Serine/threonine-protein kinase Nek4

Overview
NameSerine/threonine-protein kinase Nek4
Smed IDSMED30016820
Length (bp)2228
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/threonine-protein kinase Nek4 (SMED30016820) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/threonine-protein kinase Nek4 (SMED30016820) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine/threonine-protein kinase Nek4 (SMED30016820) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine/threonine-protein kinase Nek4 (SMED30016820) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016820

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30016820h1SMcG0014384 SmedASXL_016779SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30016820h1SMcG0014384 dd_Smed_v4_11387_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30016820h1SMcG0014384 dd_Smed_v4_11387_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30016820h1SMcG0014384 dd_Smed_v4_11387_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30016820h1SMcG0014384 dd_Smed_v4_11387_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30016820h1SMcG0014384 dd_Smed_v4_11387_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Human
Match: NEK4 (NIMA related kinase 4 [Source:HGNC Symbol;Acc:HGNC:11399])

HSP 1 Score: 339.732 bits (870), Expect = 1.063e-104
Identity = 159/274 (58.03%), Postives = 206/274 (75.18%), Query Frame = 3
Query:  120 YSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSL-YIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTKS-IIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFVEQSKRKFDK 935
            Y +++ +G+GSYGEV LVKH+  D K++V+KK++   +S RE  AA  E QLL  L+HPNIV YK+S+E  + L YI M FCE GDLY +LKE+KG LL E Q++EW +QI MAL Y+HE++ILHRDLKTQN+FLT++ IIK+GDLGIA+ LE+  DMA T+IGTPYYMSPELF  KPYN+KSD+W+LGC  YEMATLKHAFNAK+  +L Y+I+ G+ P MP  Y+ EL  LI+ ML+K PE+RPS   IL   +I+  I  F+E +K K  K
Sbjct:    6 YCYLRVVGKGSYGEVTLVKHR-RDGKQYVIKKLNLRNASSRERRAAEQEAQLLSQLKHPNIVTYKESWEGGDGLLYIVMGFCEGGDLYRKLKEQKGQLLPENQVVEWFVQIAMALQYLHEKHILHRDLKTQNVFLTRTNIIKVGDLGIARVLENHCDMASTLIGTPYYMSPELFSNKPYNYKSDVWALGCCVYEMATLKHAFNAKDMNSLVYRIIEGKLPPMPRDYSPELAELIRTMLSKRPEERPSVRSILRQPYIKRQISFFLEATKIKTSK 278          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Human
Match: NEK4 (NIMA related kinase 4 [Source:HGNC Symbol;Acc:HGNC:11399])

HSP 1 Score: 339.732 bits (870), Expect = 3.356e-104
Identity = 159/274 (58.03%), Postives = 206/274 (75.18%), Query Frame = 3
Query:  120 YSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSL-YIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTKS-IIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFVEQSKRKFDK 935
            Y +++ +G+GSYGEV LVKH+  D K++V+KK++   +S RE  AA  E QLL  L+HPNIV YK+S+E  + L YI M FCE GDLY +LKE+KG LL E Q++EW +QI MAL Y+HE++ILHRDLKTQN+FLT++ IIK+GDLGIA+ LE+  DMA T+IGTPYYMSPELF  KPYN+KSD+W+LGC  YEMATLKHAFNAK+  +L Y+I+ G+ P MP  Y+ EL  LI+ ML+K PE+RPS   IL   +I+  I  F+E +K K  K
Sbjct:    6 YCYLRVVGKGSYGEVTLVKHR-RDGKQYVIKKLNLRNASSRERRAAEQEAQLLSQLKHPNIVTYKESWEGGDGLLYIVMGFCEGGDLYRKLKEQKGQLLPENQVVEWFVQIAMALQYLHEKHILHRDLKTQNVFLTRTNIIKVGDLGIARVLENHCDMASTLIGTPYYMSPELFSNKPYNYKSDVWALGCCVYEMATLKHAFNAKDMNSLVYRIIEGKLPPMPRDYSPELAELIRTMLSKRPEERPSVRSILRQPYIKRQISFFLEATKIKTSK 278          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Human
Match: NEK1 (NIMA related kinase 1 [Source:HGNC Symbol;Acc:HGNC:7744])

HSP 1 Score: 280.411 bits (716), Expect = 3.412e-80
Identity = 129/264 (48.86%), Postives = 185/264 (70.08%), Query Frame = 3
Query:  120 YSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTK-SIIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFV 908
            Y  ++KIG+GS+G+  LVK  + D +++V+K+I+ +R S +E E +R E  +L +++HPNIVQY++SFEEN SLYI M +CE GDL+ R+  +KG L  E QI++W +QI +AL ++H+R ILHRD+K+QNIFLTK   +++GD GIA+ L S  ++A+T IGTPYY+SPE+ E KPYN KSDIW+LGCV YE+ TLKHAF A +   L  KI+ G  P +   Y+ +L +L+  +  ++P  RPS   IL   FI   I  F+
Sbjct:    4 YVRLQKIGEGSFGKAILVKSTE-DGRQYVIKEINISRMSSKEREESRREVAVLANMKHPNIVQYRESFEENGSLYIVMDYCEGGDLFKRINAQKGVLFQEDQILDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDGTVQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENKPYNNKSDIWALGCVLYELCTLKHAFEAGSMKNLVLKIISGSFPPVSLHYSYDLRSLVSQLFKRNPRDRPSVNSILEKGFIAKRIEKFL 266          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Human
Match: NEK1 (NIMA related kinase 1 [Source:HGNC Symbol;Acc:HGNC:7744])

HSP 1 Score: 280.411 bits (716), Expect = 4.555e-80
Identity = 129/264 (48.86%), Postives = 185/264 (70.08%), Query Frame = 3
Query:  120 YSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTK-SIIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFV 908
            Y  ++KIG+GS+G+  LVK  + D +++V+K+I+ +R S +E E +R E  +L +++HPNIVQY++SFEEN SLYI M +CE GDL+ R+  +KG L  E QI++W +QI +AL ++H+R ILHRD+K+QNIFLTK   +++GD GIA+ L S  ++A+T IGTPYY+SPE+ E KPYN KSDIW+LGCV YE+ TLKHAF A +   L  KI+ G  P +   Y+ +L +L+  +  ++P  RPS   IL   FI   I  F+
Sbjct:    4 YVRLQKIGEGSFGKAILVKSTE-DGRQYVIKEINISRMSSKEREESRREVAVLANMKHPNIVQYRESFEENGSLYIVMDYCEGGDLFKRINAQKGVLFQEDQILDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDGTVQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENKPYNNKSDIWALGCVLYELCTLKHAFEAGSMKNLVLKIISGSFPPVSLHYSYDLRSLVSQLFKRNPRDRPSVNSILEKGFIAKRIEKFL 266          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Human
Match: NEK1 (NIMA related kinase 1 [Source:HGNC Symbol;Acc:HGNC:7744])

HSP 1 Score: 280.026 bits (715), Expect = 4.733e-80
Identity = 129/264 (48.86%), Postives = 185/264 (70.08%), Query Frame = 3
Query:  120 YSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTK-SIIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFV 908
            Y  ++KIG+GS+G+  LVK  + D +++V+K+I+ +R S +E E +R E  +L +++HPNIVQY++SFEEN SLYI M +CE GDL+ R+  +KG L  E QI++W +QI +AL ++H+R ILHRD+K+QNIFLTK   +++GD GIA+ L S  ++A+T IGTPYY+SPE+ E KPYN KSDIW+LGCV YE+ TLKHAF A +   L  KI+ G  P +   Y+ +L +L+  +  ++P  RPS   IL   FI   I  F+
Sbjct:    4 YVRLQKIGEGSFGKAILVKSTE-DGRQYVIKEINISRMSSKEREESRREVAVLANMKHPNIVQYRESFEENGSLYIVMDYCEGGDLFKRINAQKGVLFQEDQILDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDGTVQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENKPYNNKSDIWALGCVLYELCTLKHAFEAGSMKNLVLKIISGSFPPVSLHYSYDLRSLVSQLFKRNPRDRPSVNSILEKGFIAKRIEKFL 266          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Celegans
Match: nekl-2 (Serine/threonine-protein kinase nekl-2 [Source:UniProtKB/Swiss-Prot;Acc:O01775])

HSP 1 Score: 190.66 bits (483), Expect = 4.968e-54
Identity = 102/293 (34.81%), Postives = 170/293 (58.02%), Query Frame = 3
Query:  117 NYSFIKKIGQGSYGEVWLVKHK-DYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKG-------SLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLT--KSIIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFVEQSKRKFDKPCRHRKTSLS 965
            NY  ++ +G+G++G  WL + K D  H+K ++K I+    +++E  + + E  LLK ++HP I+ Y DSF  +N L I M + E G L   + +++            EK ++++  QI +AL+++H++NI+HRDLK QNI +   K+++K+ D GI+K+L +K   A TVIGTP Y+SPE+ E +PYN KSD+WSLGCV YE+  L+ AF+ +N  A+  KI   +   +    + ++  L++ +L    +KRP   ++L +  +  ++        R    P   RK S S
Sbjct:    3 NYEKVRVVGRGAFGVCWLCRGKNDASHQKVIIKLINTHGMTEKEENSIQSEVNLLKKVQHPLIIGYIDSFIMDNQLGIVMQYAEGGTLERLINDQRAIKDSNMREYFPEKTVLDYFTQILIALNHMHQKNIVHRDLKPQNILMNRRKTVLKLSDFGISKELGTK-SAASTVIGTPNYLSPEICESRPYNQKSDMWSLGCVLYELLQLERAFDGENLPAIVMKITRSKQNPLGDHVSNDVKMLVENLLKTHTDKRPDVSQLLSDPLVLPYLISIHCDLGRIEPPPTDKRKPSAS 294          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Celegans
Match: nekl-1 (NEK (NEver in mitosis Kinase) Like [Source:UniProtKB/TrEMBL;Acc:A0A061AD48])

HSP 1 Score: 195.667 bits (496), Expect = 4.601e-52
Identity = 103/253 (40.71%), Postives = 153/253 (60.47%), Query Frame = 3
Query:  120 YSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTK-SIIKIGDLGIAKQL--ESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKIL 869
            Y  I+ +G+G++G   L + ++ D    ++K+I+       +   A  E  LL  +EHPNI+ Y DSFEE   L I M + + G L  ++  R  +LL E+QI + +IQ+  A++Y+HE ++LHRDLKT N+FLT+ S +KIGD GI+K +  E+    AKTV+GTPYY+SPE+     YN KSD+W+LGC+ YEM  LK AF   N  AL   I+      +   Y+ E+  +I+ +L   P+KRPS  + L
Sbjct:  171 YERIRTVGKGAFGSAVLYRRRE-DSSLVIIKEINMYDLDSSQRRLALNEVSLLSRIEHPNIIAYYDSFEEEGVLMIEMEYADGGTL-AQMLSRTQNLLDEEQIGDMMIQMCSAVAYLHENSVLHRDLKTANVFLTRDSFVKIGDFGISKIMGTETLAQGAKTVVGTPYYISPEMCSGVSYNEKSDMWALGCILYEMCCLKKAFEGDNLPALVNSIMTCAYTPVKGPYSAEMKMVIRELLQLDPQKRPSAPQAL 421          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Celegans
Match: nekl-1 (NEK (NEver in mitosis Kinase) Like [Source:UniProtKB/TrEMBL;Acc:A0A061AD48])

HSP 1 Score: 195.667 bits (496), Expect = 4.815e-52
Identity = 103/253 (40.71%), Postives = 153/253 (60.47%), Query Frame = 3
Query:  120 YSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTK-SIIKIGDLGIAKQL--ESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKIL 869
            Y  I+ +G+G++G   L + ++ D    ++K+I+       +   A  E  LL  +EHPNI+ Y DSFEE   L I M + + G L  ++  R  +LL E+QI + +IQ+  A++Y+HE ++LHRDLKT N+FLT+ S +KIGD GI+K +  E+    AKTV+GTPYY+SPE+     YN KSD+W+LGC+ YEM  LK AF   N  AL   I+      +   Y+ E+  +I+ +L   P+KRPS  + L
Sbjct:  133 YERIRTVGKGAFGSAVLYRRRE-DSSLVIIKEINMYDLDSSQRRLALNEVSLLSRIEHPNIIAYYDSFEEEGVLMIEMEYADGGTL-AQMLSRTQNLLDEEQIGDMMIQMCSAVAYLHENSVLHRDLKTANVFLTRDSFVKIGDFGISKIMGTETLAQGAKTVVGTPYYISPEMCSGVSYNEKSDMWALGCILYEMCCLKKAFEGDNLPALVNSIMTCAYTPVKGPYSAEMKMVIRELLQLDPQKRPSAPQAL 383          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Celegans
Match: nekl-3 (Serine/threonine-protein kinase nekl-3 [Source:UniProtKB/Swiss-Prot;Acc:G5EFM9])

HSP 1 Score: 172.94 bits (437), Expect = 2.480e-48
Identity = 99/256 (38.67%), Postives = 151/256 (58.98%), Query Frame = 3
Query:  132 KKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLEC----QLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERK--GSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLT-KSIIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAF--NAKNYTALSYKILMGQTPDMPSK-YNKELINLIQAMLNKSPEKRPSTGKIL 869
            KKIG+G + EV+  +    D     LKKI      D++   AR +C     LLK L H N+++Y  SF +NN L I +   E+GD+   +K  K  G L+ EK I ++ +Q+  AL+++H + I+HRD+K  N+F+T   I+K+GDLG+ +   SK   A +++GTPYYMSPE  ++  YNFKSD+WS GC+ YEMA L+  F  +  N  +L  KI   + P +P+  Y+ +L +L+   +     KRP T ++L
Sbjct:   27 KKIGKGQFSEVFRAQCTWVD-LHVALKKIQVFEMVDQK---ARQDCLKEIDLLKQLNHVNVIRYYASFIDNNQLNIVLELAEAGDMSRMIKHFKKGGRLIPEKTIWKYFVQLARALAHMHSKRIMHRDIKPANVFITGNGIVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIQESGYNFKSDLWSTGCLLYEMAALQSPFYGDKMNLYSLCKKIENCEYPPLPADIYSTQLRDLVSRCILPEASKRPETSEVL 278          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Celegans
Match: nekl-3 (Serine/threonine-protein kinase nekl-3 [Source:UniProtKB/Swiss-Prot;Acc:G5EFM9])

HSP 1 Score: 172.94 bits (437), Expect = 2.480e-48
Identity = 99/256 (38.67%), Postives = 151/256 (58.98%), Query Frame = 3
Query:  132 KKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLEC----QLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERK--GSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLT-KSIIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAF--NAKNYTALSYKILMGQTPDMPSK-YNKELINLIQAMLNKSPEKRPSTGKIL 869
            KKIG+G + EV+  +    D     LKKI      D++   AR +C     LLK L H N+++Y  SF +NN L I +   E+GD+   +K  K  G L+ EK I ++ +Q+  AL+++H + I+HRD+K  N+F+T   I+K+GDLG+ +   SK   A +++GTPYYMSPE  ++  YNFKSD+WS GC+ YEMA L+  F  +  N  +L  KI   + P +P+  Y+ +L +L+   +     KRP T ++L
Sbjct:   27 KKIGKGQFSEVFRAQCTWVD-LHVALKKIQVFEMVDQK---ARQDCLKEIDLLKQLNHVNVIRYYASFIDNNQLNIVLELAEAGDMSRMIKHFKKGGRLIPEKTIWKYFVQLARALAHMHSKRIMHRDIKPANVFITGNGIVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIQESGYNFKSDLWSTGCLLYEMAALQSPFYGDKMNLYSLCKKIENCEYPPLPADIYSTQLRDLVSRCILPEASKRPETSEVL 278          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Fly
Match: niki (gene:FBgn0045980 transcript:FBtr0084737)

HSP 1 Score: 197.593 bits (501), Expect = 6.387e-53
Identity = 107/257 (41.63%), Postives = 152/257 (59.14%), Query Frame = 3
Query:  105 PFTKNYSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSL-LCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTK-SIIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKIL 869
            P   NY  ++ +GQGS+G   L + K  D  + V K+I+ +  S    + A  E  +   L HPNIV Y  SF ++N+L I M + + G L   + ER+G L   E+ II    QI+ A++Y+H  NILHRDLKT N+FL +  I+KIGD GI+K + +K   A+TV+GTPYY SPE+ E K Y+ KSDIW+LGC+  EM  LK  F A N + L  KI+ G    +PS Y   L +L+  +L     +RP+  ++L
Sbjct:  100 PELANYEKVRVVGQGSFGIAILYRRKS-DGHQIVFKQINLSELSPPGRDLAMNEVDVFSKLHHPNIVSYLGSFIKDNTLLIEMEYADGGTLAQIIAERQGKLHFPERYIIAVFEQISSAINYMHSENILHRDLKTANVFLNRRGIVKIGDFGISKIMNTKIH-AQTVLGTPYYFSPEMCEGKEYDNKSDIWALGCILGEMCCLKKTFAASNLSELVTKIMAGNYTPVPSGYTSGLRSLMSNLLQVEAPRRPTASEVL 354          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Fly
Match: Nek2 (gene:FBgn0029970 transcript:FBtr0071142)

HSP 1 Score: 157.532 bits (397), Expect = 9.622e-40
Identity = 90/270 (33.33%), Postives = 142/270 (52.59%), Query Frame = 3
Query:  114 KNYSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSF--EENNSLYIAMAFCESGDLYTRLKERKGSL--LCEKQIIEWLIQITMALSYIHER----NILHRDLKTQNIFLTKSI-IKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHI 896
            ++Y  +  +G GS+G  + V+ K    + F  K +++    + + +A   E  +L+ L+HPNIVQY       E  S+YI M  C  GDL   ++  +       E  I   L Q+  AL   H +     ILHRD+K  NIFL  +   K+GD G+A+ L      A + +GTP+YMSPEL + + Y+ KSD+W++GC+ YEM  L+  F  + +  LS KI  G+   +P+ Y+ +L  +I  ML    E+RP    I+ +  +  +I
Sbjct:   17 QDYEVLAVMGNGSFGTCYKVRDKSTG-ELFAWKGMNYDELDEAKCDALVSEISVLRQLQHPNIVQYYHHLVNREAKSVYIVMECCAGGDLAQIVQRARSQRQRFEEPYIWRVLFQLCRALQVCHNKIPNGTILHRDIKPANIFLDAAGNAKLGDFGLARMLRRDQSFAASFVGTPHYMSPELVKGRKYDRKSDVWAVGCLVYEMCALRPPFRGRAFDQLSEKIAQGEFSRIPAIYSTDLQEIIAFMLAVDHEQRPGIEVIIRHPLVVRNI 285          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Fly
Match: polo (gene:FBgn0003124 transcript:FBtr0074839)

HSP 1 Score: 144.821 bits (364), Expect = 4.331e-36
Identity = 88/273 (32.23%), Postives = 148/273 (54.21%), Query Frame = 3
Query:  114 KNYSFIKKIGQGSYG---EVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTKSI-IKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIR-DHIHMFVEQS 917
            K Y  ++  G+G +    E+  V+  D    K V KK+    +   + E    E  + +SL HPNIV++ + FE++ ++YI +  C+   +    K RK   + E +   ++ QI   + Y+H+  I+HRDLK  N+FL   + +KIGD G+A ++E + +  KT+ GTP Y++PE+  KK ++F+ DIWS+GCV Y +   +  F  K       KI   +   +PS   K   +++ AML  +PE RP+ G++L   F++   + MF+  S
Sbjct:   23 KTYKRMRFFGKGGFAKCYEIIDVETDDVFAGKIVSKKLMIKHN---QKEKTAQEITIHRSLNHPNIVKFHNYFEDSQNIYIVLELCKKRSMMELHKRRKS--ITEFECRYYIYQIIQGVKYLHDNRIIHRDLKLGNLFLNDLLHVKIGDFGLATRIEYEGERKKTLCGTPNYIAPEILTKKGHSFEVDIWSIGCVMYTLLVGQPPFETKTLKDTYSKIKKCEY-RVPSYLRKPAADMVIAMLQPNPESRPAIGQLLNFEFLKGSKVPMFLPSS 289          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Fly
Match: polo (gene:FBgn0003124 transcript:FBtr0100318)

HSP 1 Score: 144.821 bits (364), Expect = 4.331e-36
Identity = 88/273 (32.23%), Postives = 148/273 (54.21%), Query Frame = 3
Query:  114 KNYSFIKKIGQGSYG---EVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTKSI-IKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIR-DHIHMFVEQS 917
            K Y  ++  G+G +    E+  V+  D    K V KK+    +   + E    E  + +SL HPNIV++ + FE++ ++YI +  C+   +    K RK   + E +   ++ QI   + Y+H+  I+HRDLK  N+FL   + +KIGD G+A ++E + +  KT+ GTP Y++PE+  KK ++F+ DIWS+GCV Y +   +  F  K       KI   +   +PS   K   +++ AML  +PE RP+ G++L   F++   + MF+  S
Sbjct:   23 KTYKRMRFFGKGGFAKCYEIIDVETDDVFAGKIVSKKLMIKHN---QKEKTAQEITIHRSLNHPNIVKFHNYFEDSQNIYIVLELCKKRSMMELHKRRKS--ITEFECRYYIYQIIQGVKYLHDNRIIHRDLKLGNLFLNDLLHVKIGDFGLATRIEYEGERKKTLCGTPNYIAPEILTKKGHSFEVDIWSIGCVMYTLLVGQPPFETKTLKDTYSKIKKCEY-RVPSYLRKPAADMVIAMLQPNPESRPAIGQLLNFEFLKGSKVPMFLPSS 289          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Fly
Match: fu (gene:FBgn0001079 transcript:FBtr0074602)

HSP 1 Score: 146.362 bits (368), Expect = 5.336e-36
Identity = 86/274 (31.39%), Postives = 142/274 (51.82%), Query Frame = 3
Query:  120 YSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTKSI-IKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFVEQSKRKFDKP 938
            Y+    +GQGS+G V+    KD D K   +K IS    + +E++  R EC +   L+HP++++  +SFE    L++   F    DL+  L       + E+        +  AL Y+H   ILHRDLK QN+ L K++  K+ D G+A+ +     +  ++ GTP YM+PEL  ++PY+  +D+WSLGC+ YE    +  F A +   L  K++  +    PS    E  + +Q +L K P  R S  ++LC+ F+   I +   Q++   + P
Sbjct:    4 YAVSSMVGQGSFGCVYKATRKD-DSKVVAIKVISKRGRATKELKNLRRECDIQARLKHPHVIEMIESFESKTDLFVVTEFALM-DLHRYLSYNGA--MGEEPARRVTGHLVSALYYLHSNRILHRDLKPQNVLLDKNMHAKLCDFGLARNMTLGTHVLTSIKGTPLYMAPELLAEQPYDHHADMWSLGCIAYESMAGQPPFCASSILHL-VKMIKHEDVKWPSTLTSECRSFLQGLLEKDPGLRISWTQLLCHPFVEGRIFIAETQAEAAKESP 272          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Zebrafish
Match: nek4 (NIMA-related kinase 4 [Source:ZFIN;Acc:ZDB-GENE-040426-1392])

HSP 1 Score: 347.436 bits (890), Expect = 2.266e-107
Identity = 164/275 (59.64%), Postives = 209/275 (76.00%), Query Frame = 3
Query:  117 NYSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFE-ENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTKS-IIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFVEQSKRKFDK 935
             Y F++ +G+GSYGEV LV+HK  D K++V+KK++   SS RE  AA  E QLL  L+HPNIV Y++S+E E+  LYI M FCE GDLY RLK++KG LL E+Q++EW +QI MAL Y+HE++ILHRDLKTQNIFLTK+ IIK+GDLGIA+ LE++ DMA T+IGTPYYMSPELF  KPYN+KSD+W+LGC  YEMATLKHAFNAK+  +L Y+I+ G+ P MPSKY+ +L  LI+ ML K PE RP    IL   +I+  I MF+E +K K  K
Sbjct:    3 GYLFVRVVGKGSYGEVNLVRHKS-DRKQYVIKKLNLRTSSRRERRAAEQEAQLLSQLKHPNIVMYRESWEGEDCQLYIVMGFCEGGDLYHRLKQQKGELLPERQVVEWFVQIAMALQYLHEKHILHRDLKTQNIFLTKTNIIKVGDLGIARVLENQNDMASTLIGTPYYMSPELFSNKPYNYKSDVWALGCCVYEMATLKHAFNAKDMNSLVYRIVEGKLPQMPSKYDPQLGELIKRMLCKKPEDRPDVKHILRQPYIKHQISMFLEATKEKTAK 276          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Zebrafish
Match: nek4 (NIMA-related kinase 4 [Source:ZFIN;Acc:ZDB-GENE-040426-1392])

HSP 1 Score: 347.821 bits (891), Expect = 2.297e-107
Identity = 164/275 (59.64%), Postives = 209/275 (76.00%), Query Frame = 3
Query:  117 NYSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFE-ENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTKS-IIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFVEQSKRKFDK 935
             Y F++ +G+GSYGEV LV+HK  D K++V+KK++   SS RE  AA  E QLL  L+HPNIV Y++S+E E+  LYI M FCE GDLY RLK++KG LL E+Q++EW +QI MAL Y+HE++ILHRDLKTQNIFLTK+ IIK+GDLGIA+ LE++ DMA T+IGTPYYMSPELF  KPYN+KSD+W+LGC  YEMATLKHAFNAK+  +L Y+I+ G+ P MPSKY+ +L  LI+ ML K PE RP    IL   +I+  I MF+E +K K  K
Sbjct:    3 GYLFVRVVGKGSYGEVNLVRHKS-DRKQYVIKKLNLRTSSRRERRAAEQEAQLLSQLKHPNIVMYRESWEGEDCQLYIVMGFCEGGDLYHRLKQQKGELLPERQVVEWFVQIAMALQYLHEKHILHRDLKTQNIFLTKTNIIKVGDLGIARVLENQNDMASTLIGTPYYMSPELFSNKPYNYKSDVWALGCCVYEMATLKHAFNAKDMNSLVYRIVEGKLPQMPSKYDPQLGELIKRMLCKKPEDRPDVKHILRQPYIKHQISMFLEATKEKTAK 276          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Zebrafish
Match: nek1 (NIMA-related kinase 1 [Source:ZFIN;Acc:ZDB-GENE-040730-1])

HSP 1 Score: 278.1 bits (710), Expect = 1.190e-87
Identity = 129/264 (48.86%), Postives = 187/264 (70.83%), Query Frame = 3
Query:  120 YSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTK-SIIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFV 908
            Y  +KKIG+GS+G+  LVK +  D +++V+K+I  +R S++E + +R E  +L ++ HPNIVQYK+SFEE+  LYI M +CE GDL+ ++  ++GSL  E+QI++W +QI +AL ++H+R ILHRD+K+QNIFLTK   +++GD GIA+ L S  ++A+T IGTPYY+SPE+ E KPYN KSDIW+LGCV YEM TLKHAF A N   L  KI+ G  P +   Y+ +L +L+  +  ++P +RPS   IL   F+   IH F+
Sbjct:    4 YERLKKIGEGSFGKAILVKSRT-DGRQYVIKEIGISRMSNKERQESRKEVAVLANMSHPNIVQYKESFEESGCLYIVMDYCEGGDLFKKINNQRGSLFPEEQILDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDGTVQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENKPYNNKSDIWALGCVLYEMCTLKHAFEAGNMKNLVLKIIRGSYPPVSIHYSPDLRSLLAQLFKRNPRERPSVSTILDKPFLARRIHKFL 266          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Zebrafish
Match: CABZ01040556.1 (NIMA related kinase 3 [Source:NCBI gene;Acc:100536894])

HSP 1 Score: 232.646 bits (592), Expect = 1.862e-68
Identity = 110/261 (42.15%), Postives = 171/261 (65.52%), Query Frame = 3
Query:  120 YSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTKS-IIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIH 899
            YS ++ IG+GS+G   LV+   ++ K +V+K+I   ++ +  M+ +R E  LL  ++HPNIV ++DSFE +  LYI M FC  GDL  R++++   L  E+QI++W  Q+ +   +IH++ +LHRDLK++NIFLT S  +K+GD G A  L S    A+T +GTPYY+SPE+++ KPYN KSD+WSLGCV YE+ TL+H F A+++ +L  ++  G    +PS +  EL  LI+ M   +P+ RPS   IL ++ +   +H
Sbjct:    4 YSVVRVIGEGSFGRALLVQ-PIHEEKHYVMKEIRLPKA-ESGMKKSRSEAVLLSKMKHPNIVAFRDSFEADGHLYIVMEFCSGGDLMQRIRQQNRLLFSEEQILKWFAQMCLGTKHIHDKRVLHRDLKSKNIFLTDSGTVKVGDFGSACSLNSAKAYAQTYVGTPYYVSPEIWDNKPYNNKSDVWSLGCVLYELCTLQHPFQARSWKSLILQVCRGSYAPLPSHFPYELHYLIKHMFKTNPKDRPSIHTILSSHRVSRLLH 262          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Zebrafish
Match: nek11 (NIMA-related kinase 11 [Source:ZFIN;Acc:ZDB-GENE-100922-73])

HSP 1 Score: 236.498 bits (602), Expect = 3.977e-68
Identity = 137/346 (39.60%), Postives = 190/346 (54.91%), Query Frame = 3
Query:  120 YSFIKKIGQGSYGEVWLVKHKDY--DHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERK--GSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTKSIIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHI----HMFVEQSKRKFDKPCRHRKTSLSKNLPGEFHKELYNYQDKSLGNKVS----------EVSDENNDKLKTTVDTSTLKNH 1103
            Y   +++G+GS+G V+LVK      + +  VLK+I        E   A  E QLL  L HP I+++  SF E ++  I   FCE  DL  +L+E K  G  L E Q+ EWL Q+ + + YIH+R ILHRDLK +NIFL K+I+KIGD G++  L    D+A T  GTPYYMSPE    K Y+ KSDIWSLGC+ YEM  L HAF A+N+ A+  +I+ G TP +P  Y+++L +L+Q+ML K    R S    L N FI + +    H F   S R          + + + L  + H  L   QD+S   K+S          + +DE   KLK  V+    +NH
Sbjct:   31 YIIQQRLGKGSFGTVYLVKDTKAVAEERLKVLKEIPVGDLKPNETVHATQEAQLLSQLSHPAILKFYSSFLERDAFCIITEFCEDKDLDCKLEELKHTGKTLSEPQVCEWLCQLLLGVHYIHQRRILHRDLKAKNIFLRKNIVKIGDFGVSCFLMGSCDLATTFTGTPYYMSPEALSHKGYDSKSDIWSLGCILYEMCCLAHAFEAQNFLAVVLRIVEGPTPSLPETYSRQLNSLMQSMLEKDSSHRISAADALRNRFIEESLQSMKHKFSILSLRDKSIGGERDASQILRALQKKVH--LQTLQDRSEVQKMSPRERMRLRKLQAADEKARKLKQIVEEKYQENH 374          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Xenopus
Match: nek1 (NIMA-related kinase 1 [Source:NCBI gene;Acc:100036653])

HSP 1 Score: 283.108 bits (723), Expect = 5.766e-81
Identity = 131/264 (49.62%), Postives = 184/264 (69.70%), Query Frame = 3
Query:  120 YSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTK-SIIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFV 908
            Y  + KIG+GS+G+  LVK KD D K++V+K+I  ++ S++E E +R E  +L +++HPNIVQY++SFEE+  LYI M +CE GDL+ R+  +KG L  E QI++W +Q+ +AL ++H+R ILHRD+K+QNIFLTK   I++GD GIA+ L S  ++A+T IGTPYY+SPE+ E +PYN KSDIW+LGCV YEM TLKHAF A N   L  KI+ G  P +   Y+ +L NL+  +  ++P  RPS   IL   FI   I  F+
Sbjct:    4 YVRVSKIGEGSFGKAILVKSKD-DGKQYVIKEIGISKMSNKEREESRREVAVLANMKHPNIVQYQESFEESGCLYIVMDYCEGGDLFKRINSQKGVLFSEDQILDWFVQLCLALKHVHDRKILHRDIKSQNIFLTKGGTIQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENRPYNNKSDIWALGCVLYEMCTLKHAFEAGNMKNLVLKIIRGSYPPVSVHYSYDLRNLLSMLFKRNPRDRPSVNSILEKPFIYRRIEKFL 266          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Xenopus
Match: nek1 (NIMA-related kinase 1 [Source:NCBI gene;Acc:100036653])

HSP 1 Score: 283.108 bits (723), Expect = 5.911e-81
Identity = 131/264 (49.62%), Postives = 184/264 (69.70%), Query Frame = 3
Query:  120 YSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTK-SIIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFV 908
            Y  + KIG+GS+G+  LVK KD D K++V+K+I  ++ S++E E +R E  +L +++HPNIVQY++SFEE+  LYI M +CE GDL+ R+  +KG L  E QI++W +Q+ +AL ++H+R ILHRD+K+QNIFLTK   I++GD GIA+ L S  ++A+T IGTPYY+SPE+ E +PYN KSDIW+LGCV YEM TLKHAF A N   L  KI+ G  P +   Y+ +L NL+  +  ++P  RPS   IL   FI   I  F+
Sbjct:    4 YVRVSKIGEGSFGKAILVKSKD-DGKQYVIKEIGISKMSNKEREESRREVAVLANMKHPNIVQYQESFEESGCLYIVMDYCEGGDLFKRINSQKGVLFSEDQILDWFVQLCLALKHVHDRKILHRDIKSQNIFLTKGGTIQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENRPYNNKSDIWALGCVLYEMCTLKHAFEAGNMKNLVLKIIRGSYPPVSVHYSYDLRNLLSMLFKRNPRDRPSVNSILEKPFIYRRIEKFL 266          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Xenopus
Match: nek1 (NIMA-related kinase 1 [Source:NCBI gene;Acc:100036653])

HSP 1 Score: 283.108 bits (723), Expect = 6.290e-81
Identity = 131/264 (49.62%), Postives = 184/264 (69.70%), Query Frame = 3
Query:  120 YSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTK-SIIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFV 908
            Y  + KIG+GS+G+  LVK KD D K++V+K+I  ++ S++E E +R E  +L +++HPNIVQY++SFEE+  LYI M +CE GDL+ R+  +KG L  E QI++W +Q+ +AL ++H+R ILHRD+K+QNIFLTK   I++GD GIA+ L S  ++A+T IGTPYY+SPE+ E +PYN KSDIW+LGCV YEM TLKHAF A N   L  KI+ G  P +   Y+ +L NL+  +  ++P  RPS   IL   FI   I  F+
Sbjct:    4 YVRVSKIGEGSFGKAILVKSKD-DGKQYVIKEIGISKMSNKEREESRREVAVLANMKHPNIVQYQESFEESGCLYIVMDYCEGGDLFKRINSQKGVLFSEDQILDWFVQLCLALKHVHDRKILHRDIKSQNIFLTKGGTIQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENRPYNNKSDIWALGCVLYEMCTLKHAFEAGNMKNLVLKIIRGSYPPVSVHYSYDLRNLLSMLFKRNPRDRPSVNSILEKPFIYRRIEKFL 266          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Xenopus
Match: nek1 (NIMA-related kinase 1 [Source:NCBI gene;Acc:100036653])

HSP 1 Score: 283.108 bits (723), Expect = 7.163e-81
Identity = 131/264 (49.62%), Postives = 184/264 (69.70%), Query Frame = 3
Query:  120 YSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTK-SIIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFV 908
            Y  + KIG+GS+G+  LVK KD D K++V+K+I  ++ S++E E +R E  +L +++HPNIVQY++SFEE+  LYI M +CE GDL+ R+  +KG L  E QI++W +Q+ +AL ++H+R ILHRD+K+QNIFLTK   I++GD GIA+ L S  ++A+T IGTPYY+SPE+ E +PYN KSDIW+LGCV YEM TLKHAF A N   L  KI+ G  P +   Y+ +L NL+  +  ++P  RPS   IL   FI   I  F+
Sbjct:    4 YVRVSKIGEGSFGKAILVKSKD-DGKQYVIKEIGISKMSNKEREESRREVAVLANMKHPNIVQYQESFEESGCLYIVMDYCEGGDLFKRINSQKGVLFSEDQILDWFVQLCLALKHVHDRKILHRDIKSQNIFLTKGGTIQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENRPYNNKSDIWALGCVLYEMCTLKHAFEAGNMKNLVLKIIRGSYPPVSVHYSYDLRNLLSMLFKRNPRDRPSVNSILEKPFIYRRIEKFL 266          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Xenopus
Match: sez6l2 (seizure related 6 homolog like 2 [Source:Xenbase;Acc:XB-GENE-921456])

HSP 1 Score: 243.432 bits (620), Expect = 5.695e-74
Identity = 124/300 (41.33%), Postives = 183/300 (61.00%), Query Frame = 3
Query:  120 YSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTK--SIIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHI--HMFVEQSKRKFDKPCRHRKTSLS---------KNLPG 980
            Y  ++ IG+G++G+ +L K K  D+ + V+K+I+ ++   +E EA+  E  LL  ++HPNIV +  S EE N LYI M +C+ GDL  R+ +++G L  E QI+ W +QI++ L +IH+R +LHRD+K QNIFL+   ++ K+GD GIA+ L +  ++A+T +GTPYY+SPE+ E KPYN K+DIWSLGCV YE+  LKH F A +   L  KI  G+   +P+KY+ +L  L+  +   S   RPS   IL   F+   I  H+  E  + +F     HRK   S         K LPG
Sbjct:    4 YDIVRMIGEGAFGKAYLAKGKS-DNMQCVIKEINLSKMPTKEKEASHKEVVLLAKMKHPNIVTFFSSIEERNKLYIVMEYCDGGDLMKRVNKQRGVLFEEDQILSWFVQISLGLKHIHDRKVLHRDIKAQNIFLSNNGTLAKLGDFGIARMLNNTMELARTCVGTPYYLSPEICENKPYNNKTDIWSLGCVLYELCALKHPFEASSLRQLVLKICRGRYEPIPTKYSYDLRILVSQLFKISSRDRPSINSILKKPFLEKRINKHLSPELIEEEFSHTVIHRKKPSSNPARYPCKPKQLPG 302          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Mouse
Match: Nek4 (NIMA (never in mitosis gene a)-related expressed kinase 4 [Source:MGI Symbol;Acc:MGI:1344404])

HSP 1 Score: 337.035 bits (863), Expect = 2.504e-110
Identity = 157/269 (58.36%), Postives = 206/269 (76.58%), Query Frame = 3
Query:  120 YSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSL-YIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTKS-IIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFVEQSK 920
            Y +++ +G+GSYGEV LVKH+  D K++V+KK++   +S RE  AA  E QLL  L+HPNIV YK+S+E  + L YI M FCE GDLY +LKE+KG LL E Q++EW +QI MAL Y+HE++ILHRDLKTQN+FLT++ IIK+GDLGIA+ LE+  DMA T+IGTPYYMSPELF  KPYN+KSD+W+LGC  YEMATLKHAFNAK+  +L Y+I+ G+ P MP  Y+ EL  LI+ ML++ PE+RPS   IL   +I+ HI +F+E +K
Sbjct:    6 YCYMRVVGRGSYGEVTLVKHRR-DGKQYVIKKLNLRNASSRERRAAEQEAQLLSQLKHPNIVTYKESWEGGDGLLYIVMGFCEGGDLYRKLKEQKGQLLPESQVVEWFVQIAMALQYLHEKHILHRDLKTQNVFLTRTNIIKVGDLGIARVLENHGDMASTLIGTPYYMSPELFSNKPYNYKSDVWALGCCVYEMATLKHAFNAKDMNSLVYRIIEGKLPPMPKVYSTELAELIRTMLSRRPEERPSVRSILRQPYIKHHISLFLEATK 273          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Mouse
Match: Nek4 (NIMA (never in mitosis gene a)-related expressed kinase 4 [Source:MGI Symbol;Acc:MGI:1344404])

HSP 1 Score: 343.199 bits (879), Expect = 1.354e-106
Identity = 159/274 (58.03%), Postives = 208/274 (75.91%), Query Frame = 3
Query:  120 YSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSL-YIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTKS-IIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFVEQSKRKFDK 935
            Y +++ +G+GSYGEV LVKH+  D K++V+KK++   +S RE  AA  E QLL  L+HPNIV YK+S+E  + L YI M FCE GDLY +LKE+KG LL E Q++EW +QI MAL Y+HE++ILHRDLKTQN+FLT++ IIK+GDLGIA+ LE+  DMA T+IGTPYYMSPELF  KPYN+KSD+W+LGC  YEMATLKHAFNAK+  +L Y+I+ G+ P MP  Y+ EL  LI+ ML++ PE+RPS   IL   +I+ HI +F+E +K K  K
Sbjct:    6 YCYMRVVGRGSYGEVTLVKHR-RDGKQYVIKKLNLRNASSRERRAAEQEAQLLSQLKHPNIVTYKESWEGGDGLLYIVMGFCEGGDLYRKLKEQKGQLLPESQVVEWFVQIAMALQYLHEKHILHRDLKTQNVFLTRTNIIKVGDLGIARVLENHGDMASTLIGTPYYMSPELFSNKPYNYKSDVWALGCCVYEMATLKHAFNAKDMNSLVYRIIEGKLPPMPKVYSTELAELIRTMLSRRPEERPSVRSILRQPYIKHHISLFLEATKAKTSK 278          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Mouse
Match: Nek4 (NIMA (never in mitosis gene a)-related expressed kinase 4 [Source:MGI Symbol;Acc:MGI:1344404])

HSP 1 Score: 344.354 bits (882), Expect = 1.531e-106
Identity = 159/274 (58.03%), Postives = 208/274 (75.91%), Query Frame = 3
Query:  120 YSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSL-YIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTKS-IIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFVEQSKRKFDK 935
            Y +++ +G+GSYGEV LVKH+  D K++V+KK++   +S RE  AA  E QLL  L+HPNIV YK+S+E  + L YI M FCE GDLY +LKE+KG LL E Q++EW +QI MAL Y+HE++ILHRDLKTQN+FLT++ IIK+GDLGIA+ LE+  DMA T+IGTPYYMSPELF  KPYN+KSD+W+LGC  YEMATLKHAFNAK+  +L Y+I+ G+ P MP  Y+ EL  LI+ ML++ PE+RPS   IL   +I+ HI +F+E +K K  K
Sbjct:    6 YCYMRVVGRGSYGEVTLVKHR-RDGKQYVIKKLNLRNASSRERRAAEQEAQLLSQLKHPNIVTYKESWEGGDGLLYIVMGFCEGGDLYRKLKEQKGQLLPESQVVEWFVQIAMALQYLHEKHILHRDLKTQNVFLTRTNIIKVGDLGIARVLENHGDMASTLIGTPYYMSPELFSNKPYNYKSDVWALGCCVYEMATLKHAFNAKDMNSLVYRIIEGKLPPMPKVYSTELAELIRTMLSRRPEERPSVRSILRQPYIKHHISLFLEATKAKTSK 278          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Mouse
Match: Nek4 (NIMA (never in mitosis gene a)-related expressed kinase 4 [Source:MGI Symbol;Acc:MGI:1344404])

HSP 1 Score: 314.309 bits (804), Expect = 8.395e-96
Identity = 145/247 (58.70%), Postives = 187/247 (75.71%), Query Frame = 3
Query:  201 FVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSL-YIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTKS-IIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFVEQSKRKFDK 935
            +V+KK++   +S RE  AA  E QLL  L+HPNIV YK+S+E  + L YI M FCE GDLY +LKE+KG LL E Q++EW +QI MAL Y+HE++ILHRDLKTQN+FLT++ IIK+GDLGIA+ LE+  DMA T+IGTPYYMSPELF  KPYN+KSD+W+LGC  YEMATLKHAFNAK+  +L Y+I+ G+ P MP  Y+ EL  LI+ ML++ PE+RPS   IL   +I+ HI +F+E +K K  K
Sbjct:   25 YVIKKLNLRNASSRERRAAEQEAQLLSQLKHPNIVTYKESWEGGDGLLYIVMGFCEGGDLYRKLKEQKGQLLPESQVVEWFVQIAMALQYLHEKHILHRDLKTQNVFLTRTNIIKVGDLGIARVLENHGDMASTLIGTPYYMSPELFSNKPYNYKSDVWALGCCVYEMATLKHAFNAKDMNSLVYRIIEGKLPPMPKVYSTELAELIRTMLSRRPEERPSVRSILRQPYIKHHISLFLEATKAKTSK 271          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Mouse
Match: Nek1 (NIMA (never in mitosis gene a)-related expressed kinase 1 [Source:MGI Symbol;Acc:MGI:97303])

HSP 1 Score: 284.648 bits (727), Expect = 6.391e-82
Identity = 131/264 (49.62%), Postives = 186/264 (70.45%), Query Frame = 3
Query:  120 YSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTK-SIIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFV 908
            Y  ++KIG+GS+G+  LVK  + D + +V+K+I+ +R SD+E + +R E  +L +++HPNIVQYK+SFEEN SLYI M +CE GDL+ R+  +KG+L  E QI++W +QI +AL ++H+R ILHRD+K+QNIFLTK   +++GD GIA+ L S  ++A+T IGTPYY+SPE+ E KPYN KSDIW+LGCV YE+ TLKHAF A N   L  KI+ G  P +   Y+ +L +L+  +  ++P  RPS   IL   FI   I  F+
Sbjct:    4 YVRLQKIGEGSFGKAVLVKSTE-DGRHYVIKEINISRMSDKERQESRREVAVLANMKHPNIVQYKESFEENGSLYIVMDYCEGGDLFKRINAQKGALFQEDQILDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDGTVQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENKPYNNKSDIWALGCVLYELCTLKHAFEAGNMKNLVLKIISGSFPPVSPHYSYDLRSLLSQLFKRNPRDRPSVNSILEKGFIAKRIEKFL 266          
BLAST of Serine/threonine-protein kinase Nek4 vs. UniProt/SwissProt
Match: sp|Q9Z1J2|NEK4_MOUSE (Serine/threonine-protein kinase Nek4 OS=Mus musculus OX=10090 GN=Nek4 PE=1 SV=1)

HSP 1 Score: 344.354 bits (882), Expect = 1.152e-105
Identity = 159/274 (58.03%), Postives = 208/274 (75.91%), Query Frame = 3
Query:  120 YSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSL-YIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTKS-IIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFVEQSKRKFDK 935
            Y +++ +G+GSYGEV LVKH+  D K++V+KK++   +S RE  AA  E QLL  L+HPNIV YK+S+E  + L YI M FCE GDLY +LKE+KG LL E Q++EW +QI MAL Y+HE++ILHRDLKTQN+FLT++ IIK+GDLGIA+ LE+  DMA T+IGTPYYMSPELF  KPYN+KSD+W+LGC  YEMATLKHAFNAK+  +L Y+I+ G+ P MP  Y+ EL  LI+ ML++ PE+RPS   IL   +I+ HI +F+E +K K  K
Sbjct:    6 YCYMRVVGRGSYGEVTLVKHR-RDGKQYVIKKLNLRNASSRERRAAEQEAQLLSQLKHPNIVTYKESWEGGDGLLYIVMGFCEGGDLYRKLKEQKGQLLPESQVVEWFVQIAMALQYLHEKHILHRDLKTQNVFLTRTNIIKVGDLGIARVLENHGDMASTLIGTPYYMSPELFSNKPYNYKSDVWALGCCVYEMATLKHAFNAKDMNSLVYRIIEGKLPPMPKVYSTELAELIRTMLSRRPEERPSVRSILRQPYIKHHISLFLEATKAKTSK 278          
BLAST of Serine/threonine-protein kinase Nek4 vs. UniProt/SwissProt
Match: sp|P51957|NEK4_HUMAN (Serine/threonine-protein kinase Nek4 OS=Homo sapiens OX=9606 GN=NEK4 PE=1 SV=2)

HSP 1 Score: 339.732 bits (870), Expect = 1.612e-103
Identity = 159/274 (58.03%), Postives = 206/274 (75.18%), Query Frame = 3
Query:  120 YSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSL-YIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTKS-IIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFVEQSKRKFDK 935
            Y +++ +G+GSYGEV LVKH+  D K++V+KK++   +S RE  AA  E QLL  L+HPNIV YK+S+E  + L YI M FCE GDLY +LKE+KG LL E Q++EW +QI MAL Y+HE++ILHRDLKTQN+FLT++ IIK+GDLGIA+ LE+  DMA T+IGTPYYMSPELF  KPYN+KSD+W+LGC  YEMATLKHAFNAK+  +L Y+I+ G+ P MP  Y+ EL  LI+ ML+K PE+RPS   IL   +I+  I  F+E +K K  K
Sbjct:    6 YCYLRVVGKGSYGEVTLVKHR-RDGKQYVIKKLNLRNASSRERRAAEQEAQLLSQLKHPNIVTYKESWEGGDGLLYIVMGFCEGGDLYRKLKEQKGQLLPENQVVEWFVQIAMALQYLHEKHILHRDLKTQNVFLTRTNIIKVGDLGIARVLENHCDMASTLIGTPYYMSPELFSNKPYNYKSDVWALGCCVYEMATLKHAFNAKDMNSLVYRIIEGKLPPMPRDYSPELAELIRTMLSKRPEERPSVRSILRQPYIKRQISFFLEATKIKTSK 278          
BLAST of Serine/threonine-protein kinase Nek4 vs. UniProt/SwissProt
Match: sp|P51954|NEK1_MOUSE (Serine/threonine-protein kinase Nek1 OS=Mus musculus OX=10090 GN=Nek1 PE=1 SV=2)

HSP 1 Score: 284.648 bits (727), Expect = 4.899e-81
Identity = 131/264 (49.62%), Postives = 186/264 (70.45%), Query Frame = 3
Query:  120 YSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTK-SIIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFV 908
            Y  ++KIG+GS+G+  LVK  + D + +V+K+I+ +R SD+E + +R E  +L +++HPNIVQYK+SFEEN SLYI M +CE GDL+ R+  +KG+L  E QI++W +QI +AL ++H+R ILHRD+K+QNIFLTK   +++GD GIA+ L S  ++A+T IGTPYY+SPE+ E KPYN KSDIW+LGCV YE+ TLKHAF A N   L  KI+ G  P +   Y+ +L +L+  +  ++P  RPS   IL   FI   I  F+
Sbjct:    4 YVRLQKIGEGSFGKAVLVKSTE-DGRHYVIKEINISRMSDKERQESRREVAVLANMKHPNIVQYKESFEENGSLYIVMDYCEGGDLFKRINAQKGALFQEDQILDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDGTVQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENKPYNNKSDIWALGCVLYELCTLKHAFEAGNMKNLVLKIISGSFPPVSPHYSYDLRSLLSQLFKRNPRDRPSVNSILEKGFIAKRIEKFL 266          
BLAST of Serine/threonine-protein kinase Nek4 vs. UniProt/SwissProt
Match: sp|Q96PY6|NEK1_HUMAN (Serine/threonine-protein kinase Nek1 OS=Homo sapiens OX=9606 GN=NEK1 PE=1 SV=2)

HSP 1 Score: 280.026 bits (715), Expect = 2.789e-79
Identity = 129/264 (48.86%), Postives = 185/264 (70.08%), Query Frame = 3
Query:  120 YSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTK-SIIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFV 908
            Y  ++KIG+GS+G+  LVK  + D +++V+K+I+ +R S +E E +R E  +L +++HPNIVQY++SFEEN SLYI M +CE GDL+ R+  +KG L  E QI++W +QI +AL ++H+R ILHRD+K+QNIFLTK   +++GD GIA+ L S  ++A+T IGTPYY+SPE+ E KPYN KSDIW+LGCV YE+ TLKHAF A +   L  KI+ G  P +   Y+ +L +L+  +  ++P  RPS   IL   FI   I  F+
Sbjct:    4 YVRLQKIGEGSFGKAILVKSTE-DGRQYVIKEINISRMSSKEREESRREVAVLANMKHPNIVQYRESFEENGSLYIVMDYCEGGDLFKRINAQKGVLFQEDQILDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDGTVQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENKPYNNKSDIWALGCVLYELCTLKHAFEAGSMKNLVLKIISGSFPPVSLHYSYDLRSLVSQLFKRNPRDRPSVNSILEKGFIAKRIEKFL 266          
BLAST of Serine/threonine-protein kinase Nek4 vs. UniProt/SwissProt
Match: sp|Q6P3R8|NEK5_HUMAN (Serine/threonine-protein kinase Nek5 OS=Homo sapiens OX=9606 GN=NEK5 PE=2 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 3.298e-71
Identity = 119/265 (44.91%), Postives = 173/265 (65.28%), Query Frame = 3
Query:  120 YSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTKS--IIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFV 908
            Y  IK IGQG++G+ +L K K  D K  V+K+I+F +   +E EA++ E  LL+ ++HPNIV + +SF+EN  L+I M +C+ GDL  R+  ++G L  E QI+ W +QI++ L +IH+R ILHRD+K QNIFL+K+  + K+GD GIA+ L +  ++A+T IGTPYY+SPE+ + KPYN K+DIWSLGCV YE+ TLKH F   N   L  KI       +   +++EL +LI  +   SP  RPS   IL   F+ + I  ++
Sbjct:    4 YDVIKAIGQGAFGKAYLAKGKS-DSKHCVIKEINFEKMPIQEKEASKKEVILLEKMKHPNIVAFFNSFQENGRLFIVMEYCDGGDLMKRINRQRGVLFSEDQILGWFVQISLGLKHIHDRKILHRDIKAQNIFLSKNGMVAKLGDFGIARVLNNSMELARTCIGTPYYLSPEICQNKPYNNKTDIWSLGCVLYELCTLKHPFEGNNLQQLVLKICQAHFAPISPGFSRELHSLISQLFQVSPRDRPSINSILKRPFLENLIPKYL 267          
BLAST of Serine/threonine-protein kinase Nek4 vs. TrEMBL
Match: A0A267GHX1 (Protein kinase domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031136g1 PE=3 SV=1)

HSP 1 Score: 381.719 bits (979), Expect = 1.062e-122
Identity = 173/274 (63.14%), Postives = 221/274 (80.66%), Query Frame = 3
Query:  120 YSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTKS-IIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFVEQSKRKFDKP 938
            Y  IK+IG+GSYGEVWL KH+  D +++VLKKIS   +S +E ++A  EC+LL  L+HPNIV Y+DSFE    LYI MA+CE GD+YT+LKE+KG  L E+QI+EW +Q+ MAL Y+HERNILHRDLKTQNIFLT+S IIK+GDLGIA+ L+S  DMAKT+IGTPYYMSPELF  KPYN KSD+W+LGC  YEMATLKHAFNA+++++LSYKIL G+TPDMP++Y+ EL+ L+++MLN SPEKRPS  +IL + FIR  I +F+E ++R    P
Sbjct:    4 YQLIKQIGKGSYGEVWLSKHQK-DRRQYVLKKISLVNASQKERKSAEQECKLLSQLKHPNIVGYRDSFELEGILYIVMAYCEGGDVYTKLKEQKGVPLPERQIVEWFVQVAMALQYMHERNILHRDLKTQNIFLTRSKIIKVGDLGIARVLDSSNDMAKTLIGTPYYMSPELFSNKPYNHKSDVWALGCCVYEMATLKHAFNARDFSSLSYKILKGRTPDMPTQYSSELLELMRSMLNLSPEKRPSVNRILRDPFIRRSIQLFLESTRRPGTAP 276          
BLAST of Serine/threonine-protein kinase Nek4 vs. TrEMBL
Match: A0A267DKL9 (Protein kinase domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig022866g8 PE=3 SV=1)

HSP 1 Score: 380.563 bits (976), Expect = 2.818e-122
Identity = 173/274 (63.14%), Postives = 221/274 (80.66%), Query Frame = 3
Query:  120 YSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTKS-IIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFVEQSKRKFDKP 938
            Y  IK+IG+GSYGEVWL KH+  D +++VLKKIS   +S +E ++A  EC+LL  L+HPNIV Y+DSFE    LYI MA+CE GD+YT+LKE+KG  L E+QI+EW +Q+ MAL Y+HERNILHRDLKTQNIFLT+S IIK+GDLGIA+ L+S  DMAKT+IGTPYYMSPELF  KPYN KSD+W+LGC  YEMATLKHAFNA+++++LSYKIL G+TPDMP++Y+ EL+ L+++MLN SPEKRPS  +IL + FIR  I +F+E ++R    P
Sbjct:    4 YQLIKQIGKGSYGEVWLSKHQK-DRRQYVLKKISLVNASQKERKSAEQECKLLSQLKHPNIVGYRDSFELEGILYIVMAYCEGGDVYTKLKEQKGVPLPERQIVEWFVQVAMALQYMHERNILHRDLKTQNIFLTRSKIIKVGDLGIARVLDSSNDMAKTLIGTPYYMSPELFSNKPYNHKSDVWALGCCVYEMATLKHAFNARDFSSLSYKILKGRTPDMPTQYSSELLELMRSMLNLSPEKRPSVNRILRDPFIRRSIQLFLESTRRPGIAP 276          
BLAST of Serine/threonine-protein kinase Nek4 vs. TrEMBL
Match: A0A1I8G6F9 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 385.571 bits (989), Expect = 1.063e-121
Identity = 173/274 (63.14%), Postives = 221/274 (80.66%), Query Frame = 3
Query:  120 YSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTKS-IIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFVEQSKRKFDKP 938
            Y  IK+IG+GSYGEVWL KH+  D +++VLKKIS   +S +E ++A  EC+LL  L+HPNIV Y+DSFE    LYI MA+CE GD+YT+LKE+KG  L E+QI+EW +Q+ MAL Y+HERNILHRDLKTQNIFLT+S IIK+GDLGIA+ L+S  DMAKT+IGTPYYMSPELF  KPYN KSD+W+LGC  YEMATLKHAFNA+++++LSYKIL G+TPDMP++Y+ EL+ L+++MLN SPEKRPS  +IL + FIR  I +F+E ++R    P
Sbjct:    5 YQLIKQIGKGSYGEVWLSKHQK-DRRQYVLKKISLVNASQKERKSAEQECKLLSQLKHPNIVGYRDSFELEGILYIVMAYCEGGDVYTKLKEQKGVPLPERQIVEWFVQVAMALQYMHERNILHRDLKTQNIFLTRSKIIKVGDLGIARVLDSSNDMAKTLIGTPYYMSPELFSNKPYNHKSDVWALGCCVYEMATLKHAFNARDFSSLSYKILKGRTPDMPTQYSSELLELMRSMLNLSPEKRPSVNRILRDPFIRRSIQLFLESTRRPGTAP 277          
BLAST of Serine/threonine-protein kinase Nek4 vs. TrEMBL
Match: A0A3S5A6U8 (Protein kinase domain-containing protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS1983 PE=3 SV=1)

HSP 1 Score: 379.407 bits (973), Expect = 1.075e-120
Identity = 176/271 (64.94%), Postives = 222/271 (81.92%), Query Frame = 3
Query:  117 NYSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTKS-IIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFVEQSKRK 926
            NY+FIK IG+GSYGEVWL ++   D K++V+KKI   +++++E  AA LEC+LL  L+HPNIVQYKDSFE  ++LYIAM+FCE GDLYTRL+ + G  L E+Q++EW +QI +AL Y+HERN+LHRDLKTQNIFLT+S IIK+GDLGIA+ LES + MA T+IGTPYYMSPELF  KPYN KSDIW+LGCV YEMATLKHAFNAK++ +LSYKIL G+ P+MP +Y+ +LINLI+AMLN  PEKRPS  +IL + FIR HI +F+E +K K
Sbjct:   28 NYAFIKAIGKGSYGEVWLCQN-GCDKKQYVIKKIYLQKTNEKERNAANLECKLLAQLKHPNIVQYKDSFEFKDNLYIAMSFCEGGDLYTRLRNQNGVFLDERQLVEWFVQIAIALQYMHERNVLHRDLKTQNIFLTRSKIIKVGDLGIARVLESSHSMATTMIGTPYYMSPELFANKPYNHKSDIWALGCVVYEMATLKHAFNAKSFNSLSYKILSGKIPEMPKEYSLDLINLIRAMLNLKPEKRPSARRILSDAFIRSHIVLFLELTKDK 297          
BLAST of Serine/threonine-protein kinase Nek4 vs. TrEMBL
Match: A0A1I8HTB5 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 373.244 bits (957), Expect = 3.071e-120
Identity = 169/268 (63.06%), Postives = 216/268 (80.60%), Query Frame = 3
Query:  117 NYSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTKS-IIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFVEQS 917
            +Y  +K IG+GSYGEVWL KH   D ++FV+KKIS   ++ +E ++A  EC+LL  L+HPNIV YKDSFE    LYI MAFCE GDLY+RLKE++G+ L E+Q++EW +QITMAL Y+HERNILHRDLKTQNIFLT+S IIK+GDLGIA+ L+S  DMAKT+IGTPYYMSPELF  KPYN KSD+W+LGC  YEMATLKHAFNA+++ +LS KIL G+ PDMP +Y+ EL+ LI+AML++ P+KRPS  +IL + FIR +I MF++ +
Sbjct:    4 DYQLLKAIGKGSYGEVWLAKHL-RDRRQFVVKKISLQSANQKERKSAEQECKLLSQLKHPNIVGYKDSFEAKGILYIVMAFCEGGDLYSRLKEQRGTALSERQVVEWFVQITMALQYMHERNILHRDLKTQNIFLTRSRIIKVGDLGIARVLDSSNDMAKTLIGTPYYMSPELFSNKPYNHKSDVWALGCCVYEMATLKHAFNARDFNSLSNKILQGRMPDMPMQYSAELVALIRAMLSQDPDKRPSVNRILRDRFIRRNIQMFLDAT 270          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Cavefish
Match: nek4 (NIMA related kinase 4 [Source:NCBI gene;Acc:103043005])

HSP 1 Score: 347.436 bits (890), Expect = 2.085e-107
Identity = 172/318 (54.09%), Postives = 226/318 (71.07%), Query Frame = 3
Query:  114 KNYSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENN-SLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTKS-IIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFVEQSKRKFDKPCRHRKTSLSKNLPG-------EFHKELYNYQDKSLGNKVSE 1040
            ++Y FI+ +G+GSYGEV LV+HK  D K++V+KK++   SS RE  AA  E QLL  L+HPNIV Y++S+E ++  LYI M FCE GDLY RLK++KG LL E+Q++EW +QI MAL Y+HE++ILHRDLKTQNIFLTK+ IIK+GDLGIA+ LE++ DMA T+IGTPYYMSPELF  KPYN+KSD+W+LGC  YEM+TLKHAFNAK+  +L+++I+ G+ P MPSKY+ +L  LI+ ML K PE RP    IL   FI+  I +F+E +K K  K  +    S S + P        E   +  N + KS G K  E
Sbjct:    2 ESYGFIRVVGKGSYGEVNLVQHKS-DRKQYVIKKLNLRTSSKRERRAAEQEAQLLSQLKHPNIVTYRESWEGDDCQLYIVMGFCEGGDLYHRLKQQKGELLPERQVVEWFVQIAMALQYLHEKHILHRDLKTQNIFLTKTNIIKVGDLGIARVLENQNDMASTLIGTPYYMSPELFSNKPYNYKSDVWALGCCVYEMSTLKHAFNAKDMNSLAFRIIEGKLPQMPSKYDPQLGELIKRMLCKKPEDRPDVKHILRQPFIKQQIAIFLEATKEKTAKSRKKVMNSKSNSTPNAAVLQKQENSLQCLNSEPKSRGKKSEE 318          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Cavefish
Match: nek4 (NIMA related kinase 4 [Source:NCBI gene;Acc:103043005])

HSP 1 Score: 347.821 bits (891), Expect = 2.391e-107
Identity = 172/318 (54.09%), Postives = 226/318 (71.07%), Query Frame = 3
Query:  114 KNYSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENN-SLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTKS-IIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFVEQSKRKFDKPCRHRKTSLSKNLPG-------EFHKELYNYQDKSLGNKVSE 1040
            ++Y FI+ +G+GSYGEV LV+HK  D K++V+KK++   SS RE  AA  E QLL  L+HPNIV Y++S+E ++  LYI M FCE GDLY RLK++KG LL E+Q++EW +QI MAL Y+HE++ILHRDLKTQNIFLTK+ IIK+GDLGIA+ LE++ DMA T+IGTPYYMSPELF  KPYN+KSD+W+LGC  YEM+TLKHAFNAK+  +L+++I+ G+ P MPSKY+ +L  LI+ ML K PE RP    IL   FI+  I +F+E +K K  K  +    S S + P        E   +  N + KS G K  E
Sbjct:    2 ESYGFIRVVGKGSYGEVNLVQHKS-DRKQYVIKKLNLRTSSKRERRAAEQEAQLLSQLKHPNIVTYRESWEGDDCQLYIVMGFCEGGDLYHRLKQQKGELLPERQVVEWFVQIAMALQYLHEKHILHRDLKTQNIFLTKTNIIKVGDLGIARVLENQNDMASTLIGTPYYMSPELFSNKPYNYKSDVWALGCCVYEMSTLKHAFNAKDMNSLAFRIIEGKLPQMPSKYDPQLGELIKRMLCKKPEDRPDVKHILRQPFIKQQIAIFLEATKEKTAKSRKKVMNSKSNSTPNAAVLQKQENSLQCLNSEPKSRGKKSEE 318          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Cavefish
Match: nek1 (NIMA related kinase 1 [Source:NCBI gene;Acc:103028272])

HSP 1 Score: 285.419 bits (729), Expect = 1.117e-81
Identity = 130/264 (49.24%), Postives = 186/264 (70.45%), Query Frame = 3
Query:  120 YSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTK-SIIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFV 908
            Y  +KKIG+GS+G+  LV+ K+  H+ +V+K+I  +R S++E + +R E  +L ++ HPNIVQYK+SFEE   LYI M +CE GDL+ ++  +KG L  E+QI++W +QI +AL ++H+R ILHRD+K+QNIFLTK   I++GD GIA+ L S  ++A+T IGTPYY+SPE+ E KPYN KSDIW+LGCV YEM TLKHAF A N   L  KI+ G  P +   Y+++L +L+  +  ++P +RPS   IL   F+   IH F+
Sbjct:    4 YEKVKKIGEGSFGKAILVRSKEDGHQ-YVIKEIGISRMSNKERQESRKEVAVLANMSHPNIVQYKESFEEGGCLYIVMDYCEGGDLFKKINNQKGVLFTEEQILDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDGTIQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENKPYNNKSDIWALGCVLYEMCTLKHAFEAGNMKNLVLKIIRGSYPPVSMHYSQDLRSLLGLLFKRNPRERPSVCTILDKPFLAHRIHRFL 266          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Cavefish
Match: nek1 (NIMA related kinase 1 [Source:NCBI gene;Acc:103028272])

HSP 1 Score: 285.034 bits (728), Expect = 1.158e-81
Identity = 130/264 (49.24%), Postives = 186/264 (70.45%), Query Frame = 3
Query:  120 YSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTK-SIIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFV 908
            Y  +KKIG+GS+G+  LV+ K+  H+ +V+K+I  +R S++E + +R E  +L ++ HPNIVQYK+SFEE   LYI M +CE GDL+ ++  +KG L  E+QI++W +QI +AL ++H+R ILHRD+K+QNIFLTK   I++GD GIA+ L S  ++A+T IGTPYY+SPE+ E KPYN KSDIW+LGCV YEM TLKHAF A N   L  KI+ G  P +   Y+++L +L+  +  ++P +RPS   IL   F+   IH F+
Sbjct:    4 YEKVKKIGEGSFGKAILVRSKEDGHQ-YVIKEIGISRMSNKERQESRKEVAVLANMSHPNIVQYKESFEEGGCLYIVMDYCEGGDLFKKINNQKGVLFTEEQILDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDGTIQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENKPYNNKSDIWALGCVLYEMCTLKHAFEAGNMKNLVLKIIRGSYPPVSMHYSQDLRSLLGLLFKRNPRERPSVCTILDKPFLAHRIHRFL 266          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Cavefish
Match: ENSAMXT00000049860.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000129.1:61559:73217:-1 gene:ENSAMXG00000043136.1 transcript:ENSAMXT00000049860.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 247.669 bits (631), Expect = 6.124e-71
Identity = 118/306 (38.56%), Postives = 186/306 (60.78%), Query Frame = 3
Query:  120 YSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTK--SIIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHI--HMFVEQSKRKFDKPCRHRKTSLSKNLPGEFHKELYNYQDKSLG 1025
            Y  +++IG G+YG+  LV+ +  + +  V+K+IS++R S RE E ++ E  LL  ++HPNIV +  SF E NSLYI M +C+ GDL  ++  ++G    E+QI++W +QI + L +IH+R +LHRD+K QNIFLT+  S +K+GD GIA+ L +  ++A+T +GTPYY+SPE+ E +PYN K+D+WSLGCV YE+ TL+H F   +   L  +I  G    +  +Y+ +L  L+  +   SP  RPS   +L    +   I  H+  +  + +F     HR   +++  PG  H  +     +S G
Sbjct:    4 YELVRQIGHGAYGKALLVRERSGNARHCVIKQISWSRMSPREREDSKKEVTLLSKMKHPNIVAFFRSFNERNSLYIVMEYCDGGDLMKKISMQRGQPFKEQQIMDWFVQICLGLKHIHDRKVLHRDIKAQNIFLTQGGSKVKLGDFGIARLLNNTVELARTCVGTPYYLSPEICENRPYNNKTDMWSLGCVLYELCTLRHPFEGSSLRQLIVRICKGYYTPVSQRYSSDLRTLVSQLFKISPRDRPSVNSLLKRPLLHTLISKHLHPQLMEEEFSHTVLHRVKPVAQ--PGPKHSAVSKVSPRSGG 307          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007414.1 (pep scaffold:Pmarinus_7.0:GL476981:230882:244405:1 gene:ENSPMAG00000006689.1 transcript:ENSPMAT00000007414.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 271.552 bits (693), Expect = 2.270e-85
Identity = 128/277 (46.21%), Postives = 186/277 (67.15%), Query Frame = 3
Query:  120 YSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTKS-IIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFI--RDHIHMFVEQSKRKFDKPC 941
            Y+ + +IG+GS+G+  LVK K   H  +V+K+I+ +R S +E + AR E  +L ++ HPNIV YK+SFEE  +LYI M +CE GDL+ R+  +KG L  E QI++WL+Q+ +AL ++H+R ILHRD+K+QNIFLTK+ I+++GD GIA+ L S  ++A+T IGTPYY+SPE+ E KPYN KSD+W+LGCV YEM TL+HAF A N   L  KI+ G  P + + Y+ EL + +  +L + P  RP    +L    +  R    M  EQ + + +  C
Sbjct:    4 YTMVSQIGEGSFGKAMLVKSKADGHL-YVIKEINISRMSPKERDEARKEVCVLANMRHPNIVSYKESFEERGNLYIVMDYCEGGDLFKRINAQKGVLFSEDQILDWLVQLCLALKHVHDRKILHRDIKSQNIFLTKAGIVQLGDFGIARVLNSTTELARTCIGTPYYLSPEICENKPYNHKSDMWALGCVLYEMCTLRHAFEAGNMKNLVLKIIRGSFPPVSAHYSSELRSTLSGLLRRDPRARPPVAVLLSRPLLMARAQRLMVSEQVRIEGNSQC 279          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Sea Lamprey
Match: NEK9 (NIMA related kinase 9 [Source:HGNC Symbol;Acc:HGNC:18591])

HSP 1 Score: 205.682 bits (522), Expect = 1.617e-56
Identity = 109/293 (37.20%), Postives = 180/293 (61.43%), Query Frame = 3
Query:  105 PFTKNYSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTKS-IIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMG-QTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFVEQSKRKFDKPCRHRKTSLSKNLP 977
            P  ++Y  ++ +G+G++GE  L + ++ D+   V K+I   R SD+E   ++ E  +L  LEH NI+ Y + F + N L I + +C  G LY ++ ++ G+   EK I+ +  Q+  A+  IH   ILHRD+KT NIFLTKS +IK+GD GI+K L+S+  MA++ +GTPYYMSPEL     YN KSDIW++GCV YE+ TL   F+A N   L Y+I+ G +  ++  +Y+KE+  ++Q  L +  E+RP+   +L  + I+      +E++  + ++P R  ++  ++ +P
Sbjct:   31 PEERHYIPVRVLGRGAFGEAALYR-RNEDNSLVVWKEIDLTRLSDKERRDSQNEIDILSLLEHANIISYYNHFLDGNVLLIELEYCNGGTLYEKIIKQHGAFFPEKDIVWYFYQLVSAVEQIHNFKILHRDIKTLNIFLTKSDLIKVGDFGISKILDSRSQMAESYVGTPYYMSPELIRGDKYNTKSDIWAMGCVLYELLTLTRTFDATNPLKLCYEIIHGKKQVEIDDQYSKEIKEVVQKCLQQDAEQRPTAEDLLELSPIKTR-RREMEKNVWRLNEPARRIRSDNAEAVP 321          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000555.1 (pep scaffold:Pmarinus_7.0:GL477093:35206:42652:1 gene:ENSPMAG00000000500.1 transcript:ENSPMAT00000000555.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 170.244 bits (430), Expect = 1.692e-49
Identity = 72/173 (41.62%), Postives = 116/173 (67.05%), Query Frame = 3
Query:  408 LLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTKS-IIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALS-----YKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFV 908
            ++ +  +++W +Q+ MA+ YIH   ILHRD+KT N+FLTK+  +K+GD GI+K +E   DMA T +GTPYY+SPE+ +  PY+ KSD+W+LGC+ YE+  L+ AF A N   L+     YKI+ G+   +   Y++++  L+  +L++SPE RPS   +L + + + H+ +FV
Sbjct:    4 IITKTNVMQWFVQVCMAVQYIHSVKILHRDIKTSNVFLTKAGTVKVGDFGISKAMEGTLDMAVTCVGTPYYLSPEMCQDLPYSSKSDVWALGCLLYELCALRPAFEASNIIRLTRRSLFYKIMRGEPDPLDESYSRDVRALVALLLSRSPEDRPSASAVLASPYAQRHLRLFV 176          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Sea Lamprey
Match: nek2 (NIMA-related kinase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-752])

HSP 1 Score: 168.318 bits (425), Expect = 8.394e-46
Identity = 99/256 (38.67%), Postives = 141/256 (55.08%), Query Frame = 3
Query:  201 FVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSF--EENNSLYIAMAFCESGDLYTRLKE--RKGSLLCEKQIIEWLIQITMALSYIHERN-----ILHRDLKTQNIFL-TKSIIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFVEQSKRKFDKP 938
             V K + +   S+ E +    E  LL+ L+HPNIV+Y D      N +LYI M +CE GDL + +    R    L E+ ++  L Q+ +AL   H R      +LHRDLK  N+FL  +  +K+GD G+A+ L+     AKT +GTPYYMSPE F +  YN KSDIWSLGC+ YE+  L   F A N   L+ KI  G+   +P +Y+ EL  +I  MLN     RPS  +I+    + + +    EQ++   +KP
Sbjct:    3 LVWKVLDYGTMSEPEKQMLVSEVNLLRELKHPNIVRYFDRIIDRSNTTLYIVMEYCECGDLASLISRCRRDRRFLEEEFVLRVLAQLVLALRECHRRTAGGRTVLHRDLKPANVFLDARHNVKLGDFGLARILQHDTSFAKTFVGTPYYMSPEQFSRMSYNEKSDIWSLGCLLYELCALVPPFTAMNQKQLAEKIKEGKFRRIPYRYSDELNEIISKMLNLKDYLRPSIEQIMQYGLLAEVLDE--EQARAAPEKP 256          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001750.1 (pep scaffold:Pmarinus_7.0:GL481695:1137:12922:1 gene:ENSPMAG00000001576.1 transcript:ENSPMAT00000001750.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 170.629 bits (431), Expect = 2.160e-45
Identity = 85/170 (50.00%), Postives = 115/170 (67.65%), Query Frame = 3
Query:  366 SGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTK--SIIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKIL 869
             G L   +++R GSLL E  I+ + +QI +AL ++H  +ILHRDLKT NI L K  +++KIGD GI+K L SK   A TV+GTP Y+SPEL E KPYN KSDIW+LGC+ YE+A+LK AF A+N  AL  KI+ G    +  +Y+ EL  L+ ++LN  P KRP   ++L
Sbjct:    1 GGTLAEYIQKRGGSLLDEDTILHFFVQIALALHHVHSNHILHRDLKTHNILLDKRQTVVKIGDFGISKILSSK-SKAYTVVGTPCYISPELCEGKPYNQKSDIWALGCILYELASLKRAFEAENLPALVLKIMSGNFAPVSDRYSGELRQLVVSLLNLDPSKRPQLSEVL 169          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Yeast
Match: KIN3 (Nonessential serine/threonine protein kinase; possible role in DNA damage response; influences tolerance to high levels of ethanol [Source:SGD;Acc:S000000071])

HSP 1 Score: 153.295 bits (386), Expect = 9.461e-41
Identity = 105/326 (32.21%), Postives = 155/326 (47.55%), Query Frame = 3
Query:  105 PFTKNYSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYK--DSFEENNSLYIAMAFCESGDLYTRLKERKGS--LLCEKQIIEWLIQITMAL------------SYIHERN---------ILHRDLKTQNIFLT----------------------------------------KSIIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIR 887
            P    Y  +++IG+GS+G V  V H     K  V K I +   + +E +    EC +L  L+H NIV++   D  E+   LY+ M +C  GDL   +K  K     + EK +   L Q+  AL            + I++R          ++HRDLK  NIFL+                                        + ++K+GD G+AK LE+    A T +GTPYYMSPE+   +PY+  SDIWSLGCV +EM +L   F AKNY  L  KI  G+   +P  Y++ L  +I +M++ +   RPST ++L +  IR
Sbjct:   20 PPRSEYQVLEEIGRGSFGSVRKVIHIP-TKKLLVRKDIKYGHMNSKERQQLIAECSILSQLKHENIVEFYNWDFDEQKEVLYLYMEYCSRGDLSQMIKHYKQEHKYIPEKIVWGILAQLLTALYKCHYGVELPTLTTIYDRMKPPVKGKNIVIHRDLKPGNIFLSYDDSDYNINEQVDGHEEVNSNYYRDHRVNSGKRGSPMDYSQVVVKLGDFGLAKSLETSIQFATTYVGTPYYMSPEVLMDQPYSPLSDIWSLGCVIFEMCSLHPPFQAKNYLELQTKIKNGKCDTVPEYYSRGLNAIIHSMIDVNLRTRPSTFELLQDIQIR 344          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Yeast
Match: CDC5 (Polo-like kinase; controls targeting and activation of Rho1p at cell division site via Rho1p guanine nucleotide exchange factors; regulates Spc72p; also functions in adaptation to DNA damage during meiosis; regulates the shape of the nucleus and expansion of the nuclear envelope during mitosis; similar to Xenopus Plx1 and S. pombe Plo1p; human homologs PLK1, PLK3 can each complement yeast cdc5 thermosensitive mutants [Source:SGD;Acc:S000004603])

HSP 1 Score: 134.42 bits (337), Expect = 4.313e-33
Identity = 85/260 (32.69%), Postives = 144/260 (55.38%), Query Frame = 3
Query:  114 KNYSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFAR-SSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTKSI-IKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKK--PYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELIN----LIQAMLNKSPEKRPSTGKIL 869
            K+Y     +G+G +   + +K  D   + F  K ++ A   S++  +    E Q+ KS+ HPNIVQ+ D FE+++++YI +  C +G L   LK RK  +L E ++  +  QI  A+ Y+H R ++HRDLK  NIF   +  +KIGD G+A  L ++ +   T+ GTP Y++PE+   K   ++F+ DIWSLG + Y +   K  F A++   +  +I   +  D     +K + +    LI+ +L+  P +RPS  +I+
Sbjct:   80 KDYHRGHFLGEGGFARCFQIK--DDSGEIFAAKTVAKASIKSEKTRKKLLSEIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRK--VLTEPEVRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYIAPEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERI---KCRDFSFPRDKPISDEGKILIRDILSLDPIERPSLTEIM 332          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Yeast
Match: SPS1 (Putative protein serine/threonine kinase; localizes to the nucleus and cytoplasm; required for efficient spore packaging, prospore membrane development and closure and localization of enzymes involved in spore wall synthesis; interacts with and required for Ssp1p phosphorylation and turnover; member of the GCKIII subfamily of STE20 kinases; multiply phosphorylated on S/T residues; interacts with 14-3-3 proteins, Bmh1p and Bmh2p; expressed at the end of meiosis [Source:SGD;Acc:S000002931])

HSP 1 Score: 129.028 bits (323), Expect = 3.860e-32
Identity = 79/265 (29.81%), Postives = 136/265 (51.32%), Query Frame = 3
Query:  105 PFTKNYSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLT-KSIIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELF--EKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRD 890
            P +K YS    IG+G++G+V+  K  D   ++ V  K+     SD ++E    E   L  L+ P I  Y  +  E+ S++I M +C  G     LK    + L E+++   + ++T+ L Y+HE+  +HRD+K  NI L  + ++K+GD G++  + S      T +GTPY+M+PE+   E   YN K+DIWSLG  TYE+       +  +   +   +   + P +   ++    + +   L K+P  RPS   +L   F+++
Sbjct:   13 PPSKLYSIQSCIGRGNFGDVY--KAVDRVTQEIVAIKVVNLEHSDEDIELLAQEIFFLAELKSPLITNYIATMLEDVSMWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLHEQRKIHRDIKAANILLNEEGMVKLGDFGVSGHIRSTLK-RDTFVGTPYWMAPEVVCCEVDGYNEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGPFSDAAKDFVAGCLVKTPADRPSAYNLLSFEFVKN 274          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Yeast
Match: CMK1 (Calmodulin-dependent protein kinase; may play a role in stress response, many Ca++/calmodulin dependent phosphorylation substrates demonstrated in vitro, amino acid sequence similar to mammalian Cam Kinase II; CMK1 has a paralog, CMK2, that arose from the whole genome duplication [Source:SGD;Acc:S000001910])

HSP 1 Score: 126.331 bits (316), Expect = 1.648e-31
Identity = 84/272 (30.88%), Postives = 141/272 (51.84%), Query Frame = 3
Query:  114 KNYSFIKKIGQGSYGEVWLVKHKDYDHK---KFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLT----KSIIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTP--------DMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFI 884
            K Y F K +G G++G V   K+ +       K ++KK    + +  ++EA   E  +L+ L HPNIV +KD FE  +  YI     + G+L+ R+  +KG    E+  +  L++I  A+ Y+H +NI+HRDLK +N+       +S + + D GIAK+L+S  ++     G+  Y++PE+  +  +    DIWS+G +TY +     AF A+       +   G+ P        D  S   K+ I  ++A LN  P KRP+  ++L + +I
Sbjct:   35 KKYVFGKTLGAGTFGVVRQAKNTETGEDVAVKILIKKA--LKGNKVQLEALYDELDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRIL-KKGKF-TEEDAVRILVEILSAVKYMHSQNIVHRDLKPENLLYIDKSDESPLVVADFGIAKRLKSDEELLYKPAGSLGYVAPEVLTQDGHGKPCDIWSIGVITYTLLCGYSAFRAERVQDFLDECTTGEYPVKFHRPYWDSVSNKAKQFI--LKA-LNLDPSKRPTAAELLEDPWI 299          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Yeast
Match: CMK2 (Calmodulin-dependent protein kinase; may play a role in stress response, many CA++/calmodulan dependent phosphorylation substrates demonstrated in vitro, amino acid sequence similar to mammalian Cam Kinase II; CMK2 has a paralog, CMK1, that arose from the whole genome duplication [Source:SGD;Acc:S000005376])

HSP 1 Score: 122.865 bits (307), Expect = 2.857e-30
Identity = 77/268 (28.73%), Postives = 132/268 (49.25%), Query Frame = 3
Query:  117 NYSFIKKIGQGSYGEVWLVKHKDYDHK---KFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLT----KSIIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTP---DMP--SKYNKELINLIQAMLNKSPEKRPSTGKILCNNFI 884
            NY F + +G GS+G V   +    +     K +LKK    + ++ +++    E  +L+ L HPNIV +KD FE  +  YI       G+L+ R+  R      E   +E ++QI  A+ Y+H +N++HRDLK +N+        S + I D GIAKQL+ + D+     G+  Y++PE+  +  +    DIWS+G +TY +      F A++      +    + P    MP     + ++   I   L  +P  RP+  ++L + +I
Sbjct:   46 NYIFGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKA--LQGNNVQLQMLYEELSILQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSR--GKFTEVDAVEIIVQILGAVEYMHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGEEDLIYKAAGSLGYVAPEVLTQDGHGKPCDIWSIGVITYTLLCGYSPFIAESVEGFMEECTASRYPVTFHMPYWDNISIDVKRFILKALRLNPADRPTATELLDDPWI 309          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Nematostella
Match: EDO49690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG02])

HSP 1 Score: 337.035 bits (863), Expect = 1.230e-110
Identity = 160/272 (58.82%), Postives = 213/272 (78.31%), Query Frame = 3
Query:  120 YSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNS-LYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTKS-IIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFVEQSKRKF 929
            Y+  K IG+GSYGEV+L KHK  D K++VLKK+   ++S RE +AA LE +LL  L HPNIV Y++SF+++   LYIAM FCE GDLY+RLK +KG  L E QI+EW +QI MAL Y+HE++ILHRDLKTQNIFLTKS IIK+GDLGIA+ LES  DMA T+IGTPYYMSPELF  KPYN KSD+W+LGC  YEM TL+HAFNAK+ ++L YKIL G+TP +P +Y+ +L ++I++ML++ P+KRPS  ++L + +I+  I +F+E +K ++
Sbjct:    6 YTIGKCIGKGSYGEVFLSKHKK-DKKQYVLKKVDLQKASVRERKAAELEAKLLSQLRHPNIVSYRESFQDDTGFLYIAMNFCEGGDLYSRLKAQKGIPLDENQIVEWFVQIAMALQYMHEKHILHRDLKTQNIFLTKSKIIKVGDLGIARVLESSSDMATTLIGTPYYMSPELFSNKPYNHKSDVWALGCCLYEMCTLRHAFNAKDMSSLVYKILKGKTPPLPKQYSTDLCSIIKSMLDQDPDKRPSASRLLRHPYIKKQIALFLEGTKNRY 276          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Nematostella
Match: EDO49822 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG20])

HSP 1 Score: 279.256 bits (713), Expect = 1.217e-88
Identity = 129/266 (48.50%), Postives = 186/266 (69.92%), Query Frame = 3
Query:  120 YSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTK-SIIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFVEQ 914
            Y  +KKIG+GS+G+  LVK ++ D K +V+K+I+  R   RE E +R E ++L  L+HPNIV Y++SFEE+ +LYI M +C+ GDLY ++  ++G    E Q+++W +QI + L ++H+R ILHRD+K+QNIFLT+  IIK+GD GIA+ L S  ++A+T IGTPYY+SPE+ E +PYN KSDIWSLGCV YEM TLKHAF A N   L  KI+ G  P +P +Y+ ++  L+  +L ++P  RPS   +L  NFI+  I  F+ +
Sbjct:    4 YVRVKKIGEGSFGKALLVKKRN-DGKHYVIKEINICRMKPREREESRKEVKVLSQLKHPNIVSYQESFEESGNLYIVMDYCDGGDLYKKINGQRGIAFSEDQVMDWFVQICLGLKHVHDRKILHRDIKSQNIFLTRHGIIKMGDFGIARVLHSTVELARTCIGTPYYLSPEIVENRPYNNKSDIWSLGCVLYEMLTLKHAFEAGNMKNLVLKIIRGSYPPIPLRYSADIRMLVAQLLKRNPHDRPSVNTVLKKNFIQKRIEKFLSK 268          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Nematostella
Match: EDO49138 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH03])

HSP 1 Score: 232.646 bits (592), Expect = 4.031e-71
Identity = 114/251 (45.42%), Postives = 163/251 (64.94%), Query Frame = 3
Query:  120 YSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTKS-IIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKIL 869
            Y  I  IG+G++G  WLV+ +    + + LK+++       +   A  E ++L +L+H NIV+Y+D+FEE    YI M + E GDL+T++K+       E+ I+ WL Q+ +AL +IH +NILHRDLKTQNIFLTK  ++KIGD GIA+ L+S  D A+T +GTPYY+SPE+ +++PYN KSDIW+LGCV YE+ T  H F A N T L  KIL G  P +P  Y   L +L+  ML  +P  RPS  +++
Sbjct:    4 YQKIDIIGKGTFGSAWLVESRQ-SKRLYALKELNATAMPSEDRHLALNEVKILSTLKHRNIVRYRDAFEETGRFYIVMEYAEGGDLHTKIKQAVEPFSSER-ILNWLAQLLLALKHIHGQNILHRDLKTQNIFLTKDDVVKIGDFGIARILDSTCDHARTTVGTPYYLSPEICQRQPYNNKSDIWALGCVLYELTTRTHPFTADNLTNLVVKILHGNYPPIPRFYGPLLEDLVAVMLKINPADRPSAKQLI 252          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Nematostella
Match: EDO37069 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGU2])

HSP 1 Score: 222.246 bits (565), Expect = 3.654e-67
Identity = 109/267 (40.82%), Postives = 164/267 (61.42%), Query Frame = 3
Query:  108 FTKNYSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLK--ERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTKSIIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHM 902
            +   Y  ++++G GS+G V+LV+    + ++ VLK+I        E   A  E +LL  L HPNIV++ DSF +     I   +CE GDL  ++    + G    E  I+ W IQI +A+ ++HE  ILHRDLKT+NIFL  +I+K+GD GI++ L    DMA T  GTPYYMSPE+ + + YN KSDIWSLG V YE+  L+HAF  ++   + YKI+ G+ P +  KY+ +L      +++K P+ RPS  +IL ++FI ++I++
Sbjct:    2 YANRYRVVRRLGSGSFGTVFLVEDLKANGERKVLKEIYVGELQPDETVDAMREAKLLSKLNHPNIVKFMDSFMDREYFCIVTEYCEGGDLDDKISAWRKSGKKFDESLILAWFIQIVLAVQHMHEMRILHRDLKTRNIFLKNNIVKLGDFGISRILMGTSDMATTFTGTPYYMSPEVLKHEGYNHKSDIWSLGVVLYELCNLQHAFQGQSLMGVMYKIVEGELPALSDKYSSQLQAFYSRLMDKDPKLRPSANEILKHHFIAENINV 268          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Nematostella
Match: EDO46185 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQY7])

HSP 1 Score: 223.402 bits (568), Expect = 3.211e-63
Identity = 115/263 (43.73%), Postives = 167/263 (63.50%), Query Frame = 3
Query:  114 KNYSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTKS--IIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHI 896
            +NY  ++ +G+G+YG V+L + +  D+   ++K+I     +  E ++A  E ++L   +HPNI++Y DSF +  +L I M + + G +Y  L++R G L+ E +I+   +QI +AL ++H+  ILHRDLKTQNI L K   ++KIGD GI+K L SK   A TVIG+P Y+SPEL E KPYN KSD+WSLGCV YE+ TLK AF A N  AL  KI+ G    +P +Y++EL  LI  ML   P KRP   +I+    I + +
Sbjct:    2 QNYEKVRIVGRGAYGTVYLCR-RLVDNFLVIIKQIPVEEMTKEERQSALNEVKVLSMFQHPNIIRYYDSFVQEKALMIVMEYAQGGTIYDYLQQRGGKLMDEDEILRLFVQILLALRHVHKGQILHRDLKTQNILLNKKRKVVKIGDFGISKILSSK-SKANTVIGSPCYISPELCEGKPYNQKSDVWSLGCVLYELTTLKRAFEASNLPALVLKIMRGYFSPIPERYSEELRKLILDMLVLDPTKRPGIKEIMAQPVIVNAL 262          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Medaka
Match: nek4 (NIMA related kinase 4 [Source:NCBI gene;Acc:101169778])

HSP 1 Score: 353.599 bits (906), Expect = 1.911e-109
Identity = 165/275 (60.00%), Postives = 213/275 (77.45%), Query Frame = 3
Query:  117 NYSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFE-ENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTKS-IIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFVEQSKRKFDK 935
            +Y FI+ +G+GSYGEV LVKHK  D K++V+KK++ + SS RE  +A  E QLL  L HPNIV Y++S+E ++  LYI M FCE GDLY RLK+RKG LL E+Q++EW +QI MAL Y+HERNILHRDLKTQNIFLTK+ IIK+GDLGIA+ LE++ DMA T+IGTPYYMSPELF  KPYN KSD+W+LGC  YEM+TLKHAFNAK+  +L Y+I+ G+ P MPS+Y+ +L +LI++ML+K PE+RP    IL   +I+  I MF+E +K K  K
Sbjct:    3 SYIFIRVVGKGSYGEVNLVKHK-TDRKQYVIKKLNLSTSSKRERRSAEQEAQLLSQLRHPNIVTYRESWEGDDRQLYIVMGFCEGGDLYHRLKQRKGELLPERQVVEWFVQIAMALQYLHERNILHRDLKTQNIFLTKTNIIKVGDLGIARVLENQNDMASTLIGTPYYMSPELFSNKPYNHKSDVWALGCCVYEMSTLKHAFNAKDMNSLVYRIVEGKLPQMPSRYDPQLGDLIKSMLSKKPEERPDVKLILRQPYIKRQIAMFLEATKEKTAK 276          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Medaka
Match: ENSORLT00000000545.2 (pep primary_assembly:ASM223467v1:4:1040495:1044496:1 gene:ENSORLG00000000439.2 transcript:ENSORLT00000000545.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 250.751 bits (639), Expect = 1.631e-77
Identity = 124/264 (46.97%), Postives = 177/264 (67.05%), Query Frame = 3
Query:  120 YSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTK-SIIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFV 908
            Y  +K+IG+GS+G+  LV  K+ D +++V+K+I  +  S +E   +R E  +L ++ HPNIVQYK+SFE    LYI M +CE GDL+ ++  +KG L  E QI++W +QI +AL ++H R ILHRD+K+QNIFLTK   +++GD GIA+ L +  ++A+T IGTPYY+SPE+ E KPYN K DIW+LGCV YEM TLKHAF A N   L  KI+ G  P +   Y+ EL +L+  +  ++P +RPS   IL   F+   I  F+
Sbjct:    4 YENVKQIGEGSFGKAILVNSKE-DGRQYVIKEIGISGMSTKERRESRKEVSVLANMSHPNIVQYKESFE-GGCLYIVMDYCEGGDLFKKINSQKGVLFSEDQILDWFVQICLALKHVHGRKILHRDIKSQNIFLTKDGTVQLGDFGIARVLNT-VELARTCIGTPYYLSPEICENKPYNNK-DIWALGCVLYEMCTLKHAFEAGNMKNLVLKIIRGSYPPVSVHYSPELRSLLAQLFRRNPRERPSVSSILEKPFLSCRIEKFL 263          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Medaka
Match: ENSORLT00000034147.1 (serine/threonine-protein kinase Nek5 [Source:NCBI gene;Acc:101162253])

HSP 1 Score: 234.187 bits (596), Expect = 2.862e-66
Identity = 107/263 (40.68%), Postives = 168/263 (63.88%), Query Frame = 3
Query:  117 NYSFIKKIGQGSYGEVWLVKHK-DYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTKSIIK--IGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHI 896
            +Y  + +IG+G++G+ +LV+ K      + V+K+I+  + S +E E++R E  LL  + HPNIV +  SF E  SL+I M FC+ GDL  ++  ++G    E++I++  +QI + L +IH++ +LHRD+K QNIFLT   +K  +GD GIA+ L +  D+A+T +GTPYY+SPE+ E +PYN K+D+WSLGCV YE+ TL+H F   +   L  KI  G+   +P++Y  EL  L+  +   +P  RPS   +L   F++ HI
Sbjct:    3 DYEVLWQIGEGAFGKAFLVRSKTGGGDTQCVIKQINLQKMSAKERESSRKEVTLLSRMRHPNIVSFISSFLEKGSLFIVMEFCDGGDLLKKINMQRGVPFREEEILDLFVQICLGLKHIHDKKVLHRDIKCQNIFLTNGGMKAKLGDFGIARMLNNSMDLARTCVGTPYYLSPEICESRPYNNKTDVWSLGCVLYELCTLRHPFEGSSLRQLLGKICRGRYAPVPTRYTHELRLLVNQLFKVNPRDRPSISSVLQRPFLQKHI 265          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Medaka
Match: nek8 (NIMA related kinase 8 [Source:NCBI gene;Acc:101161178])

HSP 1 Score: 224.557 bits (571), Expect = 4.589e-63
Identity = 129/293 (44.03%), Postives = 180/293 (61.43%), Query Frame = 3
Query:  120 YSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTKS--IIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFI-RDHIHMFVEQSK---RKFDKPCRHRKTSLSKNLPG 980
            Y  IK +G+G++G V L + +  D    +LK+I   + S  E  AA+ ECQ+LK L HPNI++Y ++F E+ +L IAM +   G L   +++R  SLL E  I+ + +QI +AL ++H + ILHRDLKTQNI L K   I+KIGD GI+K L SK   A TV+GTP Y+SPEL E KPYN KSDIW+LGCV YE+A+LK AF A N  AL  KI+ G    +  +Y+ EL  LI  MLN  P KRP   +I+      R  ++++ +      R+ +KP     +++   LPG
Sbjct:    4 YEKIKVVGRGAFGIVHLCRRRS-DGAFVILKEIPVEQMSRDERLAAQNECQVLKLLNHPNIIEYYENFLEDKALMIAMEYAPGGTLAEYIQKRCNSLLDEDTILHFFVQILLALYHVHNKLILHRDLKTQNILLDKHQMIVKIGDFGISKILVSK-SKAYTVVGTPCYISPELCEGKPYNQKSDIWALGCVLYELASLKRAFEAANLPALVLKIMSGTFAPISDRYSPELRQLILNMLNLDPSKRPQLNEIMALPICTRPLLNLYTDVGNVKMRRIEKP----LSAVQLGLPG 290          
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Medaka
Match: ENSORLT00000027525.1 (NIMA related kinase 3 [Source:NCBI gene;Acc:101171427])

HSP 1 Score: 209.92 bits (533), Expect = 9.708e-60
Identity = 99/264 (37.50%), Postives = 163/264 (61.74%), Query Frame = 3
Query:  120 YSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLT-KSIIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNN----FIRDHI 896
            Y+ +K +G+GS+G   LV+      +K+V+K+I   ++  + +  +R E  LL  ++HPNIV ++++FE  + L I M +C  GDL  R++++K +  C + I+ W  Q+     +IH++ +LHRDLK++NIFLT    +K+GD G A  L S    A   +GTPYY++PE+++ KPYN KSD+WSLGCV YE+  L+H F A ++ +L  K+  G  P +P     EL++L++ +   +P+ RPS   IL ++     +R H+
Sbjct:    4 YTQLKVVGEGSFGRAVLVQWIS-TQEKYVVKEIQLPKNESK-LRDSRKEAILLSRMKHPNIVAFREAFEMTDLLCIVMEYCSGGDLLQRIQQQKATNFCTENILRWFAQMCAGAQHIHDKRVLHRDLKSKNIFLTGDGSVKLGDFGSACVLNSSKAYAHAYVGTPYYVAPEIWDNKPYNNKSDVWSLGCVLYELCALQHPFQASSWKSLILKVCRGAYPPLPRHLPYELLHLMKQIFKTNPKDRPSVQTILTSHRVSKLLRSHL 265          
BLAST of Serine/threonine-protein kinase Nek4 vs. Planmine SMEST
Match: SMESG000005635.1 (SMESG000005635.1)

HSP 1 Score: 1159.82 bits (2999), Expect = 0.000e+0
Identity = 628/635 (98.90%), Postives = 632/635 (99.53%), Query Frame = 3
Query:   99 MVPFTKNYSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTKSIIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFVEQSKRKFDKPCRHRKTSLSKNLPGEFHKELYNYQDKSLGNKVSEVSDENNDKLKTTVDTSTLKNHXXXXXXXXXXXXIXXXXXXXXXXXXXXXXXENQVDSRKSSKTDLEIEFQKGLRNSEDKVVAHQYKQNENLMRSRSFSSDPVAPKVGQAEVPEESSPNKVAREKRRHIKREQGFQTLRNPSAICGNNFDIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGNGLPLPELRRSDNAEDMQNEEVTSIDVLQVVEKMNETLNLNEKFNNIKDSILLYKIQKEPNNVEPIEDEQETLDRSKFMNKRYQEIRKELMTAVGYKNLALCFDILRDLNLNHEEKIREILGEDYDRYCGKVIWLKMIEEA 2003
            M PFTKNYSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTKSIIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFVEQSKRK+DKPCRHRKTSLSKNLPGEFHKELYNYQDKSLGNKVSEVSDENNDKLKTTVDTSTLKN+DDEYDDNDDVVVIHSSNDSHSKKSSNSSSKENQVDSRKSSKTDLEIEFQKGLRNSEDKVVAHQYKQNENL+RSRSFSSDPVAPKVGQAEVPEESSPNKVAREKRR +KREQGFQTLRNPSAICGNNFDINDEKDNKADEN SNHNRNRRRKNNSFNQNGNGLPLPELRRSDNAEDMQNEEVTSIDVLQVVEKMNETLNLNEKFNNIKDSILLYKIQKEPNNVEPIEDEQETLDRSKFMNKRYQEIRKELMTAVGYKNLALCFDILRDLNLNHEEKIREILGEDYDRYCGKVIWLKMIEEA
Sbjct:    1 MTPFTKNYSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTKSIIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFVEQSKRKYDKPCRHRKTSLSKNLPGEFHKELYNYQDKSLGNKVSEVSDENNDKLKTTVDTSTLKNNDDEYDDNDDVVVIHSSNDSHSKKSSNSSSKENQVDSRKSSKTDLEIEFQKGLRNSEDKVVAHQYKQNENLVRSRSFSSDPVAPKVGQAEVPEESSPNKVAREKRRQMKREQGFQTLRNPSAICGNNFDINDEKDNKADENGSNHNRNRRRKNNSFNQNGNGLPLPELRRSDNAEDMQNEEVTSIDVLQVVEKMNETLNLNEKFNNIKDSILLYKIQKEPNNVEPIEDEQETLDRSKFMNKRYQEIRKELMTAVGYKNLALCFDILRDLNLNHEEKIREILGEDYDRYCGKVIWLKMIEEA 635          
BLAST of Serine/threonine-protein kinase Nek4 vs. Planmine SMEST
Match: SMESG000020466.1 (SMESG000020466.1)

HSP 1 Score: 240.736 bits (613), Expect = 4.572e-67
Identity = 118/265 (44.53%), Postives = 171/265 (64.53%), Query Frame = 3
Query:  117 NYSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTK-SIIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFV 908
            ++  + KIGQG++G  WLV+ K  D KK+VLK+I   +  ++E   AR E  LL  + HPNIV Y +SFEE    +I M +CE GDLY ++K + G L  E Q++++ IQI +AL +IH++ ILHRD+K QNIFLTK + +K+GD GIAK ++S   + KT +GTP+Y SPE+ E  PYN KSDIWSLGC+ YE+ +L +AF  ++ T L+ +I       +PS ++  L  L+  M  + P++RP+   IL   FI   I  F+
Sbjct:    6 DFKRLNKIGQGAFGIAWLVESK-IDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFL 269          
BLAST of Serine/threonine-protein kinase Nek4 vs. Planmine SMEST
Match: SMESG000020466.1 (SMESG000020466.1)

HSP 1 Score: 240.736 bits (613), Expect = 4.811e-67
Identity = 118/265 (44.53%), Postives = 171/265 (64.53%), Query Frame = 3
Query:  117 NYSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTK-SIIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFV 908
            ++  + KIGQG++G  WLV+ K  D KK+VLK+I   +  ++E   AR E  LL  + HPNIV Y +SFEE    +I M +CE GDLY ++K + G L  E Q++++ IQI +AL +IH++ ILHRD+K QNIFLTK + +K+GD GIAK ++S   + KT +GTP+Y SPE+ E  PYN KSDIWSLGC+ YE+ +L +AF  ++ T L+ +I       +PS ++  L  L+  M  + P++RP+   IL   FI   I  F+
Sbjct:    6 DFKRLNKIGQGAFGIAWLVESK-IDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFL 269          
BLAST of Serine/threonine-protein kinase Nek4 vs. Planmine SMEST
Match: SMESG000020466.1 (SMESG000020466.1)

HSP 1 Score: 240.736 bits (613), Expect = 4.925e-67
Identity = 118/265 (44.53%), Postives = 171/265 (64.53%), Query Frame = 3
Query:  117 NYSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTK-SIIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFV 908
            ++  + KIGQG++G  WLV+ K  D KK+VLK+I   +  ++E   AR E  LL  + HPNIV Y +SFEE    +I M +CE GDLY ++K + G L  E Q++++ IQI +AL +IH++ ILHRD+K QNIFLTK + +K+GD GIAK ++S   + KT +GTP+Y SPE+ E  PYN KSDIWSLGC+ YE+ +L +AF  ++ T L+ +I       +PS ++  L  L+  M  + P++RP+   IL   FI   I  F+
Sbjct:    6 DFKRLNKIGQGAFGIAWLVESK-IDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFL 269          
BLAST of Serine/threonine-protein kinase Nek4 vs. Planmine SMEST
Match: SMESG000043302.1 (SMESG000043302.1)

HSP 1 Score: 214.157 bits (544), Expect = 3.522e-60
Identity = 118/248 (47.58%), Postives = 156/248 (62.90%), Query Frame = 3
Query:  129 IKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTKS-IIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKIL 869
            I+ +G+G+YG   L + KD D    +LK+I+    S  E + A  E ++L  L+HPNIV Y DSFEE+  L I M + ++G L   L  ++  L  EK+I+E   QI  A+ YIHE  ILHRDLKT NIFLTK  IIKIGD GI+K L + ++ A +VIGTPYY+SPE+ + K YN KSD+W+LGC+ YEM  L   F   N  AL  KIL GQ   +   Y+ EL  LI ++L K+P+ R ST  IL
Sbjct:   63 IRTVGKGAYGTAVLYRKKD-DDSLVILKEINMHDLSATERQLAMNEVKVLSQLDHPNIVAYFDSFEEDGVLMIEMEYADNGTLAQFLSNQEKPLE-EKKILEMFFQIVSAIHYIHEHKILHRDLKTVNIFLTKEEIIKIGDFGISKMLSTTHEGANSVIGTPYYISPEMCQGKLYNEKSDVWALGCILYEMTCLHKTFEGSNLPALVNKILKGQFEPVKGSYSDELKELISSLLEKNPDDRLSTEVIL 308          
The following BLAST results are available for this feature:
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NEK41.063e-10458.03NIMA related kinase 4 [Source:HGNC Symbol;Acc:HGNC... [more]
NEK43.356e-10458.03NIMA related kinase 4 [Source:HGNC Symbol;Acc:HGNC... [more]
NEK13.412e-8048.86NIMA related kinase 1 [Source:HGNC Symbol;Acc:HGNC... [more]
NEK14.555e-8048.86NIMA related kinase 1 [Source:HGNC Symbol;Acc:HGNC... [more]
NEK14.733e-8048.86NIMA related kinase 1 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nekl-24.968e-5434.81Serine/threonine-protein kinase nekl-2 [Source:Un... [more]
nekl-14.601e-5240.71NEK (NEver in mitosis Kinase) Like [Source:UniPro... [more]
nekl-14.815e-5240.71NEK (NEver in mitosis Kinase) Like [Source:UniPro... [more]
nekl-32.480e-4838.67Serine/threonine-protein kinase nekl-3 [Source:Un... [more]
nekl-32.480e-4838.67Serine/threonine-protein kinase nekl-3 [Source:Un... [more]
back to top
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
niki6.387e-5341.63gene:FBgn0045980 transcript:FBtr0084737[more]
Nek29.622e-4033.33gene:FBgn0029970 transcript:FBtr0071142[more]
polo4.331e-3632.23gene:FBgn0003124 transcript:FBtr0074839[more]
polo4.331e-3632.23gene:FBgn0003124 transcript:FBtr0100318[more]
fu5.336e-3631.39gene:FBgn0001079 transcript:FBtr0074602[more]
back to top
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nek42.266e-10759.64NIMA-related kinase 4 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
nek42.297e-10759.64NIMA-related kinase 4 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
nek11.190e-8748.86NIMA-related kinase 1 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
CABZ01040556.11.862e-6842.15NIMA related kinase 3 [Source:NCBI gene;Acc:100536... [more]
nek113.977e-6839.60NIMA-related kinase 11 [Source:ZFIN;Acc:ZDB-GENE-1... [more]
back to top
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nek15.766e-8149.62NIMA-related kinase 1 [Source:NCBI gene;Acc:100036... [more]
nek15.911e-8149.62NIMA-related kinase 1 [Source:NCBI gene;Acc:100036... [more]
nek16.290e-8149.62NIMA-related kinase 1 [Source:NCBI gene;Acc:100036... [more]
nek17.163e-8149.62NIMA-related kinase 1 [Source:NCBI gene;Acc:100036... [more]
sez6l25.695e-7441.33seizure related 6 homolog like 2 [Source:Xenbase;A... [more]
back to top
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nek42.504e-11058.36NIMA (never in mitosis gene a)-related expressed k... [more]
Nek41.354e-10658.03NIMA (never in mitosis gene a)-related expressed k... [more]
Nek41.531e-10658.03NIMA (never in mitosis gene a)-related expressed k... [more]
Nek48.395e-9658.70NIMA (never in mitosis gene a)-related expressed k... [more]
Nek16.391e-8249.62NIMA (never in mitosis gene a)-related expressed k... [more]
back to top
BLAST of Serine/threonine-protein kinase Nek4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Z1J2|NEK4_MOUSE1.152e-10558.03Serine/threonine-protein kinase Nek4 OS=Mus muscul... [more]
sp|P51957|NEK4_HUMAN1.612e-10358.03Serine/threonine-protein kinase Nek4 OS=Homo sapie... [more]
sp|P51954|NEK1_MOUSE4.899e-8149.62Serine/threonine-protein kinase Nek1 OS=Mus muscul... [more]
sp|Q96PY6|NEK1_HUMAN2.789e-7948.86Serine/threonine-protein kinase Nek1 OS=Homo sapie... [more]
sp|Q6P3R8|NEK5_HUMAN3.298e-7144.91Serine/threonine-protein kinase Nek5 OS=Homo sapie... [more]
back to top
BLAST of Serine/threonine-protein kinase Nek4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GHX11.062e-12263.14Protein kinase domain-containing protein (Fragment... [more]
A0A267DKL92.818e-12263.14Protein kinase domain-containing protein (Fragment... [more]
A0A1I8G6F91.063e-12163.14Protein kinase domain-containing protein OS=Macros... [more]
A0A3S5A6U81.075e-12064.94Protein kinase domain-containing protein OS=Protop... [more]
A0A1I8HTB53.071e-12063.06Protein kinase domain-containing protein OS=Macros... [more]
back to top
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nek42.085e-10754.09NIMA related kinase 4 [Source:NCBI gene;Acc:103043... [more]
nek42.391e-10754.09NIMA related kinase 4 [Source:NCBI gene;Acc:103043... [more]
nek11.117e-8149.24NIMA related kinase 1 [Source:NCBI gene;Acc:103028... [more]
nek11.158e-8149.24NIMA related kinase 1 [Source:NCBI gene;Acc:103028... [more]
ENSAMXT00000049860.16.124e-7138.56pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007414.12.270e-8546.21pep scaffold:Pmarinus_7.0:GL476981:230882:244405:1... [more]
NEK91.617e-5637.20NIMA related kinase 9 [Source:HGNC Symbol;Acc:HGNC... [more]
ENSPMAT00000000555.11.692e-4941.62pep scaffold:Pmarinus_7.0:GL477093:35206:42652:1 g... [more]
nek28.394e-4638.67NIMA-related kinase 2 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
ENSPMAT00000001750.12.160e-4550.00pep scaffold:Pmarinus_7.0:GL481695:1137:12922:1 ge... [more]
back to top
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
KIN39.461e-4132.21Nonessential serine/threonine protein kinase; poss... [more]
CDC54.313e-3332.69Polo-like kinase; controls targeting and activatio... [more]
SPS13.860e-3229.81Putative protein serine/threonine kinase; localize... [more]
CMK11.648e-3130.88Calmodulin-dependent protein kinase; may play a ro... [more]
CMK22.857e-3028.73Calmodulin-dependent protein kinase; may play a ro... [more]
back to top
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO496901.230e-11058.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498221.217e-8848.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491384.031e-7145.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO370693.654e-6740.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461853.211e-6343.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Serine/threonine-protein kinase Nek4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nek41.911e-10960.00NIMA related kinase 4 [Source:NCBI gene;Acc:101169... [more]
ENSORLT00000000545.21.631e-7746.97pep primary_assembly:ASM223467v1:4:1040495:1044496... [more]
ENSORLT00000034147.12.862e-6640.68serine/threonine-protein kinase Nek5 [Source:NCBI ... [more]
nek84.589e-6344.03NIMA related kinase 8 [Source:NCBI gene;Acc:101161... [more]
ENSORLT00000027525.19.708e-6037.50NIMA related kinase 3 [Source:NCBI gene;Acc:101171... [more]
back to top
BLAST of Serine/threonine-protein kinase Nek4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005635.10.000e+098.90SMESG000005635.1[more]
SMESG000020466.14.572e-6744.53SMESG000020466.1[more]
SMESG000020466.14.811e-6744.53SMESG000020466.1[more]
SMESG000020466.14.925e-6744.53SMESG000020466.1[more]
SMESG000043302.13.522e-6047.58SMESG000043302.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016820 ID=SMED30016820|Name=Serine/threonine-protein kinase Nek4|organism=Schmidtea mediterranea sexual|type=transcript|length=2228bp
CCATATACTACTGTTAATTGCATTATTTAAATCATCAAAGTTTCATGTTT
TTATGTAATTTATTATCATATTGATACTTGAATTTATTTTTTACAATAAT
GGTTCCATTTACAAAAAATTATTCATTTATTAAAAAAATTGGCCAGGGAT
CTTACGGAGAAGTGTGGTTAGTAAAGCATAAGGACTATGATCACAAAAAG
TTTGTACTAAAAAAAATAAGTTTTGCGAGATCATCAGATCGTGAAATGGA
AGCCGCCAGATTGGAATGCCAGTTATTGAAAAGTTTAGAACATCCAAATA
TCGTTCAATACAAAGATTCATTTGAAGAAAATAATTCATTATATATTGCT
ATGGCATTTTGTGAAAGTGGAGATTTATATACTCGACTGAAAGAAAGGAA
AGGCTCGCTTTTATGTGAAAAGCAAATCATTGAATGGCTAATTCAAATAA
CAATGGCTTTATCGTATATTCACGAAAGAAACATTTTGCATAGAGATCTC
AAAACCCAAAACATATTTCTGACAAAGTCCATTATAAAAATTGGCGATCT
TGGCATTGCAAAGCAACTTGAGAGCAAATATGACATGGCAAAAACGGTGA
TTGGCACTCCATACTACATGAGTCCGGAATTGTTTGAGAAGAAACCATAT
AATTTTAAATCAGATATATGGTCCCTTGGCTGTGTGACTTATGAAATGGC
AACGTTAAAACATGCCTTTAATGCGAAAAACTATACTGCACTTTCATACA
AAATTCTGATGGGTCAAACTCCAGATATGCCATCAAAATATAACAAAGAA
TTGATAAATCTTATTCAAGCAATGCTCAATAAATCCCCAGAAAAGAGGCC
AAGTACCGGGAAGATATTGTGCAATAATTTCATTCGGGACCATATACATA
TGTTCGTCGAACAATCTAAAAGGAAATTTGACAAACCTTGTCGTCATCGA
AAAACATCTTTGTCGAAAAATTTGCCTGGAGAATTCCACAAAGAATTATA
CAATTATCAAGACAAGTCACTTGGAAATAAAGTATCGGAAGTATCAGATG
AAAATAATGACAAATTAAAAACGACAGTCGATACGTCGACTTTGAAAAAT
CATGACGATGAATATGATGACAATGATGACGTAGTTGTCATTCATTCTAG
CAATGATTCACATTCGAAAAAGTCTTCAAACAGCAGTTCAAAAGAAAATC
AGGTAGATTCGAGGAAATCTAGCAAAACCGATTTGGAAATTGAATTCCAG
AAAGGTTTACGCAATTCTGAAGATAAAGTTGTAGCACATCAATATAAACA
AAATGAAAATTTAATGCGATCTCGAAGTTTTAGCTCCGATCCAGTTGCTC
CAAAAGTTGGTCAAGCAGAAGTACCCGAAGAATCATCACCAAATAAAGTT
GCCAGAGAAAAACGCCGGCATATAAAACGCGAACAAGGATTTCAAACTTT
AAGAAATCCTAGTGCAATTTGTGGTAATAATTTTGATATCAATGACGAAA
AGGATAATAAAGCCGATGAAAATGATTCTAATCATAATCGTAATAGGCGA
AGGAAAAATAATTCATTTAATCAAAACGGTAATGGCCTTCCTCTTCCTGA
ATTGAGGCGTAGTGACAATGCAGAAGATATGCAGAATGAAGAAGTTACAA
GCATTGATGTGTTGCAAGTGGTTGAAAAAATGAACGAAACGTTGAATCTC
AATGAAAAATTTAATAATATTAAGGATAGTATTTTGCTGTATAAAATTCA
GAAAGAACCTAATAACGTTGAACCAATTGAAGATGAACAAGAGACCCTGG
ATAGAAGTAAATTTATGAATAAGCGTTATCAAGAAATCCGAAAAGAACTT
ATGACGGCAGTCGGTTACAAAAACCTTGCACTATGCTTTGATATATTGCG
GGATTTAAATCTTAATCATGAGGAAAAAATTAGAGAGATTTTGGGCGAGG
ATTATGATAGATATTGTGGTAAAGTAATCTGGTTAAAAATGATCGAAGAA
GCATAAAAAGAAAATTAACCATTTTACAATTAAAAATGGCTTTCTTACAT
TTTTACATTTTCGTTTTTTTCAATCAGAATTTTGTAAATTATTTCCATTT
TTATAGTGTTTATAAATTTGATATGACAATTGTAAAATTTGTCATGGTAT
ATGAAATTGGACCTGACGGACCTTCCAAATGCCGCCACATTTTCATGGTC
ATTGACTGTCTCATTAACATATCTGTAA
back to top

protein sequence of SMED30016820-orf-1

>SMED30016820-orf-1 ID=SMED30016820-orf-1|Name=SMED30016820-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=636bp
MVPFTKNYSFIKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREM
EAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKER
KGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTKSIIKIGD
LGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEM
ATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKR
PSTGKILCNNFIRDHIHMFVEQSKRKFDKPCRHRKTSLSKNLPGEFHKEL
YNYQDKSLGNKVSEVSDENNDKLKTTVDTSTLKNHDDEYDDNDDVVVIHS
SNDSHSKKSSNSSSKENQVDSRKSSKTDLEIEFQKGLRNSEDKVVAHQYK
QNENLMRSRSFSSDPVAPKVGQAEVPEESSPNKVAREKRRHIKREQGFQT
LRNPSAICGNNFDINDEKDNKADENDSNHNRNRRRKNNSFNQNGNGLPLP
ELRRSDNAEDMQNEEVTSIDVLQVVEKMNETLNLNEKFNNIKDSILLYKI
QKEPNNVEPIEDEQETLDRSKFMNKRYQEIRKELMTAVGYKNLALCFDIL
RDLNLNHEEKIREILGEDYDRYCGKVIWLKMIEEA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0004702signal transducer, downstream of receptor, with serine/threonine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
GO:0030145manganese ion binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0000278mitotic cell cycle
GO:0006974cellular response to DNA damage stimulus
GO:0007049cell cycle
GO:0007067mitotic nuclear division
GO:0016310phosphorylation
GO:0023014signal transduction by protein phosphorylation
GO:0045893positive regulation of transcription, DNA-templated
GO:0051301cell division
GO:1900062regulation of replicative cell aging
GO:2000772regulation of cellular senescence
GO:2001020regulation of response to DNA damage stimulus
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005929cilium
GO:0042995cell projection
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 8..262
e-value: 7.4E-91
score: 317.8
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 8..261
e-value: 3.6E-65
score: 219.9
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 8..270
score: 48.16
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 2..87
e-value: 1.6E-26
score: 94.3
NoneNo IPR availablePIRSFPIRSF000615TyrPK_CSF1-Rcoord: 24..385
e-value: 5.2E-13
score: 45.6
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 88..286
e-value: 3.7E-58
score: 198.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 405..506
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 464..481
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 350..378
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 430..446
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 352..368
NoneNo IPR availablePANTHERPTHR43671:SF39coord: 6..435
NoneNo IPR availablePANTHERPTHR43671FAMILY NOT NAMEDcoord: 6..435
NoneNo IPR availableCDDcd08215STKc_Nekcoord: 7..262
e-value: 5.67407E-140
score: 406.078
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 14..38
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 129..141
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 4..286