = 41/57 (71.93%), Query Frame = 2
Query: 1562 MYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELLN-GKNADNISLVN 1729
            M+ LN A DSLRK VP ++  ++LS+IETLRLA  YI  ++E+L+ GK  D +S V+
Sbjct:  113 MHGLNNALDSLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILSTGKRPDLLSFVH 169          
BLAST of fer3l-1 protein vs. Ensembl Cavefish
Match: neurod2 (neuronal differentiation 2 [Source:NCBI gene;Acc:114435])

HSP 1 Score: 57.3806 bits (137), Expect = 1.790e-8
Identity = 29/56 (51.79%), Postives = 40/56 (71.43%), Query Frame = 2
Query: 1562 MYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELL-NGKNADNISLV 1726
            M+ LN A D+LRK VP ++  ++LS+IETLRLA  YI  ++E+L NGK  D +S V
Sbjct:  124 MHDLNSALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRNGKRPDVVSYV 179          
BLAST of fer3l-1 protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004072.1 (pep scaffold:Pmarinus_7.0:GL492732:1750:4325:-1 gene:ENSPMAG00000003727.1 transcript:ENSPMAT00000004072.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.5438 bits (153), Expect = 1.825e-11
Identity = 26/45 (57.78%), Postives = 35/45 (77.78%), Query Frame = 2
Query: 1562 MYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELLN 1696
            M S+N AF+ LR  +PT  YEKRLS+++TLRLAI YI F+ EL++
Sbjct:  144 MQSINAAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYISFLGELVH 188          
BLAST of fer3l-1 protein vs. Ensembl Sea Lamprey
Match: si:dkey-34f9.3 (si:dkey-34f9.3 [Source:ZFIN;Acc:ZDB-GENE-081104-410])

HSP 1 Score: 59.3066 bits (142), Expect = 4.741e-11
Identity = 27/44 (61.36%), Postives = 34/44 (77.27%), Query Frame = 2
Query: 1562 MYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELL 1693
            M S+N AF+ LR  VPTF YEKRLS+I+TLRLAI YI  + ++L
Sbjct:   46 MLSINSAFEELRCHVPTFPYEKRLSKIDTLRLAIAYIALLRDIL 89          
BLAST of fer3l-1 protein vs. Ensembl Sea Lamprey
Match: neurod1 (neuronal differentiation 1 [Source:NCBI gene;Acc:30169])

HSP 1 Score: 53.9138 bits (128), Expect = 3.494e-8
Identity = 27/56 (48.21%), Postives = 39/56 (69.64%), Query Frame = 2
Query: 1562 MYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELLN-GKNADNISLV 1726
            M+ LN A D+LRK VP ++  ++LS+IETLRLA  YI  ++E+L  G + D +S V
Sbjct:   36 MHGLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRAGTSPDLLSFV 91          
BLAST of fer3l-1 protein vs. Ensembl Sea Lamprey
Match: TWIST1 (twist family bHLH transcription factor 1 [Source:HGNC Symbol;Acc:HGNC:12428])

HSP 1 Score: 48.1358 bits (113), Expect = 2.341e-7
Identity = 26/49 (53.06%), Postives = 34/49 (69.39%), Query Frame = 2
Query: 1568 SLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELLNGKNADN 1714
            SLNEAF SLRK +PT   +K LS+I+TL+LA  YI F+ ++L     DN
Sbjct:   23 SLNEAFASLRKIIPTLPSDK-LSKIQTLKLASRYIDFLYQVLQSDEMDN 70          
BLAST of fer3l-1 protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006843.1 (pep scaffold:Pmarinus_7.0:GL488467:178:1220:1 gene:ENSPMAG00000006182.1 transcript:ENSPMAT00000006843.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.2914 bits (116), Expect = 3.642e-7
Identity = 22/44 (50.00%), Postives = 31/44 (70.45%), Query Frame = 2
Query: 1562 MYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELL 1693
            M++LN+A D+LR  +PT   + RL++IETLR A  YI  +TE L
Sbjct:   56 MHNLNDALDALRGVLPTLPDDARLTKIETLRFAYNYIWVLTETL 99          
BLAST of fer3l-1 protein vs. Ensembl Nematostella
Match: EDO43849 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXI0])

HSP 1 Score: 65.4698 bits (158), Expect = 1.096e-13
Identity = 28/44 (63.64%), Postives = 37/44 (84.09%), Query Frame = 2
Query: 1562 MYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELL 1693
            M S+NEAF+ LRK +PT  YEKRLS+++TLRLAI YI F+TE++
Sbjct:   15 MQSINEAFEGLRKHIPTLPYEKRLSKVDTLRLAIGYIGFLTEMI 58          
BLAST of fer3l-1 protein vs. Ensembl Nematostella
Match: EDO36265 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ29])

HSP 1 Score: 51.2174 bits (121), Expect = 2.348e-7
Identity = 25/47 (53.19%), Postives = 35/47 (74.47%), Query Frame = 2
Query: 1562 MYSLNEAFDSLRKRVPTFAY--EKRLSRIETLRLAITYICFMTELLN 1696
            M+SLN+AFDSLRK +P   Y  E++ S+I TLRLAI YI  ++++L 
Sbjct:   80 MHSLNDAFDSLRKAIPKTNYNQEEKPSKIATLRLAIHYIAALSDILG 126          
BLAST of fer3l-1 protein vs. Ensembl Nematostella
Match: EDO42924 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZZ0])

HSP 1 Score: 45.0542 bits (105), Expect = 1.829e-6
Identity = 20/43 (46.51%), Postives = 33/43 (76.74%), Query Frame = 2
Query: 1565 YSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELL 1693
            +S+N AF++LR  +PT   +++LS+IETLRLA +YI  ++ +L
Sbjct:   15 HSVNAAFNALRLLIPTEPSDRKLSKIETLRLASSYIAHLSTIL 57          
BLAST of fer3l-1 protein vs. Ensembl Nematostella
Match: EDO38292 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDD5])

HSP 1 Score: 47.3654 bits (111), Expect = 2.154e-6
Identity = 20/49 (40.82%), Postives = 33/49 (67.35%), Query Frame = 2
Query: 1571 LNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELLNGKNADNI 1717
            +N+ F SLR+ +P F  +K+LS++ETLR A+ YI  +  L+   +A+ I
Sbjct:   86 VNDGFSSLRQHIPYFPEKKKLSKVETLRCAVAYIKHLQSLIEEYDAEKI 134          
BLAST of fer3l-1 protein vs. Ensembl Nematostella
Match: TWIST (Predicted protein; Twist family bHLH transcription factor [Source:UniProtKB/TrEMBL;Acc:Q6S5G7])

HSP 1 Score: 46.2098 bits (108), Expect = 3.297e-6
Identity = 23/43 (53.49%), Postives = 32/43 (74.42%), Query Frame = 2
Query: 1568 SLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELLN 1696
            +LNEAF+ LRK +PT   +K LS+I+TLRLA  YI F+ ++L 
Sbjct:   51 ALNEAFNKLRKIIPTLPSDK-LSKIQTLRLASRYIDFLCQVLG 92          
BLAST of fer3l-1 protein vs. Ensembl Medaka
Match: ferd3l (Fer3 like bHLH transcription factor [Source:NCBI gene;Acc:101167882])

HSP 1 Score: 88.5817 bits (218), Expect = 2.541e-21
Identity = 53/68 (77.94%), Postives = 61/68 (89.71%), Query Frame = 2
Query: 1490 NKPKRKRISTVXXXXXXXXXXXXXMYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELL 1693
             K +R+RI TV QR+AAN+RERRRM+SLNEAFD LR++VPTFAYEKRLSRIETLRLAI YI FMT+LL
Sbjct:    3 GKSRRRRIITVVQRQAANVRERRRMFSLNEAFDELRRKVPTFAYEKRLSRIETLRLAIVYISFMTDLL 70          
BLAST of fer3l-1 protein vs. Ensembl Medaka
Match: si:dkey-34f9.3 (si:dkey-34f9.3 [Source:ZFIN;Acc:ZDB-GENE-081104-410])

HSP 1 Score: 62.003 bits (149), Expect = 1.337e-10
Identity = 28/44 (63.64%), Postives = 34/44 (77.27%), Query Frame = 2
Query: 1562 MYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELL 1693
            M S+N AF+ LR  VPTF YEKRLS+I+TLRLAI YI  + E+L
Sbjct:  137 MLSINSAFEELRCHVPTFPYEKRLSKIDTLRLAIAYIALLREIL 180          
BLAST of fer3l-1 protein vs. Ensembl Medaka
Match: ptf1a (pancreas associated transcription factor 1a [Source:NCBI gene;Acc:101160350])

HSP 1 Score: 62.7734 bits (151), Expect = 2.052e-10
Identity = 26/44 (59.09%), Postives = 35/44 (79.55%), Query Frame = 2
Query: 1562 MYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELL 1693
            M S+N+AF+ LR  +PT  YEKRLS+++TLRLAI YI F+ EL+
Sbjct:  131 MQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLAELV 174          
BLAST of fer3l-1 protein vs. Ensembl Medaka
Match: neurod1 (neuronal differentiation 1 [Source:NCBI gene;Acc:101157169])

HSP 1 Score: 57.3806 bits (137), Expect = 1.679e-8
Identity = 28/57 (49.12%), Postives = 42/57 (73.68%), Query Frame = 2
Query: 1562 MYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELL-NGKNADNISLVN 1729
            M+ LN+A +SLRK VP ++  ++LS+IETLRLA  YI  ++E+L +GK  D +S V+
Sbjct:  103 MHGLNDALESLRKVVPCYSKTQKLSKIETLRLAKNYIWTLSEILRSGKAPDLMSFVH 159          
BLAST of fer3l-1 protein vs. Ensembl Medaka
Match: neurod2 (neurogenic differentiation factor 2 [Source:NCBI gene;Acc:101171533])

HSP 1 Score: 56.9954 bits (136), Expect = 2.272e-8
Identity = 29/56 (51.79%), Postives = 39/56 (69.64%), Query Frame = 2
Query: 1562 MYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELL-NGKNADNISLV 1726
            M+ LN A D+LRK VP ++  ++LS+IETLRLA  YI  + E+L NGK  D +S V
Sbjct:  116 MHDLNSALDNLRKVVPCYSKTQKLSKIETLRLAKNYILALGEILRNGKRPDVVSYV 171          
BLAST of fer3l-1 protein vs. Planmine SMEST
Match: SMESG000028999.1 (SMESG000028999.1)

HSP 1 Score: 579.326 bits (1492), Expect = 0.000e+0
Identity = 308/309 (99.68%), Postives = 309/309 (100.00%), Query Frame = 3
Query:   39 MNDFNKNEPISMLFSELFYFIATLKAIYYNNISDWDVVKIKNCIKRSKQCKKLGHFIHNNYQVEIISELYKKIQMLTPDVQWTSYGSNYLLHLDEICLQNIIENESINDNXXXXXXXXXXXXXXXXXXESFDSIQNEVNKLLVKLPESVRNRLINEFQMEIFSNHCQQLQNENIPIESWLNILFINNKYTAINSLSKFLVNEIWDFYDVIENWFIDKLISDKRLIFSTDHEALVNLCGKKPKFKSILIDSLLDAQILYCGNPETGKSEFPEKIMTFYEFKSVCQNFKADIMNCSLIKSNRNSEFFSSLL 965
            MNDFNKNEPISMLFSELFYFIATLKAIYYNNISDWDVVKIKNCIKRSKQCKKLGHFIHNNYQVEIISELYKKIQMLTPDVQWTSYGSNYLLHLDEICLQNIIENESINDNVKLYVSKKLSRLKRSESYESFDSIQNEVNKLLVKLPESVRNRLINEFQMEIFSNHCQQLQNENIPIESWLNILFINNKYTAINSLSKFLVNEIWDFYDV+ENWFIDKLISDKRLIFSTDHEALVNLCGKKPKFKSILIDSLLDAQILYCGNPETGKSEFPEKIMTFYEFKSVCQNFKADIMNCSLIKSNRNSEFFSSLL
Sbjct:    1 MNDFNKNEPISMLFSELFYFIATLKAIYYNNISDWDVVKIKNCIKRSKQCKKLGHFIHNNYQVEIISELYKKIQMLTPDVQWTSYGSNYLLHLDEICLQNIIENESINDNVKLYVSKKLSRLKRSESYESFDSIQNEVNKLLVKLPESVRNRLINEFQMEIFSNHCQQLQNENIPIESWLNILFINNKYTAINSLSKFLVNEIWDFYDVLENWFIDKLISDKRLIFSTDHEALVNLCGKKPKFKSILIDSLLDAQILYCGNPETGKSEFPEKIMTFYEFKSVCQNFKADIMNCSLIKSNRNSEFFSSLL 309          
BLAST of fer3l-1 protein vs. Planmine SMEST
Match: SMESG000029000.1 (SMESG000029000.1)

HSP 1 Score: 413.305 bits (1061), Expect = 1.553e-142
Identity = 230/233 (98.71%), Postives = 233/233 (100.00%), Query Frame = 2
Query: 1094 MNFATDYMYYSVNNSFNEDELSQNQEPQFMFFDQCYIPYSAINNADNPSDRSGVTIPRSSVLQYPVFDENCQISLQELYTXXXXXXXXXXQIPAVMNDNNSRYSSASSEFYTSPDNKIIIQSNIAENSPNPSNKPKRKRISTVXXXXXXXXXXXXXMYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELLNGKNADNISLVNYKRIVGSTDSSRFSLLKSSEA 1792
            MNFATDYMYYSVNNSFNEDEL+QNQEPQFMFFDQCYIPYSAINNADNPSDRSGVTIPRSSVLQYPVFDENCQISL+ELYTNNNESNISNSQIPAVMNDNNSR+SSASSEFYTSPDNKIIIQSNIAENSPNPSNKPKRKRISTVAQRRAANIRERRRMYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELLNGKNADNISLVNYKRIVGSTDSSRFSLLKSSEA
Sbjct:    1 MNFATDYMYYSVNNSFNEDELNQNQEPQFMFFDQCYIPYSAINNADNPSDRSGVTIPRSSVLQYPVFDENCQISLEELYTNNNESNISNSQIPAVMNDNNSRFSSASSEFYTSPDNKIIIQSNIAENSPNPSNKPKRKRISTVAQRRAANIRERRRMYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELLNGKNADNISLVNYKRIVGSTDSSRFSLLKSSEA 233          
BLAST of fer3l-1 protein vs. Planmine SMEST
Match: SMESG000029000.1 (SMESG000029000.1)

HSP 1 Score: 398.282 bits (1022), Expect = 7.956e-137
Identity = 223/226 (98.67%), Postives = 226/226 (100.00%), Query Frame = 2
Query: 1115 MYYSVNNSFNEDELSQNQEPQFMFFDQCYIPYSAINNADNPSDRSGVTIPRSSVLQYPVFDENCQISLQELYTXXXXXXXXXXQIPAVMNDNNSRYSSASSEFYTSPDNKIIIQSNIAENSPNPSNKPKRKRISTVXXXXXXXXXXXXXMYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELLNGKNADNISLVNYKRIVGSTDSSRFSLLKSSEA 1792
            MYYSVNNSFNEDEL+QNQEPQFMFFDQCYIPYSAINNADNPSDRSGVTIPRSSVLQYPVFDENCQISL+ELYTNNNESNISNSQIPAVMNDNNSR+SSASSEFYTSPDNKIIIQSNIAENSPNPSNKPKRKRISTVAQRRAANIRERRRMYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELLNGKNADNISLVNYKRIVGSTDSSRFSLLKSSEA
Sbjct:    1 MYYSVNNSFNEDELNQNQEPQFMFFDQCYIPYSAINNADNPSDRSGVTIPRSSVLQYPVFDENCQISLEELYTNNNESNISNSQIPAVMNDNNSRFSSASSEFYTSPDNKIIIQSNIAENSPNPSNKPKRKRISTVAQRRAANIRERRRMYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELLNGKNADNISLVNYKRIVGSTDSSRFSLLKSSEA 226          
BLAST of fer3l-1 protein vs. Planmine SMEST
Match: SMESG000019274.1 (SMESG000019274.1)

HSP 1 Score: 87.4261 bits (215), Expect = 1.104e-19
Identity = 56/74 (75.68%), Postives = 64/74 (86.49%), Query Frame = 2
Query: 1472 NSPNPSNKPKRKRISTVXXXXXXXXXXXXXMYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELL 1693
            NS N S+KPKR+R +T+ QR AANIRERRRM +LN+AFD LR+ VPTFAYEK+LSRIETLRLAITYI FMTE L
Sbjct:   98 NSSNNSDKPKRRRTTTIEQRHAANIRERRRMNNLNKAFDRLRQLVPTFAYEKQLSRIETLRLAITYISFMTEQL 171          
BLAST of fer3l-1 protein vs. Planmine SMEST
Match: SMESG000062901.1 (SMESG000062901.1)

HSP 1 Score: 69.707 bits (169), Expect = 4.124e-14
Identity = 46/69 (66.67%), Postives = 55/69 (79.71%), Query Frame = 2
Query: 1493 KPKRKRISTVXXXXXXXXXXXXXMYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELLNG 1699
            K KR+R  + A R AANIRER+RM +LN AF++LR +VPTF +EKRLSRIETLRLAI YI FM  +LNG
Sbjct:   42 KQKRRRNKSTAHRTAANIRERKRMINLNAAFENLRLKVPTFVFEKRLSRIETLRLAIAYIKFMECILNG 110          
The following BLAST results are available for this feature:
BLAST of fer3l-1 protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FERD3L8.522e-2078.26Fer3 like bHLH transcription factor [Source:HGNC S... [more]
PTF1A7.702e-1057.78pancreas associated transcription factor 1a [Sourc... [more]
NEUROD12.768e-850.00neuronal differentiation 1 [Source:HGNC Symbol;Acc... [more]
NEUROD61.601e-748.21neuronal differentiation 6 [Source:HGNC Symbol;Acc... [more]
NEUROD22.481e-750.00neuronal differentiation 2 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of fer3l-1 protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
hlh-132.723e-756.82Helix-loop-helix protein 13 [Source:UniProtKB/Swi... [more]
hlh-158.993e-651.16Helix Loop Helix [Source:UniProtKB/TrEMBL;Acc:Q18... [more]
back to top
BLAST of fer3l-1 protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fer38.110e-2080.30gene:FBgn0037937 transcript:FBtr0082435[more]
Fer15.665e-1154.93gene:FBgn0037475 transcript:FBtr0081567[more]
Fer17.132e-1154.93gene:FBgn0037475 transcript:FBtr0334670[more]
Fer24.155e-1066.67gene:FBgn0038402 transcript:FBtr0344012[more]
Fer24.275e-1066.67gene:FBgn0038402 transcript:FBtr0301709[more]
back to top
BLAST of fer3l-1 protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ferd3l1.706e-2179.10Fer3-like bHLH transcription factor [Source:ZFIN;A... [more]
si:dkey-34f9.39.202e-1163.64si:dkey-34f9.3 [Source:ZFIN;Acc:ZDB-GENE-081104-41... [more]
ptf1a3.843e-1059.09pancreas associated transcription factor 1a [Sourc... [more]
neurod21.948e-851.79neuronal differentiation 2 [Source:NCBI gene;Acc:1... [more]
neurod12.218e-850.00neuronal differentiation 1 [Source:NCBI gene;Acc:3... [more]
back to top
BLAST of fer3l-1 protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ferd3l7.113e-2274.36Fer3-like bHLH transcription factor [Source:NCBI g... [more]
ENSXETT00000031930.12.054e-1162.22pep primary_assembly:Xenopus_tropicalis_v9.1:9:556... [more]
PTF1A9.475e-1059.09pancreas associated transcription factor 1a [Sourc... [more]
neurod13.258e-850.00neuronal differentiation 1 [Source:NCBI gene;Acc:1... [more]
neurod61.270e-748.21neuronal differentiation 6 [Source:NCBI gene;Acc:7... [more]
back to top
BLAST of fer3l-1 protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ferd3l7.212e-2172.73Fer3 like bHLH transcription factor [Source:MGI Sy... [more]
Ptf1a6.446e-1059.09pancreas specific transcription factor, 1a [Source... [more]
Neurod11.716e-850.00neurogenic differentiation 1 [Source:MGI Symbol;Ac... [more]
Neurod61.070e-748.21neurogenic differentiation 6 [Source:MGI Symbol;Ac... [more]
Neurod21.621e-750.00neurogenic differentiation 2 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of fer3l-1 protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q923Z4|FER3L_MOUSE5.045e-2072.73Fer3-like protein OS=Mus musculus OX=10090 GN=Ferd... [more]
sp|Q96RJ6|FER3L_HUMAN4.092e-1978.26Fer3-like protein OS=Homo sapiens OX=9606 GN=FERD3... [more]
sp|Q9VGJ5|FER3_DROME8.130e-1980.30Protein Fer3 OS=Drosophila melanogaster OX=7227 GN... [more]
sp|Q7ZSX3|PTF1A_DANRE2.901e-959.09Pancreas transcription factor 1 subunit alpha OS=D... [more]
sp|Q7RTS3|PTF1A_HUMAN3.699e-957.78Pancreas transcription factor 1 subunit alpha OS=H... [more]
back to top
BLAST of fer3l-1 protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
U5YTA68.323e-10198.90Fer3l-1 protein (Fragment) OS=Schmidtea mediterran... [more]
A0A5N4A3725.852e-2170.45Uncharacterized protein OS=Photinus pyralis OX=705... [more]
A0A444TVV62.958e-2059.81Fer3-like protein OS=Acipenser ruthenus OX=7906 GN... [more]
A0A402ENE03.784e-2076.32BHLH domain-containing protein OS=Paroedura picta ... [more]
A0A0U2T2J55.300e-2071.60Hlh transcription factor fer3-like 116 OS=Saccoglo... [more]
back to top
BLAST of fer3l-1 protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ferd3l2.512e-2177.94Fer3-like bHLH transcription factor [Source:ZFIN;A... [more]
si:dkey-34f9.32.149e-1063.64neurogenic differentiation factor 1-like [Source:N... [more]
ptf1a5.672e-1059.09pancreas associated transcription factor 1a [Sourc... [more]
neurod6a1.689e-850.88neuronal differentiation 6a [Source:NCBI gene;Acc:... [more]
neurod21.790e-851.79neuronal differentiation 2 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of fer3l-1 protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004072.11.825e-1157.78pep scaffold:Pmarinus_7.0:GL492732:1750:4325:-1 ge... [more]
si:dkey-34f9.34.741e-1161.36si:dkey-34f9.3 [Source:ZFIN;Acc:ZDB-GENE-081104-41... [more]
neurod13.494e-848.21neuronal differentiation 1 [Source:NCBI gene;Acc:3... [more]
TWIST12.341e-753.06twist family bHLH transcription factor 1 [Source:H... [more]
ENSPMAT00000006843.13.642e-750.00pep scaffold:Pmarinus_7.0:GL488467:178:1220:1 gene... [more]
back to top
BLAST of fer3l-1 protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of fer3l-1 protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO438491.096e-1363.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362652.348e-753.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO429241.829e-646.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO382922.154e-640.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
TWIST3.297e-653.49Predicted protein; Twist family bHLH transcription... [more]
back to top
BLAST of fer3l-1 protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ferd3l2.541e-2177.94Fer3 like bHLH transcription factor [Source:NCBI g... [more]
si:dkey-34f9.31.337e-1063.64si:dkey-34f9.3 [Source:ZFIN;Acc:ZDB-GENE-081104-41... [more]
ptf1a2.052e-1059.09pancreas associated transcription factor 1a [Sourc... [more]
neurod11.679e-849.12neuronal differentiation 1 [Source:NCBI gene;Acc:1... [more]
neurod22.272e-851.79neurogenic differentiation factor 2 [Source:NCBI g... [more]
back to top
BLAST of fer3l-1 protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000028999.10.000e+099.68SMESG000028999.1[more]
SMESG000029000.11.553e-14298.71SMESG000029000.1[more]
SMESG000029000.17.956e-13798.67SMESG000029000.1[more]
SMESG000019274.11.104e-1975.68SMESG000019274.1[more]
SMESG000062901.14.124e-1466.67SMESG000062901.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30016826
GenBankAGZ94909.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016826 ID=SMED30016826|Name=fer3l-1 protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1839bp
GTTTGTTTAAATATTATATATAGTTCATTACTAATTAGATGAATGATTTT
AATAAGAATGAACCGATTTCTATGCTATTTTCCGAATTATTTTATTTTAT
AGCAACTTTGAAGGCAATTTATTATAATAATATAAGTGACTGGGATGTCG
TAAAAATAAAGAATTGTATTAAAAGATCAAAACAATGCAAGAAATTAGGT
CATTTCATTCACAATAATTATCAAGTTGAAATTATTTCTGAGTTATATAA
AAAAATTCAAATGCTAACTCCTGATGTGCAATGGACGTCATATGGAAGCA
ATTACTTGTTGCATTTAGATGAAATATGCTTACAGAATATTATCGAAAAT
GAATCAATAAATGACAATGTAAAACTATATGTATCAAAAAAATTGTCTAG
ATTAAAACGTTCTGAATCATATGAAAGTTTTGATTCGATTCAAAACGAAG
TAAATAAATTATTAGTAAAACTACCAGAATCTGTTAGAAATAGATTAATT
AACGAGTTTCAAATGGAAATATTTTCAAACCACTGTCAACAATTACAAAA
TGAAAATATCCCTATTGAATCTTGGTTAAATATATTATTCATTAATAATA
AATACACAGCTATTAACTCATTGTCAAAATTTCTGGTCAACGAAATTTGG
GATTTTTATGATGTTATAGAAAACTGGTTCATTGACAAACTTATATCAGA
CAAGAGATTAATATTCTCTACTGATCATGAAGCTCTCGTCAACTTATGTG
GGAAAAAACCAAAATTTAAATCTATTCTAATTGATAGTTTATTAGATGCT
CAAATTTTATACTGTGGAAATCCTGAAACGGGAAAATCTGAATTCCCTGA
AAAAATAATGACATTCTATGAATTCAAATCTGTTTGCCAGAATTTCAAAG
CCGATATTATGAATTGTAGCTTGATTAAATCCAATCGAAATTCTGAATTT
TTTAGCTCTTTGTTATAATATATTTCGTGTTGTCTTTTTCTCTTTAATAT
TATTGGTTAAATTTGTTGCAGCGGTGAAATATCCAATCAAATCGCTGTAA
TTATTTCGTATAATAATGAAAATAATTATCTGATTGGTATAGAATGAATT
TTGCAACGGATTATATGTATTATTCAGTAAATAACTCGTTTAATGAGGAT
GAATTAAGTCAAAATCAGGAACCTCAATTTATGTTTTTTGATCAATGTTA
TATACCATATTCAGCAATTAATAATGCCGATAATCCATCAGATAGATCCG
GAGTCACAATACCAAGATCCAGTGTATTGCAATACCCAGTATTTGATGAA
AATTGTCAGATTTCTCTTCAAGAGTTGTATACTAATAATAATGAATCGAA
TATATCCAATTCTCAAATCCCTGCTGTAATGAATGATAATAATTCTCGAT
ACAGTTCCGCAAGCAGTGAATTCTACACCTCGCCAGACAATAAAATTATT
ATTCAATCAAACATAGCCGAGAATTCACCAAATCCTTCAAATAAACCGAA
ACGAAAAAGAATTTCAACAGTGGCCCAGCGTCGAGCAGCAAATATCAGAG
AACGTCGACGCATGTACAGTTTAAATGAAGCATTTGATAGTTTACGTAAA
AGAGTTCCAACATTTGCTTATGAAAAACGTTTATCTCGCATTGAAACTTT
AAGACTAGCAATCACATATATTTGTTTCATGACTGAACTTTTGAACGGCA
AAAATGCAGACAACATCAGCTTGGTGAATTACAAAAGAATTGTTGGTAGC
ACTGATTCTAGTAGATTTTCACTCTTGAAATCGTCAGAAGCATAAATATA
TAATTTTTGTTTAAATAAATAGACTTAACTACAAAAAAA
back to top

protein sequence of SMED30016826-orf-1

>SMED30016826-orf-1 ID=SMED30016826-orf-1|Name=SMED30016826-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=310bp
MNDFNKNEPISMLFSELFYFIATLKAIYYNNISDWDVVKIKNCIKRSKQC
KKLGHFIHNNYQVEIISELYKKIQMLTPDVQWTSYGSNYLLHLDEICLQN
IIENESINDNVKLYVSKKLSRLKRSESYESFDSIQNEVNKLLVKLPESVR
NRLINEFQMEIFSNHCQQLQNENIPIESWLNILFINNKYTAINSLSKFLV
NEIWDFYDVIENWFIDKLISDKRLIFSTDHEALVNLCGKKPKFKSILIDS
LLDAQILYCGNPETGKSEFPEKIMTFYEFKSVCQNFKADIMNCSLIKSNR
NSEFFSSLL*
back to top

protein sequence of SMED30016826-orf-2

>SMED30016826-orf-2 ID=SMED30016826-orf-2|Name=SMED30016826-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=234bp
MNFATDYMYYSVNNSFNEDELSQNQEPQFMFFDQCYIPYSAINNADNPSD
RSGVTIPRSSVLQYPVFDENCQISLQELYTNNNESNISNSQIPAVMNDNN
SRYSSASSEFYTSPDNKIIIQSNIAENSPNPSNKPKRKRISTVAQRRAAN
IRERRRMYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELL
NGKNADNISLVNYKRIVGSTDSSRFSLLKSSEA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000103central nervous system
PLANA:0000120progenitor cell
PLANA:0000121stem cell
PLANA:0000418head
PLANA:0000419prepharyngeal region
PLANA:0002109X1 cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR011598bHLH_dom
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
GO:0003677DNA binding
GO:0046982protein heterodimerization activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0007275multicellular organism development
GO:0007399nervous system development
GO:0030154cell differentiation
GO:0048666neuron development
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 10..32