SMED30016814

Overview
NameSMED30016814
Smed IDSMED30016814
Length (bp)5231
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30016814 (SMED30016814) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30016814 (SMED30016814) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016814

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30016814SMESG000016214.1 PL06017A1F10_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Alignments
SMED30016814 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000152:76943..104315 -25823
Homology
BLAST of SMED30016814 vs. Planmine SMEST
Match: SMESG000016214.1 (SMESG000016214.1)

HSP 1 Score: 3371.25 bits (8740), Expect = 0.000e+0
Identity = 1677/1677 (100.00%), Postives = 1677/1677 (100.00%), Query Frame = 1
Query:  118 CWNCVKLEEFCIEENGIQRELNHVWIRNGCQCKCEILRDKIGITCNECAEKSEKLLMVLPDGLDGYFSDKDMEVYCNFDNGRLEINTTEGFRNSNNSMNIGGDYNDSNETICASCVTSFQRSSLKCYKMIGYAPDLYFDIPTNFYPIGRNLTIKCELRPKGISKYFHNIVVMTQINDSVHSGYLNGVDHGEICFVCKHQCPACTILSSIYNCFKPLNILYLTPNKSSEYSTNKTLMLHCLPDNNARLHINLKNVNFTSDSSVELKNISKTVCAYCSSFYFTNPKTCYLVKEMAISKDDVDDTMKLLDENLMKERITELRSNVTGRKIYLFQKTVVNLSIIPIYLVYLRSTPMKIICLVHPQKFKDTQYNVTLISLNATALTISRFEMQITGTDRSTICFQCGSSSTNFTIRCYKYYNQNVSVTIGPQKTSVFFRKTPLDVFCQVIPSDLINFMEDIFLEGDDPQLIRIDGRSLRIESVIHQKICFYCGNKVIKNATKCYELYTQDVIISIEPSSPPYYYKGQRIQVTCIVKPPDIFQKVQNIEIIWHNTSFNKDTDLSLTLTGKYVGDIICVLCGNILIYLESMCYEYLDTSNPSIDFIPKYQIFLPKVQMTVACILSPKEFYKPQYGFSLSFKNASGMKLSGLEFVMNGLNTDTVCFNCSGTPMKSLVKCYSLYSAAISLSIDPNSKXXXXXXXXXXXXCRVKPDEVVTKNLITDIMLNSNASKVTRVGSLHFNIPNIQSQTQFCFTCGNRVIANISKCYMFMGNVPTFEIYPAATFLFFRNPTTLTCNVTPANSALTKFSFDLFFLNTSYYTNVNQHVKTLSVNIPFDNHQICLTCGVPVTNITKCYILKKQDIVIEIIPKVNYYLVYDDTMDVICQVSPIKSLPNFPGLGFTKMSLSYYKVITQRHYKICHPKSRCAGKFCFTCADPQLPTVFKCYKPWTGTVNFFMTPRNHILFYMEPHLIVCHVDKPFTKNESIKMDINGLKLNEYTYIPAEMTIKILPLHYLLNRRVIAVCGTNFPTMKANHIYNLTGAVNLDYDPNFLIFMGFYQNFRIVTYFTFAKKNYSANCVIISPIPLIRVTGSVIELFRYLGSGTYHFRCPFPNTTSIYIFSLNVLNISVQSRIEPQGPTLYYIYNSLVECIYVPFFVPFSRIDKRVIGLNPSDYTWRSSGMEIAKKLSLRGAKVCITCRFSPMFINTKCYNLKANISFIYHPVMXXXXXXXXXXXXXXXFKHRLLAETFQSTCRMKSGSHQLNILGGNITLAIPLWSGTYLVECYPPNSTEMTELQLKVFSDPINLIIYPPAGTVVIMDTVRIYCEVQPSLNLGMIILSTMQSFLHGNDSSEKIIPNSVLFRDRCLCFSCNCAKMSSVRQCYNFTTPLILRTKPKQDLYFAWNRVTIETYFINKNKPGRKYLAMCSLPYENFSVSNLGEIHISPMLVNLVYDFHCTIPTVVDYQILTLFVYSNKVELEIIPNNTDIYIFSMVMEVECIVKPDDLNVVFPVIKFLSINSTQYVYKAFRLILIGGVDYDVKDIICVVCGHDYLPFNVSRCFSPYMGDINVTILPLEWEIYYLMPHTITCKIVPQFSNYSKVSFFVIGIPKSSYKVSSDLTIRINSDKTLINKDICVICGNRPTMNKSRCYRLASDDESRCFDYVIVMTIMLTFLVLAVYISTYEVM 5148
            CWNCVKLEEFCIEENGIQRELNHVWIRNGCQCKCEILRDKIGITCNECAEKSEKLLMVLPDGLDGYFSDKDMEVYCNFDNGRLEINTTEGFRNSNNSMNIGGDYNDSNETICASCVTSFQRSSLKCYKMIGYAPDLYFDIPTNFYPIGRNLTIKCELRPKGISKYFHNIVVMTQINDSVHSGYLNGVDHGEICFVCKHQCPACTILSSIYNCFKPLNILYLTPNKSSEYSTNKTLMLHCLPDNNARLHINLKNVNFTSDSSVELKNISKTVCAYCSSFYFTNPKTCYLVKEMAISKDDVDDTMKLLDENLMKERITELRSNVTGRKIYLFQKTVVNLSIIPIYLVYLRSTPMKIICLVHPQKFKDTQYNVTLISLNATALTISRFEMQITGTDRSTICFQCGSSSTNFTIRCYKYYNQNVSVTIGPQKTSVFFRKTPLDVFCQVIPSDLINFMEDIFLEGDDPQLIRIDGRSLRIESVIHQKICFYCGNKVIKNATKCYELYTQDVIISIEPSSPPYYYKGQRIQVTCIVKPPDIFQKVQNIEIIWHNTSFNKDTDLSLTLTGKYVGDIICVLCGNILIYLESMCYEYLDTSNPSIDFIPKYQIFLPKVQMTVACILSPKEFYKPQYGFSLSFKNASGMKLSGLEFVMNGLNTDTVCFNCSGTPMKSLVKCYSLYSAAISLSIDPNSKYVYPPVVLLDVYCRVKPDEVVTKNLITDIMLNSNASKVTRVGSLHFNIPNIQSQTQFCFTCGNRVIANISKCYMFMGNVPTFEIYPAATFLFFRNPTTLTCNVTPANSALTKFSFDLFFLNTSYYTNVNQHVKTLSVNIPFDNHQICLTCGVPVTNITKCYILKKQDIVIEIIPKVNYYLVYDDTMDVICQVSPIKSLPNFPGLGFTKMSLSYYKVITQRHYKICHPKSRCAGKFCFTCADPQLPTVFKCYKPWTGTVNFFMTPRNHILFYMEPHLIVCHVDKPFTKNESIKMDINGLKLNEYTYIPAEMTIKILPLHYLLNRRVIAVCGTNFPTMKANHIYNLTGAVNLDYDPNFLIFMGFYQNFRIVTYFTFAKKNYSANCVIISPIPLIRVTGSVIELFRYLGSGTYHFRCPFPNTTSIYIFSLNVLNISVQSRIEPQGPTLYYIYNSLVECIYVPFFVPFSRIDKRVIGLNPSDYTWRSSGMEIAKKLSLRGAKVCITCRFSPMFINTKCYNLKANISFIYHPVMDYYTIYYQDYYVVTYFKHRLLAETFQSTCRMKSGSHQLNILGGNITLAIPLWSGTYLVECYPPNSTEMTELQLKVFSDPINLIIYPPAGTVVIMDTVRIYCEVQPSLNLGMIILSTMQSFLHGNDSSEKIIPNSVLFRDRCLCFSCNCAKMSSVRQCYNFTTPLILRTKPKQDLYFAWNRVTIETYFINKNKPGRKYLAMCSLPYENFSVSNLGEIHISPMLVNLVYDFHCTIPTVVDYQILTLFVYSNKVELEIIPNNTDIYIFSMVMEVECIVKPDDLNVVFPVIKFLSINSTQYVYKAFRLILIGGVDYDVKDIICVVCGHDYLPFNVSRCFSPYMGDINVTILPLEWEIYYLMPHTITCKIVPQFSNYSKVSFFVIGIPKSSYKVSSDLTIRINSDKTLINKDICVICGNRPTMNKSRCYRLASDDESRCFDYVIVMTIMLTFLVLAVYISTYEVM
Sbjct:   14 CWNCVKLEEFCIEENGIQRELNHVWIRNGCQCKCEILRDKIGITCNECAEKSEKLLMVLPDGLDGYFSDKDMEVYCNFDNGRLEINTTEGFRNSNNSMNIGGDYNDSNETICASCVTSFQRSSLKCYKMIGYAPDLYFDIPTNFYPIGRNLTIKCELRPKGISKYFHNIVVMTQINDSVHSGYLNGVDHGEICFVCKHQCPACTILSSIYNCFKPLNILYLTPNKSSEYSTNKTLMLHCLPDNNARLHINLKNVNFTSDSSVELKNISKTVCAYCSSFYFTNPKTCYLVKEMAISKDDVDDTMKLLDENLMKERITELRSNVTGRKIYLFQKTVVNLSIIPIYLVYLRSTPMKIICLVHPQKFKDTQYNVTLISLNATALTISRFEMQITGTDRSTICFQCGSSSTNFTIRCYKYYNQNVSVTIGPQKTSVFFRKTPLDVFCQVIPSDLINFMEDIFLEGDDPQLIRIDGRSLRIESVIHQKICFYCGNKVIKNATKCYELYTQDVIISIEPSSPPYYYKGQRIQVTCIVKPPDIFQKVQNIEIIWHNTSFNKDTDLSLTLTGKYVGDIICVLCGNILIYLESMCYEYLDTSNPSIDFIPKYQIFLPKVQMTVACILSPKEFYKPQYGFSLSFKNASGMKLSGLEFVMNGLNTDTVCFNCSGTPMKSLVKCYSLYSAAISLSIDPNSKYVYPPVVLLDVYCRVKPDEVVTKNLITDIMLNSNASKVTRVGSLHFNIPNIQSQTQFCFTCGNRVIANISKCYMFMGNVPTFEIYPAATFLFFRNPTTLTCNVTPANSALTKFSFDLFFLNTSYYTNVNQHVKTLSVNIPFDNHQICLTCGVPVTNITKCYILKKQDIVIEIIPKVNYYLVYDDTMDVICQVSPIKSLPNFPGLGFTKMSLSYYKVITQRHYKICHPKSRCAGKFCFTCADPQLPTVFKCYKPWTGTVNFFMTPRNHILFYMEPHLIVCHVDKPFTKNESIKMDINGLKLNEYTYIPAEMTIKILPLHYLLNRRVIAVCGTNFPTMKANHIYNLTGAVNLDYDPNFLIFMGFYQNFRIVTYFTFAKKNYSANCVIISPIPLIRVTGSVIELFRYLGSGTYHFRCPFPNTTSIYIFSLNVLNISVQSRIEPQGPTLYYIYNSLVECIYVPFFVPFSRIDKRVIGLNPSDYTWRSSGMEIAKKLSLRGAKVCITCRFSPMFINTKCYNLKANISFIYHPVMDYYTIYYQDYYVVTYFKHRLLAETFQSTCRMKSGSHQLNILGGNITLAIPLWSGTYLVECYPPNSTEMTELQLKVFSDPINLIIYPPAGTVVIMDTVRIYCEVQPSLNLGMIILSTMQSFLHGNDSSEKIIPNSVLFRDRCLCFSCNCAKMSSVRQCYNFTTPLILRTKPKQDLYFAWNRVTIETYFINKNKPGRKYLAMCSLPYENFSVSNLGEIHISPMLVNLVYDFHCTIPTVVDYQILTLFVYSNKVELEIIPNNTDIYIFSMVMEVECIVKPDDLNVVFPVIKFLSINSTQYVYKAFRLILIGGVDYDVKDIICVVCGHDYLPFNVSRCFSPYMGDINVTILPLEWEIYYLMPHTITCKIVPQFSNYSKVSFFVIGIPKSSYKVSSDLTIRINSDKTLINKDICVICGNRPTMNKSRCYRLASDDESRCFDYVIVMTIMLTFLVLAVYISTYEVM 1690          
BLAST of SMED30016814 vs. Planmine SMEST
Match: SMESG000004613.1 (SMESG000004613.1)

HSP 1 Score: 279.641 bits (714), Expect = 2.232e-80
Identity = 184/599 (30.72%), Postives = 294/599 (49.08%), Query Frame = 1
Query: 3355 IRVTGSVIELFRYLGSGTYHFRCPFPNTTSIYIFSLNVLNISVQSRIEPQGPTLYYIYNSLVECIYVPFFVPFSRIDKRVIGLNPSDYTWRSSGMEIAKKLSLRGAKVCITCRFSPMFINTKCYNLKANISFIYHPVMXXXXXXXXXXXXXXXFKHRLLAETFQSTCRMKSGSHQLNILGGNITLAIPLWSGTYLVECYPPNSTEMTELQLKVFSDPINLIIYPPAGTVVIMDTVRIYCEVQP-SLNLGMIILSTMQSFLHGNDSSEKIIPNSVLFRDRCLCFSCNCAKMSSVRQCYNFTTPLILRTKPKQDLYFAWNRVTIETYFINKNKPGRKYLAMCSLPYENFSVSNLGEIHISPMLVNLVYDFHCTIPTVVDYQILTLFVYSNKVELEIIPNNTDIYIFSMVMEVECIVKPDDLNVVFPVIKFLSINSTQYVYKAFRLILIGGVDYDVKDIICVVCGHDYLPFNVSRCFSPYMGDINVTILPLEWEIYYLMPHTITCKIVPQFSNYSKVSFFVIGIPKSSYKVSSDLTIRINSDKTLINKDICVICGNRPTMNKSRCYRLASDDESRCFDYVIVMTIMLTFLVLAVYISTYEVM 5148
            + + G+++E   +LG    H +     + ++    L    +   + I P   +LY++ N  + C++         I+  V GL  +DY     G+EI K + L   KVC+   +  +  + +CY L A+ISF  +  +  Y        + TYF++ L  +   S C   + + Q+NI  G I L   + +  Y   C+  NS     L +  +  P++LI  P    ++I   V I C+ +P  ++   II+ T  +F H    +  I+ NS+L  DRC+CF C       V +CYN  T   L   P Q++YFA  +  I+ +FI+K K  R Y  MCS   +   + N+  I I+  + N  YD  C IP +    +L + +Y+  V + I P  +D+Y+  +   V+C V P +L  + P I+FL INS  Y   + R I+IG  +      IC  CGH Y+P    +CF+ Y  D+NVTI+PL  E+ ++    I C   P F+  S + F +I +    Y  + DL I I  D +LI +++C ICGN   MN ++CY L    ES+   YV+V  I++  + + VYI   EVM
Sbjct:   41 LEIKGNIVENVPWLGIKDDHLQINVAESEAV----LREKALQRNAYILPNTSSLYFMDNPHIYCVFAESNGFTEFINISVSGLKFTDYIIGRKGVEIMKYIHLVSKKVCVDFYYPKIINSYRCYELVASISFY-YYPLYEYYSLKTTKAIYTYFRYDL--KILDSICHSDNKNIQINITNGIIHLNENMLNMNYKFRCHLNNSKYQRNLSINFYDGPMSLIFSPSKSVIIIKSNVTITCQTKPYPIDYSFIIIYTYDTFEHHIIDNTVILENSLLLHDRCICFRCISIGFGDVSKCYNIKTSTGLFLFPYQNIYFALKQDKIQIHFIDKYKLNRSYPTMCSFSIQGNFIFNINLITITSSVPNGSYDIECHIPNLSHRDVLRINIYAIDVTVTITPTESDVYLTDVPFTVQCQVSPIELLYILPDIRFLEINSEYYTNISNRDIIIGEFNQTDYSPICFKCGHQYMPQYDIKCFNSYEDDVNVTIVPLVDELRFMESQVIKCYFWPHFTKASLIQFRMISLQMEYYTKTDDLIILIKKDSSLIGRNVCAICGNITKMNGTKCYVLIGSPESQIVYYVLVAIILVCVIGVMVYIKKNEVM 632          

HSP 2 Score: 71.633 bits (174), Expect = 3.549e-12
Identity = 77/304 (25.33%), Postives = 123/304 (40.46%), Query Frame = 1
Query: 2353 CFTCGNRVIANISKCYMFMGNVPTFEIYPAATFLFFRNPTTLTCNVTPANSALTKFSFDLFFLNTSYYTNVNQHVKTLSVNIPFDNHQICLTCGVP---------VTNITKCYILKKQ----DIVIEIIPKVNYYLVYDDTMDVICQVSPIKSLPNFPGLGFTKMSLSYYKVITQRHYKICHPKSRCAGKFCFTCADPQLPTV-FKCYKPWTGTVNFFMTPRNHILFYMEPHLIVCHVDKPFTKNESIKMDINGLKLNEYTYIPAEMTIKILPLHYLLNRRVIAVCGTNFPTMKANHIYNLTGA 3222
            CF C +    ++SKCY    +   F ++P     F      +  +             D + LN SY T  +  ++    N  F+ + I +T  VP         + N++   +L+      D+ + I P  +   + D    V CQVSPI+ L   P + F +++  YY  I+ R   I           CF C    +P    KC+  +   VN  + P    L +ME  +I C+    FTK   I+  +  L++  YT    ++ I I     L+ R V A+CG N   M     Y L G+
Sbjct:  315 CFRCISIGFGDVSKCYNIKTSTGLF-LFPYQNIYFALKQDKIQIHF-----------IDKYKLNRSYPTMCSFSIQG---NFIFNINLITITSSVPNGSYDIECHIPNLSHRDVLRINIYAIDVTVTITPTESDVYLTDVPFTVQCQVSPIELLYILPDIRFLEINSEYYTNISNRDIIIGEFNQTDYSPICFKCGHQYMPQYDIKCFNSYEDDVNVTIVPLVDELRFMESQVIKCYFWPHFTKASLIQFRMISLQMEYYTK-TDDLIILIKKDSSLIGRNVCAICG-NITKMNGTKCYVLIGS 601          

HSP 3 Score: 57.3806 bits (137), Expect = 8.553e-8
Identity = 49/179 (27.37%), Postives = 79/179 (44.13%), Query Frame = 1
Query: 1363 YNQNVSVTIGPQKTSVFFRKTPLDVFCQVIPSDLINFMEDI-FLEGDDPQLIRIDGRSLRI---ESVIHQKICFYCGNKVI-KNATKCYELYTQDVIISIEPSSPPYYYKGQRIQVTCIVKPPDIFQKVQNIEIIWHNTSFNKDTDLSLTLTGK---YVGDIICVLCGNILIYLESMCY 1875
            Y  +V+VTI P ++ V+    P  V CQV P +L+  + DI FLE +      I  R + I       +  ICF CG++ + +   KC+  Y  DV ++I P      +   ++ + C   P      +    +I     +   TD  + L  K    +G  +C +CGNI     + CY
Sbjct:  419 YAIDVTVTITPTESDVYLTDVPFTVQCQVSPIELLYILPDIRFLEINSEYYTNISNRDIIIGEFNQTDYSPICFKCGHQYMPQYDIKCFNSYEDDVNVTIVPLVDELRFMESQV-IKCYFWPHFTKASLIQFRMISLQMEYYTKTDDLIILIKKDSSLIGRNVCAICGNITKMNGTKCY 596          

HSP 4 Score: 55.4546 bits (132), Expect = 4.106e-7
Identity = 55/199 (27.64%), Postives = 87/199 (43.72%), Query Frame = 1
Query: 1150 VYLRSTPMKIICLVHPQKFKDTQYNVTLISLNATALT-ISRFEM---QITGTDRSTICFQCGSSST-NFTIRCYKYYNQNVSVTIGPQKTSVFFRKTPLDVFCQVIP----SDLINF----MEDIFLEGDDPQLIRIDGRSLRIESVIHQKICFYCGNKVIKNATKCYELYTQDVIISIEPSSPPYYYKGQRIQVTCIV 1707
            VYL   P  + C V P +      ++  + +N+   T IS  ++   +   TD S ICF+CG      + I+C+  Y  +V+VTI P    + F ++ + + C   P    + LI F    ++  +    D  +I I   S    S+I + +C  CGN    N TKCY L          P S   YY    I + C++
Sbjct:  434 VYLTDVPFTVQCQVSPIELLYILPDIRFLEINSEYYTNISNRDIIIGEFNQTDYSPICFKCGHQYMPQYDIKCFNSYEDDVNVTIVPLVDELRFMESQV-IKCYFWPHFTKASLIQFRMISLQMEYYTKTDDLIILIKKDS----SLIGRNVCAICGNITKMNGTKCYVLIGS-------PESQIVYYVLVAIILVCVI 620          

HSP 5 Score: 55.0694 bits (131), Expect = 4.787e-7
Identity = 78/379 (20.58%), Postives = 154/379 (40.63%), Query Frame = 1
Query: 2956 NFFMTPRNHILFYMEPHLIVCHVDKPFTKNESIKMDINGLKLNEYTYIPAEMTIKILPLHYLLNRRVIAVCGTNFPT-MKANHIYNLTGAVNLDYDPNFLIFMGFYQNFRIVTYFTFAKKNYSANCVIISPIPLIRVTGSVIELFRYLGSGTYHFRCPFPNTTSIYIFSLNVLNISVQSRIEPQGPTLYYIYNSLVECIYVPFFVPFSRIDKRVIGLNPSDYTWRSSGMEIAKKLSLRGAKVCITCRFSPMFINTKCYNLKANISFIYHPVMXXXXXXXXXXXXXXXFKHRLLAETFQSTCRMK-SGSHQLNILGGNITLAIPLWSGTYLVECYPPNSTEMTELQLKVFSDPINLIIYPPAGTVVIMDT-VRIYCEVQP 4083
            N ++ P    L++M+   I C   +     E I + ++GLK  +  YI     ++I+   +L++++V       +P  + +   Y L  +++  Y      +        I TYF +  K   + C   +    I +T  +I L   + +  Y FRC   N+      S+N  +  +     P    +    N  + C   P+ + +S I   +   +  ++    + + +   L L    +C  C        +KCYN+K +      P  + Y    QD   + +     L  ++ + C     G+   NI    IT ++P  +G+Y +EC+ PN +    L++ +++  + + I P    V + D    + C+V P
Sbjct:   80 NAYILPNTSSLYFMDNPHIYCVFAESNGFTEFINISVSGLKFTD--YIIGRKGVEIMKYIHLVSKKVCV--DFYYPKIINSYRCYELVASISF-YYYPLYEYYSLKTTKAIYTYFRYDLKILDSICHSDNKNIQINITNGIIHLNENMLNMNYKFRCHLNNSKYQRNLSINFYDGPMSLIFSPSKSVIIIKSNVTITCQTKPYPIDYSFI--IIYTYDTFEHHIIDNTVILENSLLLHDRCICFRCISIGFGDVSKCYNIKTSTGLFLFPYQNIYFALKQDKIQIHFIDKYKLNRSYPTMCSFSIQGNFIFNINLITITSSVP--NGSYDIECHIPNLSHRDVLRINIYAIDVTVTITPTESDVYLTDVPFTVQCQVSP 449          
BLAST of SMED30016814 vs. Planmine SMEST
Match: SMESG000004618.1 (SMESG000004618.1)

HSP 1 Score: 273.092 bits (697), Expect = 6.358e-74
Identity = 260/1002 (25.95%), Postives = 422/1002 (42.12%), Query Frame = 1
Query:  364 LEINTTEGFRNSNNSMNIGGDYNDSNETICASCVTSFQRSSLKCYKMIGYAPDLYFDIPTNFYPIGRNLTIKCELRPKGISKYFHNIVVMTQINDSVHSGYLNGVDHGEICFVCKHQCPACT--ILSSIYNCFKPLNILYLTPNKSSEYSTNKTLMLHCLPDNNARL----HINLKNVNFTSDS-SVELKNISKTVCAYCSSFYFTNPKTCY--LVKEMAISK-----------------DDVDDTMKLLDENLMKERITELRSNVTGRKI----------YLFQKTV--------VNLSIIPIYLVYLRSTPMKIICLVHPQKFKDTQYNVTLISL-NATALTISRFEMQITGTDRSTICFQCGSSSTNFTIRCYKYYNQNVSVTIGPQKTSVFFRKTPLDVFCQVIPSDLI--NFMEDIFLEGDDPQLIRIDGRSLRIESVIHQKICFYCGNKVIKNATKCYELYTQDVIISIEPSSPPYYYKGQRIQVTCIVKPPDIFQKVQNIEIIWHNTSFNKDTDLSLTLTGKYVGDIICVLCGNILIYLESMCYEYLDTSNPSIDFIPKYQIFLPKVQMTVACILSPKEFYKPQY--GFSLSFKNASGMKLSGLEFVMNGLNTDTVCFNCSGTPMKSLVKCYSLYSAAISLSIDPNSKXXXXXXXXXXXXCRVKPDEVVTKNLITDIMLNSNASKVTRVGSLHFNIPNIQSQTQFCFTCGNRVIANISKCYMFMGNVPTFEIYPAATFLFFRN-PTTLTCNVTPANSALTKFSFDLFFLN------TSYYTNVNQHVKTLS-VNIPFDNHQICLTCG-VPVTNITKCYILKKQDIVIEIIPKVNYYLVYDDTMDVICQVSPIKSLPNFPGLGFTKMSLSYYKVITQRHYKICHPKSRCAGKFCFTCADPQLPTVFKCYKPWTGTVNFFMTPRNHILFYMEPHL-IVCHVDKPFTKNESIKMDINGLKLNEYTYIPAEMTIKILPLHYLLNRRVIAV----CGTNF 3180
            L INTTE  R S  S+ IG  YN SN TICA C +        CY MIGY P    +IP N YP  R  ++ C + PK   KY+ NI++   +N++   G L G +   +CF C+ +    T  IL     C  P  +  L P  +  Y   KT+ L+C P +N  L     + L+++   + S   +    +KT+C +CS+     P+TC   L+ E  I                   D + +T K L    M            G  I          +L   T         + + + P   +Y+ +      C + P  F          S  NAT   IS  +M +  +    IC  C     +    CY+ YN+ + +TI P  +S++F+   L V C++ P ++I  N + +I  E   PQ+ R+      +       +CF CGN ++ +  KCY+ Y + + ++  P+    Y+   +I  +C   P  I+  +Q++E+I+ N +  K + LS+T  G+ +G  +C  CG    + ++ CY+Y               ++L  + M V C ++P E +  +   G    + N S      + + + G++   +CF C       +  CY  ++  + L+I PN+  VY   + + V C V+P  ++   LI DI L SN+S V  V  L   IP   S T  CFTCGN+ I   +KCY++     +  I+P  T ++F N    + C + P           +F+LN        Y  + +  +  L    I  D   +C +CG   + N TKC+   K  +   I P V+ YL  +  M V C V P +      G+GF   +      I+  + K            CF C       V KCY  +  T+   + P    +++   +L + C +  P   N   K+               ++T+   P   LLN +  +V    CG +F
Sbjct:  239 LVINTTEIMRISKQSLIIGSRYNLSNRTICAYCASKIVIYPKVCYHMIGYKPVFSLNIPANMYPPRRRTSVFCNMFPKEAEKYYKNILL--TMNNTAFGGILYG-NETIVCFQCQLKRFISTEKILDHYEKCLIPHPVYNLIPENTKAYFFFKTMELNCNPSDNEVLIQADTLELRSLQHHTISIGGKYNKNNKTICVFCSTVLLVYPQTCLIILIIEPKIFIKPNSTMYRVGRPNTYFCDVIPNTTKSLFSIDMFIGTVPFSGFFNGTDIGRVCLTCHNNFLQNATKCVIPYNGPLKIEVFPKSKIYISNKNSTFQCQMTPNLFTGGNTVAPEFSFTNATNFIISG-DMVLFVSGSGDICITCIHPWIDPMTNCYESYNKPIVLTINPNYSSIYFKGKNLRVKCELYPEEIIQKNLINNISFECLSPQVKRVSELEFLLTGQDLGSVCFVCGNPLLGSTRKCYDYYDKIIDVNFHPNYTTVYFPNLKIVFSCDFVPISIYNLIQDLEMIYLNDTSLKISKLSVTFNGQNLGR-MCFSCGKAAYFTKTECYDYFVVPMTFYITPEGTSVYLSNMLMEVTCNVNPPEVFTQKLVTGIGFIYNNYSISSTIVVSYTVVGVDMGRLCFRCGHINYTHVDSCYDYFADPVILTIQPNNSKVYLKGINMAVTCTVEPLRIIQNGLIKDIKLKSNSSNVDYVSDLSLEIPT-GSITTICFTCGNKFIFTSTKCYLYFDEPVSIIIHPNYTHVYFANLLLRVECEILP---------MKIFYLNLITGIEMVYLNDTSAPISNLEYFIIGTDKGTMCFSCGHFLLRNETKCFEFYKTPMSFLIEPLVSIYLP-NKEMSVYCYVLPGELSRKITGIGFVSTNF-----ISTSNEKEIIIYGNLTFTLCFKCGHVLYSNVTKCYDYYNHTITITIIPDFSSIYFANKNLNVSCQITPPGIINIVTKIKFE---------FENDLTLPHAPFWILLNGKYKSVICFNCGDHF 1210          

HSP 2 Score: 233.417 bits (594), Expect = 1.530e-61
Identity = 224/921 (24.32%), Postives = 396/921 (43.00%), Query Frame = 1
Query:  289 VLPDGLDGYFSDKDMEVYCNFDNGR--LEINTTEGFRNSNNSMNIGGDYNDSNETICASCVTSFQRSSLKCYKMIGYAPDLYFDIPTNFYPIGRNLTIKCELRPKGISKYFHNIVVMTQINDSVHSGYLNGVDHGEICFVCKHQCPACTILSSIYNCFKPLNILYLTPNKSSEYSTNKTLMLHCLPDNNARLHINLKNVNFTSDSSVELKNISKTVCAYCSSFYFTNPKTCYLVKEMAISKDDVDDTMKLLDENLMKERITELRSNVTGRKIYLFQKTVVNLSIIPIYL-VYLRSTPMKIICLVHPQKF--KDTQYNVTLISLNATALTISRFEMQITGTDRSTICFQCGSSSTNFTIRCYKYYNQNVSVTIGPQKTSVFFRKTPLDVFCQVIPSDLINFMEDIFLEGDDPQLIRIDGRSLRIESVIHQKICFYCGNKVIKNATKCYELYTQDVIISIEPSSPPYYYKGQRIQVTCIVKPPDIFQK--VQNIEIIWHNTSFNKDTDLSLTLTGKYVGDIICVLCGNILIYLESMCYEYLDTSNPSIDFIP--KYQIFLPKVQMTVACILSPKEFYKPQYGFSLSFK-NASGMK-LSGLEFVMNGLNTDTVCFNCSGTPMKSLVKCYSLYSAAISLSIDPNSKXXXXXXXXXXXXCRVKPDEVVTKNLITDIMLNSNASKVTRVGSLHFNIPNIQSQTQFCFTCGNRVIANISKCYMFMGNVPTFEIYPAATFLFFRNPTTLTCNVTPANSALTKFSFDLFFLNTSYYTNVNQHVKTLSVNIPFDNHQICLTCG-VPVTNITKCYILKKQDIVIEIIPKVNYYLVYDDTMDVICQVSPIKSLPNFPGLG--FTKMSLSYYKVITQRH---YKICHPKSRCAGKFCFTCADPQLPTVFKCYKPWTGTVNFFMTPRNHILFYME 3000
            ++P+    YF  K ME+ CN  +    ++ +T E     +++++IGG YN +N+TIC  C T        C  ++   P ++    +  Y +GR  T  C++ P      F    +   I     SG+ NG D G +C  C +       L +   C  P N                 L +   P   ++++I+ KN  F    +  L     TV      F FTN     +  +M +      D         +        S         + K +V L+I P Y  +Y +   +++ C ++P++   K+   N++   L+     +S  E  +TG D  ++CF CG+     T +CY YY++ + V   P  T+V+F    +   C  +P  + N ++D+ +   +   ++I   S+        ++CF CG       T+CY+ +   +   I P     Y     ++VTC V PP++F +  V  I  I++N S +    +S T+ G  +G + C  CG+I       CY+Y   ++P I  I     +++L  + M V C + P    +      +  K N+S +  +S L   +   +  T+CF C    + +  KCY  +   +S+ I PN  +VY   +LL V C + P ++   NLIT I +         + +L + I      T  CF+CG+ ++ N +KC+ F     +F I P  +        ++ C V P    L++    + F++T++ +  N+    +  N+ F    +C  CG V  +N+TKCY      I I IIP  +     +  ++V CQ++P       PG+    TK+   +   +T  H   + + + K +     CF C D  +    +CY  +   + F++ P NH   Y++
Sbjct:  376 LIPENTKAYFFFKTMELNCNPSDNEVLIQADTLELRSLQHHTISIGGKYNKNNKTICVFCSTVLLVYPQTCLIILIIEPKIFIKPNSTMYRVGRPNTYFCDVIPNTTKSLFS---IDMFIGTVPFSGFFNGTDIGRVCLTCHNN-----FLQNATKCVIPYN---------------GPLKIEVFPK--SKIYISNKNSTFQCQMTPNLFTGGNTVAP---EFSFTNATNFIISGDMVLFVSGSGDICITCIHPWIDPMTNCYES---------YNKPIV-LTINPNYSSIYFKGKNLRVKCELYPEEIIQKNLINNISFECLSPQVKRVSELEFLLTGQDLGSVCFVCGNPLLGSTRKCYDYYDKIIDVNFHPNYTTVYFPNLKIVFSCDFVPISIYNLIQDLEMIYLNDTSLKISKLSVTFNGQNLGRMCFSCGKAAYFTKTECYDYFVVPMTFYITPEGTSVYLSNMLMEVTCNVNPPEVFTQKLVTGIGFIYNNYSISSTIVVSYTVVGVDMGRL-CFRCGHINYTHVDSCYDYF--ADPVILTIQPNNSKVYLKGINMAVTCTVEPLRIIQNGLIKDIKLKSNSSNVDYVSDLSLEIPTGSITTICFTCGNKFIFTSTKCYLYFDEPVSIIIHPNYTHVYFANLLLRVECEILPMKIFYLNLITGIEMVYLNDTSAPISNLEYFIIGTDKGTM-CFSCGHFLLRNETKCFEFYKTPMSFLIEPLVSIYLPNKEMSVYCYVLPG--ELSRKITGIGFVSTNFISTSNEKEIIIYGNLTF---TLCFKCGHVLYSNVTKCYDYYNHTITITIIPDFSSIYFANKNLNVSCQITP-------PGIINIVTKIKFEFENDLTLPHAPFWILLNGKYKSV--ICFNCGDHFIYVERRCYDHYNTYLTFYIQP-NHTTVYLK 1239          

HSP 3 Score: 193.741 bits (491), Expect = 2.793e-49
Identity = 226/924 (24.46%), Postives = 387/924 (41.88%), Query Frame = 1
Query:  289 VLPDGLDGYFSDKDMEVYC-NFDNGR---LEINTTEGFRNSNNSMNIGGDYNDSNETICASCVTSFQRSSLKCYKMIGYAPDLYFDIPTNFYPIGRNLTIKCELRPKGISKYFHNIVVMTQINDSVHSGYLNGVDHGEICFVCKHQCPACTILSSIYNCFKPLNILYLTPNKSSEYSTNKTLMLHC-LPDNNARLHINLKNVNFTSDSSVELK---NIS-KTVCAYCSSFYFTNPKTCYLVKEMAISKDDVDDTMKLLDENLMKERITELRSNVTGRKIYLFQKTVVNLSIIPIYLVYLRSTPMKIICLVHPQKFKDTQYNVTLISLNATALTISRFEMQITGTDRSTICFQCGSSSTNFTIRCYKYYNQ----NVSVTIGPQKTSVFFRKTPLDVFCQVIPSDLINFMEDIFLEGDDPQLIRIDGRSLRIESVIHQK---ICFYCGNKVIKNATKCYELYTQDVIISIEPSSPPYYYKGQRIQVTCIVKPPDIFQKVQNIEIIWHNTSFNKDTDLSLTLTGKYVGDIICVLCGNILIYLESMCYEYLDTSNP-SIDFIPKYQIFLPKVQMTVACILSPKEF-----YKPQYGFSLSFKNASGMKLSGLEFVMNGLNTDTVCFNCSGTPMKSLVKCYSLYSAAISLSIDPNSKXXXXXXXXXXXXCRVKPDEVVTKNLITDIMLNSNASKVTRVGSLHFNIPNIQSQTQFCFTCGNRVIANISKCYMFMGNVPTFEIYPAATFLFFRN-PTTLTCNVTPANSALTKFSFDLFFLNTSYYTNVNQHVKTLSVNIPFDN-HQICLTCG-VPVTNITKCYILKKQDIVIEIIPKVNYYLVYDDTMDVICQVSPIKSLPN--FPGLGFTKMSLSYYKVITQRHYKICHPKSRCAGKFCFTCADPQLPTVFKCYKPWTGTVNFFMTPRN 2979
            V PD ++ YF+D +M + C N  NG+   L +NTTE +  + +S+ IGG YN  +  ICA+C+ S   S L CY + G   ++ F++P  +Y   R   + CE++P  I+     IV ++  N + H+G +N   +  ICF C   C  C  L +I  C++P N   L P   S Y     + L C  PD +  L IN   +   S  S+ +    N+S +T+CAYC+S     PK CY +                                       +  K V +L+I        R T   + C + P++  +  Y   L+++N TA         I   + + +CFQC       T +   +Y +    +    + P+ T  +F    +++ C   PSD      ++ ++ D  +L  +   ++ I    ++    IC +C   ++     C  +   +  I I+P+S   Y  G+     C V  P+  + + +I++      F      S    G  +G  +C+ C N  +   + C   +  + P  I+  PK +I++     T  C ++P  F       P++    SF NA+   +SG + V+    +  +C  C    +  +  CY  Y+  I L+I+PN   +Y     L V C + P+E++ KNLI +I     + +V RV  L F +   Q     CF CGN ++ +  KCY +   +     +P  T ++F N     +C+  P +        ++ +LN     + +  +  LSV     N  ++C +CG       T+CY      +   I P+     + +  M+V C V+P +        G+GF   + S    I   +  +        G+ CF C       V  CY  +   V   + P N
Sbjct:   46 VFPDDINFYFADFEMLISCLNEINGQFSVLLLNTTESYIINKSSILIGGIYNYKSTIICATCLESAFSSPLHCYTIRGKLHNISFNVPGIYYLPQRTTIVYCEVKPP-INIKSKEIVNISLANGTQHNGVINPGFNSVICFKCFPICTLCDFLKNITKCYQPQNFHILQPKDESVYYFTIEMTLQCDPPDVDIMLVINTTEIMRISKQSLIIGSRYNLSNRTICAYCASKIVIYPKVCYHM---------------------------------------IGYKPVFSLNIPANMYPPRRRT--SVFCNMFPKE-AEKYYKNILLTMNNTAFG------GILYGNETIVCFQCQLKRFISTEKILDHYEKCLIPHPVYNLIPENTKAYFFFKTMELNCN--PSD-----NEVLIQADTLELRSLQHHTISIGGKYNKNNKTICVFCSTVLLVYPQTCLIILIIEPKIFIKPNS-TMYRVGRPNTYFCDVI-PNTTKSLFSIDMFIGTVPF------SGFFNGTDIGR-VCLTCHNNFLQNATKC--VIPYNGPLKIEVFPKSKIYISNKNSTFQCQMTPNLFTGGNTVAPEF----SFTNATNFIISG-DMVLFVSGSGDICITCIHPWIDPMTNCYESYNKPIVLTINPNYSSIYFKGKNLRVKCELYPEEIIQKNLINNISFECLSPQVKRVSELEFLLTG-QDLGSVCFVCGNPLLGSTRKCYDYYDKIIDVNFHPNYTTVYFPNLKIVFSCDFVPISIYNLIQDLEMIYLN-----DTSLKISKLSVTFNGQNLGRMCFSCGKAAYFTKTECYDYFVVPMTFYITPEGTSVYLSNMLMEVTCNVNPPEVFTQKLVTGIGFIYNNYSISSTIVVSYTVV----GVDMGRLCFRCGHINYTHVDSCYDYFADPVILTIQPNN 887          

HSP 4 Score: 145.206 bits (365), Expect = 2.364e-34
Identity = 201/870 (23.10%), Postives = 350/870 (40.23%), Query Frame = 1
Query:  313 YFSDKDMEVYC----NFDNGRLEINTTEGFRNSNNSMNIGGD---YNDSNETICASCVTSFQRSSLKCYKMIGYAPDLYFDIPTNFYPI---GRNLTIKCELRPKGI-SKYFHNIVVMTQINDSVH-----SGYLNGVDHGEICFVCKHQCPACTILSSIYNCFKPLNILYLTPNKSSEYSTNKTLMLHC--LPDNNARLHINLKNVNFTSDSSVELKNISKTV-----------CAYCSSF-------YFTNPKTCYLVKE---MAISKDDVDDTMKLLDENLMKERITE----LRSNVTGRKIYLFQKTVVNLSI-----------------------IPIYL--------VYLRSTPMKIICLVHPQKFKDTQY--NVTLISLNATALTISRFEMQITGTDRSTICFQCGSSSTNFTIRCYKYYNQNVSVTIGPQKTSVFFRKTPLDVFCQVIPS-----DLINFMEDIFLEGDDPQLIRIDGRSLRIESVIHQKICFYCGNKVIKNATKCYELYTQDVIISIEPSSPPYYYKGQRIQVTCIVKPPDIFQKVQNIEIIWHN---TSFNKDTDLSLTLTGKYVGDIICVLCGNILIYLESMCYEYLDTSNPSIDFIPKYQ-IFLPKVQMTVACILSPKEFYKPQYGFSLSFKNASGMKLSGLEFVMNGLNTDTVCFNCSGTPMKSLVKCYSLYSAAISLSIDPNSKXXXXXXXXXXXXCRVKPDEVVTKNLITDIMLNSNASKVTRVGSLHFNIPNIQSQTQFCFTCGNRVIANISKCYMFMGNVPTFEIYPAATFLFFRNPTTLTCNVTPANSALTKFSFDLFFLNTSYYTNVNQHVKTLSVNIPFDNHQICLTCGVPV-TNITKCY 2664
            Y S+K+    C    N   G   +     F N+ N + I GD   +   +  IC +C+  +      CY+   Y   +   I  N+  I   G+NL +KCEL P+ I  K   N +    ++  V         L G D G +CFVC +  P        Y+ +  +  +   PN ++ Y  N  ++  C  +P +   L  +L+ + + +D+S+++  +S T            C   + F       YF  P T Y+  E   + +S   ++ T  +    +  +++      + +N +     +   TVV + +                        P+ L        VYL+   M + C V P +        ++ L S ++    +S   ++I     +TICF CG+     + +CY Y+++ VS+ I P  T V+F    L V C+++P      +LI  +E ++L      +  ++     I       +CF CG+ +++N TKC+E Y   +   IEP     Y   + + V C V P ++ +K+  I  +  N   TS  K+  +   LT       +C  CG++L    + CY+Y + +  +I  IP +  I+     + V+C ++P             F+N   +  +    ++NG     +CFNC    +    +CY  Y+  ++  I PN   VY   V + + C+V P E+ TK LI   +   + S +    S++  IP               V    + C M   N+ T            +N   ++CN T   + L   SF  F L+T+                      +CL CG  + TN+TKCY
Sbjct:  543 YISNKNSTFQCQMTPNLFTGGNTVAPEFSFTNATNFI-ISGDMVLFVSGSGDICITCIHPWIDPMTNCYE--SYNKPIVLTINPNYSSIYFKGKNLRVKCELYPEEIIQKNLINNISFECLSPQVKRVSELEFLLTGQDLGSVCFVCGN--PLLGSTRKCYDYYDKIIDVNFHPNYTTVYFPNLKIVFSCDFVPISIYNLIQDLEMI-YLNDTSLKISKLSVTFNGQNLGRMCFSCGKAAYFTKTECYDYFVVPMTFYITPEGTSVYLSNMLMEVTCNVNPPEVFTQKLVTGIGFIYNNYSISSTIVVSYTVVGVDMGRLCFRCGHINYTHVDSCYDYFADPVILTIQPNNSKVYLKGINMAVTCTVEPLRIIQNGLIKDIKLKSNSSNVDYVSDLSLEIPTGSITTICFTCGNKFIFTSTKCYLYFDEPVSIIIHPNYTHVYFANLLLRVECEILPMKIFYLNLITGIEMVYLNDTSAPISNLE---YFIIGTDKGTMCFSCGHFLLRNETKCFEFYKTPMSFLIEPLVS-IYLPNKEMSVYCYVLPGELSRKITGIGFVSTNFISTSNEKEIIIYGNLTFT-----LCFKCGHVLYSNVTKCYDYYNHT-ITITIIPDFSSIYFANKNLNVSCQITPPGIINIVTKIKFEFENDLTLPHAPFWILLNGKYKSVICFNCGDHFIYVERRCYDHYNTYLTFYIQPNHTTVYLKNVEMKITCKVFPQEIFTKKLINGTV---SYSLIVSPNSVNTYIP---------------VFKMNASCEMVPSNLNT----------MVQNIKFISCNSTCRMNGLRNISFGPFPLSTA--------------------QTVCLQCGHRILTNVTKCY 1348          

HSP 5 Score: 86.6557 bits (213), Expect = 1.458e-16
Identity = 323/1488 (21.71%), Postives = 548/1488 (36.83%), Query Frame = 1
Query:  757 KPLNILY-------LTPNKSSEYSTNKTLMLHCLPDNNARLHINLKNVN---FTSDSSVELKNI----SKTVCAYCSSFYFTNPKTCYLVKEMAISKDDVDDTMKLLDENLMKERITELRSNVTGRKIYLFQKTVVNLSIIPIYLVYLRSTPMKIICLVHPQKFKDTQYNVTLISLNATALTISRFEMQITGTDRSTICFQCGSSST------NFTIRCYKYYNQNVSVTIGPQKTSVFFRKTPLDVFCQVIPSDLINFMEDIFLEGDDPQLIRIDGRSLRIES---VIHQKICFYCGNKVIKNATKCYELYTQDVIISIE-PSSPPYYYKGQRIQVTCIVKPPDIFQKVQNIEIIWHNTSFNKDTDLSLTLTGKYVGD--IICVLCG-NILIYLESMC--YEYLDTSNPSIDFIPK-YQIFLPKVQMTVACILSPKEFYKPQYGFSLSFKNASGMKLSGLEFVMNGLNTDTVCFNCSGTPMKSLVKCYSLYSAAISLSIDPNSKXXXXXXXXXXXXCRVKPDEVVTKNLITDIMLNSNASKVTRVGSLHFN-IPNIQSQTQFCFTCGNRVIANISKCYMFMGNVPTFEIYPAATFLFFRNPTTLTCNVTP-----ANSALTKFSFDLFFLNTSYYTNVNQHVKTLSVNIPFDNHQICLTCGVP-VTNITKCYILKKQDIVIEIIPKVNYYLVYDDTMDVICQVSP----IKSLPNFPGLGFTKMSLSYYKVITQRHYKICHPKSRCAGKFCFTCADPQLPTVFKCYKPWTGTVNFFMTPRNHILFYMEPHLIVCHVDKPFTKNESIKMDINGLKLNEYTYIPAEMTIKILPLHYLLNR----RVIAVCG------------------TNFPTMKANHIY--NLTGAVNLDYDPNFLIFMGFYQNFRIVTYFTFAKKNYSANCVIISPIPLIRVTGSVIEL------FRYLGSGTYHFRCPF-----PNTTSIYIFSLNVLNISVQSRIEPQGPTLYYIYNSLVECIYVPFFVPFSRIDKRVIGLNPSDYTWRSSGMEIAKKLSLR---GA--KVCITCRFSPMFINTKCY-NLKANISFIYHPVMXXXXXXXXXXXXXXXFKHRLLAE-TFQSTCR-MKSGSHQLNILGG------NITLA---------IPLWSGTYLVEC---YPPNSTEMTELQLKVFSDPINLIIYPPAGTVVIMDTVRIYCEVQPS----LNLGMIILSTMQSFLHGNDSSEKIIPNSVLFRDRCLCFSCNCAKMSSVRQCYNFTTPLILRT--KPKQDLYFAWNRVTIETY--------FINKNK---------PGRKYLAMCSLPYENFSVSNLGE----------IHISPMLVNLVYDFHCTIP----------TVVDYQILTLFVYSNKVELEII--PNNTDIYIFSMVMEVECIVKPDDLNVVFPVIKFLSINSTQYVYKAFRLILIGGVDYDVKDIICVVCGHDYLPFNVSRCFSP 4779
            KPLN+ +       + P+  + Y  +  +++ CL + N +  + L N       + SS+ +  I    S  +CA C    F++P  CY ++                       ++  +  NV G   YL Q+T +         VY    P        P   K  +       +N +    ++    I     S ICF+C    T      N T +CY+  N ++   + P+  SV++    + + C   P D+     DI L  +  +++RI  +SL I S   + ++ IC YC +K++     CY +     + S+  P++   Y   +R  V C + P +  +  +NI +  +NT+F           G   G+  I+C  C     I  E +   YE     +P  + IP+  + +     M + C  S  E         L       + + G        N  T+C  CS   +     C  +      + I PNS  +Y        +C V P+   TK+L +  M          +G++ F+   N     + C TC N  + N +KC +        E++P +        +T  C +TP      N+   +FSF     N + +      V  +S      +  IC+TC  P +  +T CY    + IV+ I P  +        + V C++ P     K+L N   + F  +S    K +++  + +     +  G  CF C +P L +  KCY  +   ++    P N+   Y     IV   D       ++  D+  + LN+        ++KI  L    N     R+   CG                  T + T +   +Y  N+   V  + +P  +    F Q  ++VT   F   NYS +  I+    ++ V    +        + ++ S   +F  P      PN + +Y   L  +N++V   +EP    L  I N L++ I +                        SS ++    LSL    G+   +C TC    +F +TKCY      +S I HP                 + H   A    +  C  +      LN++ G      N T A         I    GT    C      N T+  E     +  P++ +I P     +    + +YC V P        G+  +ST  +F+  ++  E II  ++ F    LCF C     S+V +CY++    I  T       +YFA   + +            + K K         P   +  + +  Y++    N G+           H +  L   +   H T+            V   +I T  + +  V   +I  PN+ + YI    M   C + P +LN +   IKF+S NST  +    R I  G         +C+ CGH  L  NV++C+ P
Sbjct:   32 KPLNMFFFYSKPYHVFPDDINFYFADFEMLISCLNEINGQFSVLLLNTTESYIINKSSILIGGIYNYKSTIICATCLESAFSSPLHCYTIRG----------------------KLHNISFNVPGI-YYLPQRTTI---------VYCEVKP--------PINIKSKEI------VNISLANGTQHNGVINPGFNSVICFKCFPICTLCDFLKNIT-KCYQPQNFHI---LQPKDESVYYFTIEMTLQCD--PPDV-----DIMLVINTTEIMRISKQSLIIGSRYNLSNRTICAYCASKIVIYPKVCYHMIGYKPVFSLNIPAN--MYPPRRRTSVFCNMFPKEAEKYYKNILLTMNNTAFG----------GILYGNETIVCFQCQLKRFISTEKILDHYEKCLIPHPVYNLIPENTKAYFFFKTMELNCNPSDNEVLIQADTLELRSLQHHTISIGG----KYNKNNKTICVFCSTVLLVYPQTCLIILIIEPKIFIKPNS-TMYRVGRPNTYFCDVIPN--TTKSLFSIDMF---------IGTVPFSGFFNGTDIGRVCLTCHNNFLQNATKCVIPYNGPLKIEVFPKSKIYISNKNSTFQCQMTPNLFTGGNTVAPEFSFT----NATNFIISGDMVLFVS-----GSGDICITCIHPWIDPMTNCYESYNKPIVLTINPNYSSIYFKGKNLRVKCELYPEEIIQKNLIN--NISFECLS-PQVKRVSELEFLL---TGQDLGSVCFVCGNPLLGSTRKCYDYYDKIIDVNFHP-NYTTVYFPNLKIVFSCDFVPISIYNLIQDLEMIYLND-------TSLKISKLSVTFNGQNLGRMCFSCGKAAYFTKTECYDYFVVPMTFYITPEGTSVYLSNMLMEVTCNVNPPEV----FTQ--KLVTGIGFIYNNYSISSTIVVSYTVVGVDMGRLCFRCGHINYTHVDSCYDYFADPVILTIQPNNSKVY---LKGINMAVTCTVEP----LRIIQNGLIKDIKL---------------------KSNSSNVDYVSDLSLEIPTGSITTICFTCGNKFIFTSTKCYLYFDEPVSIIIHP----------------NYTHVYFANLLLRVECEILPMKIFYLNLITGIEMVYLNDTSAPISNLEYFIIGTDKGTMCFSCGHFLLRNETKCFEF----YKTPMSFLIEPLVSIYLPNKEMSVYCYVLPGELSRKITGIGFVST--NFISTSNEKEIIIYGNLTFT---LCFKCGHVLYSNVTKCYDYYNHTITITIIPDFSSIYFANKNLNVSCQITPPGIINIVTKIKFEFENDLTLPHAPFWILLNGKYKSVICFNCGDHFIYVERRCYDHYNTYLTFYIQPNHTTVYLKNVEMKITCKVFPQEIFTKKLINGTVSYSLIVSPNSVNTYIPVFKMNASCEMVPSNLNTMVQNIKFISCNSTCRM-NGLRNISFGPFPLSTAQTVCLQCGHRILT-NVTKCYDP 1350          

HSP 6 Score: 78.5666 bits (192), Expect = 3.994e-14
Identity = 125/577 (21.66%), Postives = 216/577 (37.44%), Query Frame = 1
Query:  280 LLMVLPDGLDGYFSDKDMEVYCNFDNGRLEINT-TEGFRNSNNSMNIGGDY---------NDSNETICASCVTSFQRSSLKCYKMIGYAPDLYFDIP---------TNFYPIGRNLTIKCELRPKGISKYFHNIVV---MTQINDSVH-----SGYLNGVDHGEICFVCKHQCPACTILSSIYNCFK----PLNILYLTPNKSSEYSTNKTLMLHC--LPDNNAR--LHINLKNVNFTSDSS----VELKNISKTVCAYCSSFYFTNPKTCYLVKEMAISKDDVDDTMKLLDENLMKERITELRSNVTGRKIYLFQKTVVNLSIIPIY-LVYLRSTPMKIICLVHPQKFKDTQYNVTLISLNATALTISRFEMQITGTDRSTICFQCGSSSTNFTIRCYKYYNQNVSVTIGPQKTSVFFRKTPLDVFCQVIPSDLINFMEDIFLEGDDPQLIRIDGRSLRIESVIHQKICFYCGNKVIKNATKCYELYTQDVIISIEPSSPPYYYKGQRIQVTCIVKPPDIFQKVQNIEIIWHNTS--FNKDTDLSLTLTGKYVGDIICVLCGNILIYLESMCYEYL 1884
            +L + P+    Y    +M V C  +  R+  N   +  +  +NS N+  DY           S  TIC +C   F  +S KCY        LYFD P         T+ Y     L ++CE+ P  I  ++ N++    M  +ND+         ++ G D G +CF C H      +L +   CF+    P++  +L     S Y  NK + ++C  LP   +R    I   + NF S S+    +   N++ T+C  C    ++N   CY         D  + T                                + ++IIP +  +Y  +  + + C + P    +    +     N   L  + F + + G  +S ICF CG        RCY +YN  ++  I P  T+V+ +   + + C+V P ++                                        K + N T  Y L        + P+S   Y    ++  +C + P ++   VQNI+ I  N++   N   ++S           +C+ CG+ ++   + CY+ L
Sbjct:  880 ILTIQPNNSKVYLKGINMAVTCTVEPLRIIQNGLIKDIKLKSNSSNV--DYVSDLSLEIPTGSITTICFTCGNKFIFTSTKCY--------LYFDEPVSIIIHPNYTHVYFANLLLRVECEILPMKI--FYLNLITGIEMVYLNDTSAPISNLEYFIIGTDKGTMCFSCGH-----FLLRNETKCFEFYKTPMS--FLIEPLVSIYLPNKEMSVYCYVLPGELSRKITGIGFVSTNFISTSNEKEIIIYGNLTFTLCFKCGHVLYSNVTKCY---------DYYNHT--------------------------------ITITIIPDFSSIYFANKNLNVSCQITPPGIINIVTKIKFEFENDLTLPHAPFWILLNGKYKSVICFNCGDHFIYVERRCYDHYNTYLTFYIQPNHTTVYLKNVEMKITCKVFPQEIF--------------------------------------TKKLINGTVSYSLI-------VSPNSVNTYIPVFKMNASCEMVPSNLNTMVQNIKFISCNSTCRMNGLRNISFGPFPLSTAQTVCLQCGHRILTNVTKCYDPL 1351          

HSP 7 Score: 63.1586 bits (152), Expect = 1.956e-9
Identity = 85/359 (23.68%), Postives = 158/359 (44.01%), Query Frame = 1
Query: 3823 RLLAETFQSTCRMKSGSHQLNILGGNITLAIPLWSGTYLVECYP-PNSTEMTELQLKV-FSDPINLIIYPPAGTVVIMDTV-RIYCEVQPSLNLGMIILSTMQSFLHGNDSSEKI--IPNSVLFRDR-CLCFSCNCAKMSSVRQCYNF-TTPLILRTKPKQDLYFAWNRVTIETYFINKNKPGRKYLAMCSLPYENFSVSNLGEIHISPMLVNLVYDFHCTIPTVVDYQILTLFVYSNK-VELEIIPNNTDIYIFSMVMEVECIVKPDDLNVVFPVIKFLSINSTQYVYKAFRLILIGGVDYDVKDIICVVCGHDYLPFNVSRCFSPYMGDINVTILPLEWEIYYL-MPHTITCKIVPQ 4872
            R++        ++KS S  ++ +  +++L IP  +G+    C+   N    T  +  + F +P+++II+P    V   + + R+ CE+ P + +  + L T    ++ ND+S  I  +   ++  D+  +CFSC    + +  +C+ F  TP+    +P   +Y     +++  Y +   +  RK   +  +     S SN  EI I     NL +        V+   +   + Y N  + + IIP+ + IY  +  + V C + P  +  +   IKF   N     +  F ++L G      K +IC  CG D+  +   RC+  Y   +   I P    +Y   +   ITCK+ PQ
Sbjct:  907 RIIQNGLIKDIKLKSNSSNVDYVS-DLSLEIP--TGSITTICFTCGNKFIFTSTKCYLYFDEPVSIIIHPNYTHVYFANLLLRVECEILP-MKIFYLNLITGIEMVYLNDTSAPISNLEYFIIGTDKGTMCFSCGHFLLRNETKCFEFYKTPMSFLIEPLVSIYLPNKEMSVYCYVL-PGELSRKITGIGFVSTNFISTSNEKEIIIYG---NLTFTLCFKCGHVLYSNVTKCYDYYNHTITITIIPDFSSIYFANKNLNVSCQITPPGIINIVTKIKFEFENDLTLPHAPFWILLNG----KYKSVICFNCG-DHFIYVERRCYDHYNTYLTFYIQPNHTTVYLKNVEMKITCKVFPQ 1252          
BLAST of SMED30016814 vs. Planmine SMEST
Match: SMESG000004618.1 (SMESG000004618.1)

HSP 1 Score: 273.478 bits (698), Expect = 7.119e-74
Identity = 260/1002 (25.95%), Postives = 422/1002 (42.12%), Query Frame = 1
Query:  364 LEINTTEGFRNSNNSMNIGGDYNDSNETICASCVTSFQRSSLKCYKMIGYAPDLYFDIPTNFYPIGRNLTIKCELRPKGISKYFHNIVVMTQINDSVHSGYLNGVDHGEICFVCKHQCPACT--ILSSIYNCFKPLNILYLTPNKSSEYSTNKTLMLHCLPDNNARL----HINLKNVNFTSDS-SVELKNISKTVCAYCSSFYFTNPKTCY--LVKEMAISK-----------------DDVDDTMKLLDENLMKERITELRSNVTGRKI----------YLFQKTV--------VNLSIIPIYLVYLRSTPMKIICLVHPQKFKDTQYNVTLISL-NATALTISRFEMQITGTDRSTICFQCGSSSTNFTIRCYKYYNQNVSVTIGPQKTSVFFRKTPLDVFCQVIPSDLI--NFMEDIFLEGDDPQLIRIDGRSLRIESVIHQKICFYCGNKVIKNATKCYELYTQDVIISIEPSSPPYYYKGQRIQVTCIVKPPDIFQKVQNIEIIWHNTSFNKDTDLSLTLTGKYVGDIICVLCGNILIYLESMCYEYLDTSNPSIDFIPKYQIFLPKVQMTVACILSPKEFYKPQY--GFSLSFKNASGMKLSGLEFVMNGLNTDTVCFNCSGTPMKSLVKCYSLYSAAISLSIDPNSKXXXXXXXXXXXXCRVKPDEVVTKNLITDIMLNSNASKVTRVGSLHFNIPNIQSQTQFCFTCGNRVIANISKCYMFMGNVPTFEIYPAATFLFFRN-PTTLTCNVTPANSALTKFSFDLFFLN------TSYYTNVNQHVKTLS-VNIPFDNHQICLTCG-VPVTNITKCYILKKQDIVIEIIPKVNYYLVYDDTMDVICQVSPIKSLPNFPGLGFTKMSLSYYKVITQRHYKICHPKSRCAGKFCFTCADPQLPTVFKCYKPWTGTVNFFMTPRNHILFYMEPHL-IVCHVDKPFTKNESIKMDINGLKLNEYTYIPAEMTIKILPLHYLLNRRVIAV----CGTNF 3180
            L INTTE  R S  S+ IG  YN SN TICA C +        CY MIGY P    +IP N YP  R  ++ C + PK   KY+ NI++   +N++   G L G +   +CF C+ +    T  IL     C  P  +  L P  +  Y   KT+ L+C P +N  L     + L+++   + S   +    +KT+C +CS+     P+TC   L+ E  I                   D + +T K L    M            G  I          +L   T         + + + P   +Y+ +      C + P  F          S  NAT   IS  +M +  +    IC  C     +    CY+ YN+ + +TI P  +S++F+   L V C++ P ++I  N + +I  E   PQ+ R+      +       +CF CGN ++ +  KCY+ Y + + ++  P+    Y+   +I  +C   P  I+  +Q++E+I+ N +  K + LS+T  G+ +G  +C  CG    + ++ CY+Y               ++L  + M V C ++P E +  +   G    + N S      + + + G++   +CF C       +  CY  ++  + L+I PN+  VY   + + V C V+P  ++   LI DI L SN+S V  V  L   IP   S T  CFTCGN+ I   +KCY++     +  I+P  T ++F N    + C + P           +F+LN        Y  + +  +  L    I  D   +C +CG   + N TKC+   K  +   I P V+ YL  +  M V C V P +      G+GF   +      I+  + K            CF C       V KCY  +  T+   + P    +++   +L + C +  P   N   K+               ++T+   P   LLN +  +V    CG +F
Sbjct:  407 LVINTTEIMRISKQSLIIGSRYNLSNRTICAYCASKIVIYPKVCYHMIGYKPVFSLNIPANMYPPRRRTSVFCNMFPKEAEKYYKNILL--TMNNTAFGGILYG-NETIVCFQCQLKRFISTEKILDHYEKCLIPHPVYNLIPENTKAYFFFKTMELNCNPSDNEVLIQADTLELRSLQHHTISIGGKYNKNNKTICVFCSTVLLVYPQTCLIILIIEPKIFIKPNSTMYRVGRPNTYFCDVIPNTTKSLFSIDMFIGTVPFSGFFNGTDIGRVCLTCHNNFLQNATKCVIPYNGPLKIEVFPKSKIYISNKNSTFQCQMTPNLFTGGNTVAPEFSFTNATNFIISG-DMVLFVSGSGDICITCIHPWIDPMTNCYESYNKPIVLTINPNYSSIYFKGKNLRVKCELYPEEIIQKNLINNISFECLSPQVKRVSELEFLLTGQDLGSVCFVCGNPLLGSTRKCYDYYDKIIDVNFHPNYTTVYFPNLKIVFSCDFVPISIYNLIQDLEMIYLNDTSLKISKLSVTFNGQNLGR-MCFSCGKAAYFTKTECYDYFVVPMTFYITPEGTSVYLSNMLMEVTCNVNPPEVFTQKLVTGIGFIYNNYSISSTIVVSYTVVGVDMGRLCFRCGHINYTHVDSCYDYFADPVILTIQPNNSKVYLKGINMAVTCTVEPLRIIQNGLIKDIKLKSNSSNVDYVSDLSLEIPT-GSITTICFTCGNKFIFTSTKCYLYFDEPVSIIIHPNYTHVYFANLLLRVECEILP---------MKIFYLNLITGIEMVYLNDTSAPISNLEYFIIGTDKGTMCFSCGHFLLRNETKCFEFYKTPMSFLIEPLVSIYLP-NKEMSVYCYVLPGELSRKITGIGFVSTNF-----ISTSNEKEIIIYGNLTFTLCFKCGHVLYSNVTKCYDYYNHTITITIIPDFSSIYFANKNLNVSCQITPPGIINIVTKIKFE---------FENDLTLPHAPFWILLNGKYKSVICFNCGDHF 1378          

HSP 2 Score: 233.802 bits (595), Expect = 1.722e-61
Identity = 224/921 (24.32%), Postives = 396/921 (43.00%), Query Frame = 1
Query:  289 VLPDGLDGYFSDKDMEVYCNFDNGR--LEINTTEGFRNSNNSMNIGGDYNDSNETICASCVTSFQRSSLKCYKMIGYAPDLYFDIPTNFYPIGRNLTIKCELRPKGISKYFHNIVVMTQINDSVHSGYLNGVDHGEICFVCKHQCPACTILSSIYNCFKPLNILYLTPNKSSEYSTNKTLMLHCLPDNNARLHINLKNVNFTSDSSVELKNISKTVCAYCSSFYFTNPKTCYLVKEMAISKDDVDDTMKLLDENLMKERITELRSNVTGRKIYLFQKTVVNLSIIPIYL-VYLRSTPMKIICLVHPQKF--KDTQYNVTLISLNATALTISRFEMQITGTDRSTICFQCGSSSTNFTIRCYKYYNQNVSVTIGPQKTSVFFRKTPLDVFCQVIPSDLINFMEDIFLEGDDPQLIRIDGRSLRIESVIHQKICFYCGNKVIKNATKCYELYTQDVIISIEPSSPPYYYKGQRIQVTCIVKPPDIFQK--VQNIEIIWHNTSFNKDTDLSLTLTGKYVGDIICVLCGNILIYLESMCYEYLDTSNPSIDFIP--KYQIFLPKVQMTVACILSPKEFYKPQYGFSLSFK-NASGMK-LSGLEFVMNGLNTDTVCFNCSGTPMKSLVKCYSLYSAAISLSIDPNSKXXXXXXXXXXXXCRVKPDEVVTKNLITDIMLNSNASKVTRVGSLHFNIPNIQSQTQFCFTCGNRVIANISKCYMFMGNVPTFEIYPAATFLFFRNPTTLTCNVTPANSALTKFSFDLFFLNTSYYTNVNQHVKTLSVNIPFDNHQICLTCG-VPVTNITKCYILKKQDIVIEIIPKVNYYLVYDDTMDVICQVSPIKSLPNFPGLG--FTKMSLSYYKVITQRH---YKICHPKSRCAGKFCFTCADPQLPTVFKCYKPWTGTVNFFMTPRNHILFYME 3000
            ++P+    YF  K ME+ CN  +    ++ +T E     +++++IGG YN +N+TIC  C T        C  ++   P ++    +  Y +GR  T  C++ P      F    +   I     SG+ NG D G +C  C +       L +   C  P N                 L +   P   ++++I+ KN  F    +  L     TV      F FTN     +  +M +      D         +        S         + K +V L+I P Y  +Y +   +++ C ++P++   K+   N++   L+     +S  E  +TG D  ++CF CG+     T +CY YY++ + V   P  T+V+F    +   C  +P  + N ++D+ +   +   ++I   S+        ++CF CG       T+CY+ +   +   I P     Y     ++VTC V PP++F +  V  I  I++N S +    +S T+ G  +G + C  CG+I       CY+Y   ++P I  I     +++L  + M V C + P    +      +  K N+S +  +S L   +   +  T+CF C    + +  KCY  +   +S+ I PN  +VY   +LL V C + P ++   NLIT I +         + +L + I      T  CF+CG+ ++ N +KC+ F     +F I P  +        ++ C V P    L++    + F++T++ +  N+    +  N+ F    +C  CG V  +N+TKCY      I I IIP  +     +  ++V CQ++P       PG+    TK+   +   +T  H   + + + K +     CF C D  +    +CY  +   + F++ P NH   Y++
Sbjct:  544 LIPENTKAYFFFKTMELNCNPSDNEVLIQADTLELRSLQHHTISIGGKYNKNNKTICVFCSTVLLVYPQTCLIILIIEPKIFIKPNSTMYRVGRPNTYFCDVIPNTTKSLFS---IDMFIGTVPFSGFFNGTDIGRVCLTCHNN-----FLQNATKCVIPYN---------------GPLKIEVFPK--SKIYISNKNSTFQCQMTPNLFTGGNTVAP---EFSFTNATNFIISGDMVLFVSGSGDICITCIHPWIDPMTNCYES---------YNKPIV-LTINPNYSSIYFKGKNLRVKCELYPEEIIQKNLINNISFECLSPQVKRVSELEFLLTGQDLGSVCFVCGNPLLGSTRKCYDYYDKIIDVNFHPNYTTVYFPNLKIVFSCDFVPISIYNLIQDLEMIYLNDTSLKISKLSVTFNGQNLGRMCFSCGKAAYFTKTECYDYFVVPMTFYITPEGTSVYLSNMLMEVTCNVNPPEVFTQKLVTGIGFIYNNYSISSTIVVSYTVVGVDMGRL-CFRCGHINYTHVDSCYDYF--ADPVILTIQPNNSKVYLKGINMAVTCTVEPLRIIQNGLIKDIKLKSNSSNVDYVSDLSLEIPTGSITTICFTCGNKFIFTSTKCYLYFDEPVSIIIHPNYTHVYFANLLLRVECEILPMKIFYLNLITGIEMVYLNDTSAPISNLEYFIIGTDKGTM-CFSCGHFLLRNETKCFEFYKTPMSFLIEPLVSIYLPNKEMSVYCYVLPG--ELSRKITGIGFVSTNFISTSNEKEIIIYGNLTF---TLCFKCGHVLYSNVTKCYDYYNHTITITIIPDFSSIYFANKNLNVSCQITP-------PGIINIVTKIKFEFENDLTLPHAPFWILLNGKYKSV--ICFNCGDHFIYVERRCYDHYNTYLTFYIQP-NHTTVYLK 1407          

HSP 3 Score: 193.741 bits (491), Expect = 3.212e-49
Identity = 226/924 (24.46%), Postives = 387/924 (41.88%), Query Frame = 1
Query:  289 VLPDGLDGYFSDKDMEVYC-NFDNGR---LEINTTEGFRNSNNSMNIGGDYNDSNETICASCVTSFQRSSLKCYKMIGYAPDLYFDIPTNFYPIGRNLTIKCELRPKGISKYFHNIVVMTQINDSVHSGYLNGVDHGEICFVCKHQCPACTILSSIYNCFKPLNILYLTPNKSSEYSTNKTLMLHC-LPDNNARLHINLKNVNFTSDSSVELK---NIS-KTVCAYCSSFYFTNPKTCYLVKEMAISKDDVDDTMKLLDENLMKERITELRSNVTGRKIYLFQKTVVNLSIIPIYLVYLRSTPMKIICLVHPQKFKDTQYNVTLISLNATALTISRFEMQITGTDRSTICFQCGSSSTNFTIRCYKYYNQ----NVSVTIGPQKTSVFFRKTPLDVFCQVIPSDLINFMEDIFLEGDDPQLIRIDGRSLRIESVIHQK---ICFYCGNKVIKNATKCYELYTQDVIISIEPSSPPYYYKGQRIQVTCIVKPPDIFQKVQNIEIIWHNTSFNKDTDLSLTLTGKYVGDIICVLCGNILIYLESMCYEYLDTSNP-SIDFIPKYQIFLPKVQMTVACILSPKEF-----YKPQYGFSLSFKNASGMKLSGLEFVMNGLNTDTVCFNCSGTPMKSLVKCYSLYSAAISLSIDPNSKXXXXXXXXXXXXCRVKPDEVVTKNLITDIMLNSNASKVTRVGSLHFNIPNIQSQTQFCFTCGNRVIANISKCYMFMGNVPTFEIYPAATFLFFRN-PTTLTCNVTPANSALTKFSFDLFFLNTSYYTNVNQHVKTLSVNIPFDN-HQICLTCG-VPVTNITKCYILKKQDIVIEIIPKVNYYLVYDDTMDVICQVSPIKSLPN--FPGLGFTKMSLSYYKVITQRHYKICHPKSRCAGKFCFTCADPQLPTVFKCYKPWTGTVNFFMTPRN 2979
            V PD ++ YF+D +M + C N  NG+   L +NTTE +  + +S+ IGG YN  +  ICA+C+ S   S L CY + G   ++ F++P  +Y   R   + CE++P  I+     IV ++  N + H+G +N   +  ICF C   C  C  L +I  C++P N   L P   S Y     + L C  PD +  L IN   +   S  S+ +    N+S +T+CAYC+S     PK CY +                                       +  K V +L+I        R T   + C + P++  +  Y   L+++N TA         I   + + +CFQC       T +   +Y +    +    + P+ T  +F    +++ C   PSD      ++ ++ D  +L  +   ++ I    ++    IC +C   ++     C  +   +  I I+P+S   Y  G+     C V  P+  + + +I++      F      S    G  +G  +C+ C N  +   + C   +  + P  I+  PK +I++     T  C ++P  F       P++    SF NA+   +SG + V+    +  +C  C    +  +  CY  Y+  I L+I+PN   +Y     L V C + P+E++ KNLI +I     + +V RV  L F +   Q     CF CGN ++ +  KCY +   +     +P  T ++F N     +C+  P +        ++ +LN     + +  +  LSV     N  ++C +CG       T+CY      +   I P+     + +  M+V C V+P +        G+GF   + S    I   +  +        G+ CF C       V  CY  +   V   + P N
Sbjct:  214 VFPDDINFYFADFEMLISCLNEINGQFSVLLLNTTESYIINKSSILIGGIYNYKSTIICATCLESAFSSPLHCYTIRGKLHNISFNVPGIYYLPQRTTIVYCEVKPP-INIKSKEIVNISLANGTQHNGVINPGFNSVICFKCFPICTLCDFLKNITKCYQPQNFHILQPKDESVYYFTIEMTLQCDPPDVDIMLVINTTEIMRISKQSLIIGSRYNLSNRTICAYCASKIVIYPKVCYHM---------------------------------------IGYKPVFSLNIPANMYPPRRRT--SVFCNMFPKE-AEKYYKNILLTMNNTAFG------GILYGNETIVCFQCQLKRFISTEKILDHYEKCLIPHPVYNLIPENTKAYFFFKTMELNCN--PSD-----NEVLIQADTLELRSLQHHTISIGGKYNKNNKTICVFCSTVLLVYPQTCLIILIIEPKIFIKPNS-TMYRVGRPNTYFCDVI-PNTTKSLFSIDMFIGTVPF------SGFFNGTDIGR-VCLTCHNNFLQNATKC--VIPYNGPLKIEVFPKSKIYISNKNSTFQCQMTPNLFTGGNTVAPEF----SFTNATNFIISG-DMVLFVSGSGDICITCIHPWIDPMTNCYESYNKPIVLTINPNYSSIYFKGKNLRVKCELYPEEIIQKNLINNISFECLSPQVKRVSELEFLLTG-QDLGSVCFVCGNPLLGSTRKCYDYYDKIIDVNFHPNYTTVYFPNLKIVFSCDFVPISIYNLIQDLEMIYLN-----DTSLKISKLSVTFNGQNLGRMCFSCGKAAYFTKTECYDYFVVPMTFYITPEGTSVYLSNMLMEVTCNVNPPEVFTQKLVTGIGFIYNNYSISSTIVVSYTVV----GVDMGRLCFRCGHINYTHVDSCYDYFADPVILTIQPNN 1055          

HSP 4 Score: 179.104 bits (453), Expect = 1.014e-44
Identity = 207/815 (25.40%), Postives = 344/815 (42.21%), Query Frame = 1
Query:  313 YFSDKDMEVYC----NFDNGRLEINTTEGFRNSNNSMNIGGD---YNDSNETICASCVTSFQRSSLKCYKMIGYAPDLYFDIPTNFYPI---GRNLTIKCELRPKGI-SKYFHNIVVMTQINDSVH-----SGYLNGVDHGEICFVCKHQCPACTILSSIYNCFKPLNILYLTPNKSSEYSTNKTLMLHC--LPDNNARLHINLKNVNFTSDSSVELKNISKTVCAY-CSSFYFTNPKTCYLVKEMAISKDDVDDTMKLLDENLMKERITELRSNVTGRKIYLFQKTVVNLSIIPIYLVYLRSTPMKIICLVHPQKFKDTQYNVTLISLNATALTISR---FEMQITGTDRSTICFQCGSSSTNFTIRCYKYYNQNVSVTIGPQKTSVFFRKTPLDVFCQVIPSDLI--NFMEDIFLEGDDPQLIRIDGRSLRIESVIHQKICFYCGNKVIKNATKCYELYTQDVIISIEPSSPPYYYKGQRIQVTCIVKPPDIF--QKVQNIEIIWHNTSFNKDTDLSLTLTGKYVGDIICVLCGNILIYLESMCYEYLDTSNPSIDFIPKYQIFLPKVQMTVACILSPKEFYKPQYGF---SLSFKNASGMKLSGLEFVMNGLNTDTVCFNCSGTPMKSLVKCYSLYSAAISLSIDPNSKXXXXXXXXXXXXCRVKPDEVVTKNLITDIMLNSNASKVTRVGSLHFNIPNIQSQTQFCFTCGNRVIANISKCYMFMGNVPTFEIYPAATFLFFRN-PTTLTCNVTPANSALTKFSFDLFFLNTSYYTNVNQHVKTLSVNIPFDNHQICLTCGVPV-TNITKCY 2664
            Y S+K+    C    N   G   +     F N+ N + I GD   +   +  IC +C+  +      CY+   Y   +   I  N+  I   G+NL +KCEL P+ I  K   N +    ++  V         L G D G +CFVC +  P        Y+ +  +  +   PN ++ Y  N  ++  C  +P +   L  +L+ + + +D+S+++  +S T          F+  K  Y  K        V  T  +  E                                    VYL +  M++ C V+P +   TQ  VT I       +IS        + G D   +CF+CG  +      CY Y+   V +TI P  + V+ +   + V C V P  +I    ++DI L+ +   +  +   SL I +     ICF CGNK I  +TKCY  + + V I I P+    Y+    ++V C + P  IF    +  IE+++ N +    ++L   + G   G + C  CG+ L+  E+ C+E+  T   S    P   I+LP  +M+V C + P E  +   G    S +F + S  K    E ++ G  T T+CF C      ++ KCY  Y+  I+++I P+   +Y     L+V C++ P  ++  N++T I      + +T   +  + + N + ++  CF CG+  I    +CY       TF I P  T ++ +N    +TC V P      K      F+  +Y  ++N    T+  N     H++C  CG     N++KCY
Sbjct:  711 YISNKNSTFQCQMTPNLFTGGNTVAPEFSFTNATNFI-ISGDMVLFVSGSGDICITCIHPWIDPMTNCYE--SYNKPIVLTINPNYSSIYFKGKNLRVKCELYPEEIIQKNLINNISFECLSPQVKRVSELEFLLTGQDLGSVCFVCGN--PLLGSTRKCYDYYDKIIDVNFHPNYTTVYFPNLKIVFSCDFVPISIYNLIQDLEMI-YLNDTSLKISKLSVTFNGQNLGRMCFSCGKAAYFTKTECYDYFVVPMTFYITPEGTS---------------------------------VYLSNMLMEVTCNVNPPEVF-TQKLVTGIGFIYNNYSISSTIVVSYTVVGVDMGRLCFRCGHINYTHVDSCYDYFADPVILTIQPNNSKVYLKGINMAVTCTVEPLRIIQNGLIKDIKLKSNSSNVDYVSDLSLEIPTGSITTICFTCGNKFIFTSTKCYLYFDEPVSIIIHPNYTHVYFANLLLRVECEILPMKIFYLNLITGIEMVYLNDTSAPISNLEYFIIGTDKGTM-CFSCGHFLLRNETKCFEFYKTPM-SFLIEPLVSIYLPNKEMSVYCYVLPGELSRKITGIGFVSTNFISTSNEK----EIIIYGNLTFTLCFKCGHVLYSNVTKCYDYYNHTITITIIPDFSSIYFANKNLNVSCQITPPGII--NIVTKIKFEF-ENDLTLPHAPFWILLNGKYKSVICFNCGDHFIYVERRCYDHYNTYLTFYIQPNHTTVYLKNVEMKITCKVFPQEIFTKKLINGTGFIYNNYNPSLNGTQITIFGN---TTHKLCFQCGHTFYENVSKCY 1473          

HSP 5 Score: 158.303 bits (399), Expect = 2.377e-38
Identity = 154/608 (25.33%), Postives = 252/608 (41.45%), Query Frame = 1
Query:  448 ICASCVTSFQRSSLKCYKMIGYAPDLYFDIPTNFY--PIGRN-------LTIKCELRP---------KGISKYFHNIVVMTQINDSVHSGYLNGVDHGEICFVCKHQCPACTILSSIYNCFKPLNILYLTPNKSSEYSTNKTLMLHCLPD----------NNARLHINLKNVNFTSDSSVELKNIS-KTVCAYCSSFYFTNPKTCYLVKEMAISKDDVDDTMKLLDENLMKERITELRSNVTGRKIYLFQKTVVNLSIIPIYL-VYLRSTPMKIICLVHPQK--FKDTQYNVTLISLNATALTISRFEMQITGTDRSTICFQCGSSSTNFTIRCYKYYNQNVSVTIGPQKTSVFFRKTPLDVFCQVIPSDL------INFMEDIFLEGDDPQLIRIDGRSLRIESVIHQKICFYCGNKVIKNATKCYELYTQDVIISIEPSSPPYYYKGQRIQVTCIVKPPDIFQKVQNIEIIWHNTSFNKDTDLSLTLTGKYVGDIICVLCGNILIYLESMCYEYLDTSNPSIDFIPKYQIFLPKVQMTVACILSPKEFYKPQY----GFSLSFKNASGMKLSGLEFVMNGLNTDTVCFNCSGTPMKSLVKCYSLYS 2145
            +C SC  +   +  +CY         YF +P  FY  P G +       + + C + P          GI   ++N  + + I   V S  + GVD G +CF C H     T + S Y+ F    IL + PN S  Y     + + C  +           + +L  N  NV++ SD S+E+   S  T+C  C + +                                           T  K YL+    V++ I P Y  VY  +  +++ C + P K  + +    + ++ LN T+  IS  E  I GTD+ T+CF CG        +C+++Y   +S  I P   S++     + V+C V+P +L      I F+   F+   + + I I G        +   +CF CG+ +  N TKCY+ Y   + I+I P     Y+  + + V+C + PP I   V  I+  + N          + L GKY   +IC  CG+  IY+E  CY++ +T            ++L  V+M + C + P+E +  +     GF  +  N S   L+G +  + G  T  +CF C  T  +++ KCY  Y 
Sbjct:  936 MCFSCGKAAYFTKTECYD--------YFVVPMTFYITPEGTSVYLSNMLMEVTCNVNPPEVFTQKLVTGIGFIYNNYSISSTI---VVSYTVVGVDMGRLCFRCGHI--NYTHVDSCYDYFADPVILTIQPNNSKVYLKGINMAVTCTVEPLRIIQNGLIKDIKLKSNSSNVDYVSDLSLEIPTGSITTICFTCGNKFI-----------------------------------------FTSTKCYLYFDEPVSIIIHPNYTHVYFANLLLRVECEILPMKIFYLNLITGIEMVYLNDTSAPISNLEYFIIGTDKGTMCFSCGHFLLRNETKCFEFYKTPMSFLIEPL-VSIYLPNKEMSVYCYVLPGELSRKITGIGFVSTNFISTSNEKEIIIYGN-------LTFTLCFKCGHVLYSNVTKCYDYYNHTITITIIPDFSSIYFANKNLNVSCQITPPGIINIVTKIKFEFENDLTLPHAPFWILLNGKY-KSVICFNCGDHFIYVERRCYDHYNTYLTFYIQPNHTTVYLKNVEMKITCKVFPQEIFTKKLINGTGFIYNNYNPS---LNGTQITIFGNTTHKLCFQCGHTFYENVSKCYDYYE 1477          

HSP 6 Score: 125.561 bits (314), Expect = 2.451e-28
Identity = 361/1626 (22.20%), Postives = 623/1626 (38.31%), Query Frame = 1
Query:  283 LMVLPDGLDGYFSDKDMEVYCNFDNGRLEINTTEGFRNSNNSMNIGGDYNDSNETICASCVTSFQRSSLKCYKMIGYAPDLYFD---IPTNFYPI--GRNLTIKCELRPKGISKYFHNIVVMTQINDSVHSGYLNGVDHGEICFVCKHQCPACTILSSIYNCFKPLNILY-------LTPNKSSEYSTNKTLMLHCLPDNNARLHINLKNVN---FTSDSSVELKNI----SKTVCAYCSSFYFTNPKTCYLVKEMAISKDDVDDTMKLLDENLMKERITELRSNVTGRKIYLFQKTVVNLSIIPIYLVYLRSTPMKIICLVHPQKFKDTQYNVTLISLNATALTISRFEMQITGTDRSTICFQCGSSST------NFTIRCYKYYNQNVSVTIGPQKTSVFFRKTPLDVFCQVIPSDLINFMEDIFLEGDDPQLIRIDGRSLRIES---VIHQKICFYCGNKVIKNATKCYELYTQDVIISIE-PSSPPYYYKGQRIQVTCIVKPPDIFQKVQNIEIIWHNTSFNKDTDLSLTLTGKYVGD--IICVLCG-NILIYLESMC--YEYLDTSNPSIDFIPK-YQIFLPKVQMTVACILSPKEFYKPQYGFSLSFKNASGMKLSGLEFVMNGLNTDTVCFNCSGTPMKSLVKCYSLYSAAISLSIDPNSKXXXXXXXXXXXXCRVKPDEVVTKNLITDIMLNSNASKVTRVGSLHFN-IPNIQSQTQFCFTCGNRVIANISKCYMFMGNVPTFEIYPAATFLFFRNPTTLTCNVTP-----ANSALTKFSFDLFFLNTSYYTNVNQHVKTLSVNIPFDNHQICLTCGVP-VTNITKCYILKKQDIVIEIIPKVNYYLVYDDTMDVICQVSP----IKSLPNFPGLGFTKMSLSYYKVITQRHYKICHPKSRCAGKFCFTCADPQLPTVFKCYKPWTGTVNFFMTPRNHILFYMEPHLIVCHVDKPFTKNESIKMDINGLKLNEYTYIPAEMTIKILPLHYLLNR----RVIAVCG------------------TNFPTMKANHIY--NLTGAVNLDYDPNFLIFMGFYQNFRIVTYFTFAKKNYSANCVIISPIPLIRVTGSVIEL------FRYLGSGTYHFRCPF-----PNTTSIYIFSLNVLNISVQSRIEPQGPTLYYIYNSLVECIYVPFFVPFSRIDKRVIGLNPSDYTWRSSGMEIAKKLSLR---GA--KVCITCRFSPMFINTKCY-NLKANISFIYHPVMXXXXXXXXXXXXXXXFKHRLLAE-TFQSTCR-MKSGSHQLNILGG------NITLA---------IPLWSGTYLVEC---YPPNSTEMTELQLKVFSDPINLIIYPPAGTVVIMDTVRIYCEVQPS----LNLGMIILSTMQSFLHGNDSSEKIIPNSVLFRDRCLCFSCNCAKMSSVRQCYNFTTPLILRT--KPKQDLYFAWNRVTIETYFINKNKPG-RKYLAMCSLPYENFSVSNLGEIHISPMLVNLVYDFHCTIPTVVDYQILTLFVYSNK---------VELEIIPNNTDIYIFSMVMEVECIVKPDDLNVVFPVIKFLSINSTQYVYKAFRLILIG---GVDYDVKDIICVVCGHDYLPFNVSRCFSPY 4782
            L + P     Y+   + +++C    G L +NTTE          +GG +N SN+TIC +C    Q++ +KCY+MI  AP L  +   IP   Y +  G++  ++C L P  + KY+ NI+V  ++N ++ +G +    +  I  +   Q      +       KPLN+ +       + P+  + Y  +  +++ CL + N +  + L N       + SS+ +  I    S  +CA C    F++P  CY ++                       ++  +  NV G   YL Q+T +         VY    P        P   K  +       +N +    ++    I     S ICF+C    T      N T +CY+  N ++   + P+  SV++    + + C   P D+     DI L  +  +++RI  +SL I S   + ++ IC YC +K++     CY +     + S+  P++   Y   +R  V C + P +  +  +NI +  +NT+F           G   G+  I+C  C     I  E +   YE     +P  + IP+  + +     M + C  S  E         L       + + G        N  T+C  CS   +     C  +      + I PNS  +Y        +C V P+   TK+L +  M          +G++ F+   N     + C TC N  + N +KC +        E++P +        +T  C +TP      N+   +FSF     N + +      V  +S      +  IC+TC  P +  +T CY    + IV+ I P  +        + V C++ P     K+L N   + F  +S    K +++  + +     +  G  CF C +P L +  KCY  +   ++    P N+   Y     IV   D       ++  D+  + LN+        ++KI  L    N     R+   CG                  T + T +   +Y  N+   V  + +P  +    F Q  ++VT   F   NYS +  I+    ++ V    +        + ++ S   +F  P      PN + +Y   L  +N++V   +EP    L  I N L++ I +                        SS ++    LSL    G+   +C TC    +F +TKCY      +S I HP                 + H   A    +  C  +      LN++ G      N T A         I    GT    C      N T+  E     +  P++ +I P     +    + +YC V P        G+  +ST  +F+  ++  E II  ++ F    LCF C     S+V +CY++    I  T       +YFA   + +         PG    +      +EN    +L   H +P  + L   +     +V+ +     F+Y  +         +   I PN+T +Y+ ++ M++ C V P ++       K L IN T ++Y  +   L G    +  +    +C  CGH +   NVS+C+  Y
Sbjct:   47 LWISPRDSSVYYFAFESQIFCIPVTGILTLNTTERDIKQKYLSEVGGRHNKSNKTICGTCEIGIQKTKVKCYEMIETAPTLSTNLVYIPPFPYLLAHGKSSNVQCFLIPDYLEKYYINIIV--KMNGTIITGLIKPY-YNYIVLIITCQMSETGFI-------KPLNMFFFYSKPYHVFPDDINFYFADFEMLISCLNEINGQFSVLLLNTTESYIINKSSILIGGIYNYKSTIICATCLESAFSSPLHCYTIRG----------------------KLHNISFNVPGI-YYLPQRTTI---------VYCEVKP--------PINIKSKEI------VNISLANGTQHNGVINPGFNSVICFKCFPICTLCDFLKNIT-KCYQPQNFHI---LQPKDESVYYFTIEMTLQCD--PPDV-----DIMLVINTTEIMRISKQSLIIGSRYNLSNRTICAYCASKIVIYPKVCYHMIGYKPVFSLNIPAN--MYPPRRRTSVFCNMFPKEAEKYYKNILLTMNNTAFG----------GILYGNETIVCFQCQLKRFISTEKILDHYEKCLIPHPVYNLIPENTKAYFFFKTMELNCNPSDNEVLIQADTLELRSLQHHTISIGG----KYNKNNKTICVFCSTVLLVYPQTCLIILIIEPKIFIKPNS-TMYRVGRPNTYFCDVIPN--TTKSLFSIDMF---------IGTVPFSGFFNGTDIGRVCLTCHNNFLQNATKCVIPYNGPLKIEVFPKSKIYISNKNSTFQCQMTPNLFTGGNTVAPEFSFT----NATNFIISGDMVLFVS-----GSGDICITCIHPWIDPMTNCYESYNKPIVLTINPNYSSIYFKGKNLRVKCELYPEEIIQKNLIN--NISFECLS-PQVKRVSELEFLL---TGQDLGSVCFVCGNPLLGSTRKCYDYYDKIIDVNFHP-NYTTVYFPNLKIVFSCDFVPISIYNLIQDLEMIYLND-------TSLKISKLSVTFNGQNLGRMCFSCGKAAYFTKTECYDYFVVPMTFYITPEGTSVYLSNMLMEVTCNVNPPEV----FTQ--KLVTGIGFIYNNYSISSTIVVSYTVVGVDMGRLCFRCGHINYTHVDSCYDYFADPVILTIQPNNSKVY---LKGINMAVTCTVEP----LRIIQNGLIKDIKL---------------------KSNSSNVDYVSDLSLEIPTGSITTICFTCGNKFIFTSTKCYLYFDEPVSIIIHP----------------NYTHVYFANLLLRVECEILPMKIFYLNLITGIEMVYLNDTSAPISNLEYFIIGTDKGTMCFSCGHFLLRNETKCFEF----YKTPMSFLIEPLVSIYLPNKEMSVYCYVLPGELSRKITGIGFVST--NFISTSNEKEIIIYGNLTFT---LCFKCGHVLYSNVTKCYDYYNHTITITIIPDFSSIYFANKNLNVSCQI---TPPGIINIVTKIKFEFEN----DLTLPH-APFWILLNGKYK----SVICFNCGDHFIYVERRCYDHYNTYLTFYIQPNHTTVYLKNVEMKITCKVFPQEI-----FTKKL-INGTGFIYNNYNPSLNGTQITIFGNTTHKLCFQCGHTFYE-NVSKCYDYY 1476          

HSP 7 Score: 94.7449 bits (234), Expect = 4.789e-19
Identity = 121/495 (24.44%), Postives = 198/495 (40.00%), Query Frame = 1
Query:  280 LLMVLPDGLDGYFSDKDMEVYCNFDNGRLEINT-TEGFRNSNNSMNIGGDY---------NDSNETICASCVTSFQRSSLKCYKMIGYAPDLYFDIP---------TNFYPIGRNLTIKCELRPKGISKYFHNIVV---MTQINDSVH-----SGYLNGVDHGEICFVCKHQCPACTILSSIYNCFK----PLNILYLTPNKSSEYSTNKTLMLHC--LPDNNAR--LHINLKNVNFTSDSS----VELKNISKTVCAYCSSFYFTNPKTCYLVKEMAISKDDVDDTMKLLDENLMKERITELRSNVTGRKIYLFQKTVVNLSIIPIYL-VYLRSTPMKIICLVHPQKFKDTQYNVTLISLNATALTISRFEMQITGTDRSTICFQCGSSSTNFTIRCYKYYNQNVSVTIGPQKTSVFFRKTPLDVFCQVIPSD-----LINFMEDIFLEGDDPQLIRIDGRSLRIESVIHQKICFYCGNKVIKNATKCYELYTQ 1629
            +L + P+    Y    +M V C  +  R+  N   +  +  +NS N+  DY           S  TIC +C   F  +S KCY        LYFD P         T+ Y     L ++CE+ P  I  ++ N++    M  +ND+         ++ G D G +CF C H      +L +   CF+    P++  +L     S Y  NK + ++C  LP   +R    I   + NF S S+    +   N++ T+C  C                                          L SNVT  K Y +    + ++IIP +  +Y  +  + + C + P    +    +     N   L  + F + + G  +S ICF CG        RCY +YN  ++  I P  T+V+ +   + + C+V P +     LIN    I+    +P L   +G  + I      K+CF CG+   +N +KCY+ Y +
Sbjct: 1048 ILTIQPNNSKVYLKGINMAVTCTVEPLRIIQNGLIKDIKLKSNSSNV--DYVSDLSLEIPTGSITTICFTCGNKFIFTSTKCY--------LYFDEPVSIIIHPNYTHVYFANLLLRVECEILPMKI--FYLNLITGIEMVYLNDTSAPISNLEYFIIGTDKGTMCFSCGH-----FLLRNETKCFEFYKTPMS--FLIEPLVSIYLPNKEMSVYCYVLPGELSRKITGIGFVSTNFISTSNEKEIIIYGNLTFTLCFKCGHV---------------------------------------LYSNVT--KCYDYYNHTITITIIPDFSSIYFANKNLNVSCQITPPGIINIVTKIKFEFENDLTLPHAPFWILLNGKYKSVICFNCGDHFIYVERRCYDHYNTYLTFYIQPNHTTVYLKNVEMKITCKVFPQEIFTKKLINGTGFIY-NNYNPSL---NGTQITIFGNTTHKLCFQCGHTFYENVSKCYDYYEE 1478          

HSP 8 Score: 69.3218 bits (168), Expect = 3.068e-11
Identity = 103/432 (23.84%), Postives = 186/432 (43.06%), Query Frame = 1
Query: 3823 RLLAETFQSTCRMKSGSHQLNILGGNITLAIPLWSGTYLVECYP-PNSTEMTELQLKV-FSDPINLIIYPPAGTVVIMDTV-RIYCEVQPSLNLGMIILSTMQSFLHGNDSSEKI--IPNSVLFRDR-CLCFSCNCAKMSSVRQCYNF-TTPLILRTKPKQDLYFAWNRVTIETYFINKNKPGRKYLAMCSLPYENFSVSNLGEIHISPMLVNLVYDFHCTIPTVVDYQILTLFVYSNK-VELEIIPNNTDIYIFSMVMEVECIVKPDDLNVVFPVIKFLSINSTQYVYKAFRLILIGGVDYDVKDIICVVCGHDYLPFNVSRCFSPYMGDINVTILPLEWEIYYL-MPHTITCKIVPQFSNYSKVSFFVIGIPKSSYKVSSDLT-IRINSDKTLINKDICVICGNRPTMNKSRCYRLASDDESRCFDYVIV 5088
            R++        ++KS S  ++ +  +++L IP  +G+    C+   N    T  +  + F +P+++II+P    V   + + R+ CE+ P + +  + L T    ++ ND+S  I  +   ++  D+  +CFSC    + +  +C+ F  TP+    +P   +Y     +++  Y +   +  RK   +  +     S SN  EI I     NL +        V+   +   + Y N  + + IIP+ + IY  +  + V C + P  +  +   IKF   N     +  F ++L G      K +IC  CG D+  +   RC+  Y   +   I P    +Y   +   ITCK+ PQ   ++K      G   ++Y  S + T I I  + T     +C  CG+    N S+CY    +     F   IV
Sbjct: 1075 RIIQNGLIKDIKLKSNSSNVDYVS-DLSLEIP--TGSITTICFTCGNKFIFTSTKCYLYFDEPVSIIIHPNYTHVYFANLLLRVECEILP-MKIFYLNLITGIEMVYLNDTSAPISNLEYFIIGTDKGTMCFSCGHFLLRNETKCFEFYKTPMSFLIEPLVSIYLPNKEMSVYCYVL-PGELSRKITGIGFVSTNFISTSNEKEIIIYG---NLTFTLCFKCGHVLYSNVTKCYDYYNHTITITIIPDFSSIYFANKNLNVSCQITPPGIINIVTKIKFEFENDLTLPHAPFWILLNG----KYKSVICFNCG-DHFIYVERRCYDHYNTYLTFYIQPNHTTVYLKNVEMKITCKVFPQ-EIFTKKLINGTGFIYNNYNPSLNGTQITIFGNTT---HKLCFQCGHTFYENVSKCYDYYEEYRKNGFKEAIV 1489          
BLAST of SMED30016814 vs. Planmine SMEST
Match: SMESG000001257.1 (SMESG000001257.1)

HSP 1 Score: 256.144 bits (653), Expect = 1.202e-70
Identity = 182/644 (28.26%), Postives = 297/644 (46.12%), Query Frame = 1
Query: 1564 ICFYCGNKVIKNATKCYELYTQDVIISIEPSSPPYYYKGQRIQVTCIVKPPDIFQK--VQNIEIIWHNTSFNKDTDLSLTLTGKYVGDIICVLCGNILIYLESMCYEYLDTSNPSIDFIPK-YQIFLPKVQMTVACILSPKEFYKPQYGFSLSFKNASGMKLSGLEFVMNGLNT--DTVCFNCSGTPMKSLVKCYSLYSAAISLSIDPNSKXXXXXXXXXXXXCRVKPDEVVTKNLITDIMLNSNASKVTRVGS--LHFNIPNIQSQTQFCFTCGNRVIANISKCYMFMGNVPTFEIYPAATFLFFRNPTTLTCNVTPANSALTKFSFDLFFLNTSYYTNVNQHVKTLSVNIPFDNHQICLTCG-VPVTNITKCYILKKQDIVIEIIPKVNYYLVYDDTMDVICQVSPIKSLPNFPGLGFTKMSLSYYKVITQRHYKICHPKSRCAGKFCFTCADPQLPTVFKCYKPWTGTVNFFMTPRNHILFYMEPHLIVCHVDKPFTKNESIKMDINGLKLNEYTYIPAEMTIKILPLHYLLNRRVIAVCGTNFPTMKANHIYNLTGAVNLDYDPNFLIFMGFYQNFRIVTYFTFAKKNYSANCVIISPIPLIRVTGSVIELFRYLGSGTYHFRCPFPNTTSIYIFSLNVL 3471
            ICF CG+  + N  KCY +Y   + ++I P+    Y +   + V C V P ++     + NI  I +N S  + ++  + + G   G + C  CG+ L+   + CY Y +  N S+  IP    ++    +    C   P EF     G           KLS     +         +CF C+   +K  +KCY   +    L I P +  ++    ++ V C V P  ++  N++  I L ++      +G   + F    I      C +CG+R++ N++KC+       T +I P    ++++    +TC  +P         F +  LN + Y NV    K +   +  D  +ICL CG + + N +KC+   K ++ I I P V YYL Y+D  DVIC   P  ++  FP L FT +   ++ +I + HY+IC+P + C    CFTC + QL    KCY+ ++  V+  +TP    L+YM  H + C     F     + + I GL          E++++I P  YL+ ++V A CG  F  M  +  +NL   + L + P ++++M FY +F + TYF      Y A C   S +P + + GS I L  +L SGTY F C   NTT  +   L + 
Sbjct:   43 ICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLIYMRNLSMNVICRVDPLEVINNNLLLNIRFIEYNRSVTEVSERQMFVNGVDKGKL-CFTCGHRLLVPVTRCYIYYE-GNVSMFIIPNDTSVYFTDNKFEAFCEFDPPEFLTLIIGIQFFSNYRGAAKLSSTHMKIANFTAPFSVICFYCTFRLVKPKLKCYKPITDY-KLKILPENISIFMVKFVMKVSCEVYPSSLL--NVLPTISLTTSRVLYKLLGKRKISFGPFPITMTKDVCVSCGHRIMVNVTKCFKPNAENITIDILPVENIIYYKYIHEITCKYSPVFILEQFVEFKVVNLNKTLYENVGTLSKRIPSRLEIDMFEICLVCGNMAMMNTSKCFTASKIEVEIVISPNVQYYLSYEDKKDVICGTKPGNAIFQFPQLHFTMVDSKHFHMINKTHYQICYPANSCTSDICFTCEERQLGYKEKCYRIFSRPVDTTITPIEPDLYYMRYHELHCEFIPDFETKNHVGLIIPGLVSGWQYESVGELSLRIFPSIYLIGKKVCAFCGFRFHYMNFSKCWNLKINITLFHLPFYIVYMIFYYDFIVTTYFVENSTKYEALCR-YSKLPKVLIIGSNIYLQNHLQSGTYLFECYLLNTTMKHELRLQIF 680          

HSP 2 Score: 161.77 bits (408), Expect = 5.712e-40
Identity = 185/693 (26.70%), Postives = 300/693 (43.29%), Query Frame = 1
Query: 2005 SLSFKNASGMKLSGLEFVMNGLNTDTVCFNCSGTPMKSLVKCYSLYSAAISLSIDPNSKXXXXXXXXXXXXCRVKPDEVVTKNLITDIMLNSNASKVTRVGSLHFNIPNIQSQTQFCFTCGNRVIANISKCYMFM-GNVPTFEIYPAATFLFFRNPTTLTCNVTPANSALTKFSFDLFFLNTSYYTNVNQ-HVKTLSVNIPFDNHQICLTCGVP-VTNITKCYILKKQDIVIEIIPKVNYYLVYDDTMDVICQVSPIKSLPNFPGLGFTKMSLSYYKVITQRHYKICHPKSRCAGKFCFTCADPQLPTVFKCYKPWTGTVNFFMTPRNHILFYMEPHLIVCHVDKPFTKNESIKMDINGLKLNEYTYIPAEMTIKILPLHYLLNR-RVIAVCGTNFPTMKANHIYNLTG-AVNLDYDPNFLIFMGFYQNFRIVTYFTFAKKNYSANCVIISPIPLIRVTGSVIELFRYLGSGTYHFRCPFPNTTSIYIFS------------LNVLNISVQSRIEPQGPTLYYIYNSLVECIYVPFFVPFSRIDKRVIGLNPSDYTWRSSG---MEIAKKLSLRGAKVCITCRFSPMFIN-TKCYNLKANISFIYHPVMXXXXXXXXXXXXXXXFKHRLLAETFQSTCRMKSGSHQLNILGGNITLAIPLWSGTYLVECYPPNSTEMTELQLKVFSDPINLII 4020
            S +F NAS + ++    ++ G +T  +CF C    + ++ KCY++Y   I L+I PN   +Y   + ++V CRV P EV+  NL+ +I        VT V      +  +  + + CFTCG+R++  +++CY++  GNV  F I    +  F  N     C   P    LT      FF N      ++  H+K  +   PF    IC  C    V    KCY     D  ++I+P+     +    M V C+V P   L   P +  T  S   YK++ +R               C +C    +  V KC+KP    +   + P  +I++Y   H I C     F   + ++  +  + LN+  Y       K +P    ++   +  VCG N   M  +  +  +   V +   PN   ++ +     ++       K  +A    I   P +  T    + F  +    Y    P  + TS   F+              + +  V + I P  P LYY+    + C ++P F   + +   + GL  S + + S G   + I   + L G KVC  C F   ++N +KC+NLK NI+  + P    Y I+Y D+ V TYF     +  +++ CR  S   ++ I+G NI L   L SGTYL ECY  N+T   EL+L++F +  N II
Sbjct:   17 SFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLIYMRNLSMNVICRVDPLEVINNNLLLNIRFIEYNRSVTEVSERQMFVNGV-DKGKLCFTCGHRLLVPVTRCYIYYEGNVSMFIIPNDTSVYFTDNKFEAFCEFDPP-EFLTLIIGIQFFSNYRGAAKLSSTHMKIANFTAPFS--VICFYCTFRLVKPKLKCY-KPITDYKLKILPENISIFMVKFVMKVSCEVYPSSLLNVLPTISLT-TSRVLYKLLGKRKISFGPFPITMTKDVCVSCGHRIMVNVTKCFKPNAENITIDILPVENIIYYKYIHEITCKYSPVFILEQFVEFKV--VNLNKTLYENVGTLSKRIPSRLEIDMFEICLVCG-NMAMMNTSKCFTASKIEVEIVISPNVQYYLSYEDKKDVIC----GTKPGNA----IFQFPQLHFTMVDSKHFHMINKTHYQICYPANSCTSDICFTCEERQLGYKEKCYRIFSRPVDTTITPIEPDLYYMRYHELHCEFIPDFETKNHVGLIIPGL-VSGWQYESVGELSLRIFPSIYLIGKKVCAFCGFRFHYMNFSKCWNLKINITLFHLPFYIVYMIFYYDFIVTTYFVEN--STKYEALCRY-SKLPKVLIIGSNIYLQNHLQSGTYLFECYLLNTTMKHELRLQIFMEQNNKII 688          

HSP 3 Score: 119.398 bits (298), Expect = 8.715e-27
Identity = 124/535 (23.18%), Postives = 217/535 (40.56%), Query Frame = 1
Query: 1120 VNLSIIP-IYLVYLRSTPMKIICLVHPQKFKDTQY--NVTLISLNATALTISRFEMQITGTDRSTICFQCGSSSTNFTIRCYKYYNQNVSVTIGPQKTSVFFRKTPLDVFCQVIPSDLINFMEDIFLEGDDPQLIRIDGRSLRIESVIH--QKICFYCGNKVIKNATKCYELYTQDVIISIEPSSPPYYYKGQRIQVTCIVKPPDIFQKVQNIEIIWHNTSFN--KDTDLSLTLTGKYVGDIICVLCGNILIYLESMCYEYLDTSNPSIDFIPKYQIFLPKVQMTVACILSPKEFYKPQYGFSLSFKNASGMKLSGL--EFVMNGLNTD--TVCFNCSGTPMKSLVKCYSLYSAAISLSIDPNSKXXXXXXXXXXXXCRVKPDEVVTK-NLITDIMLNSNASKVTRVGSLHFNI--PNIQSQTQFCFTCGNRVIANISKCYMFMGNVPTFEIYPAATFLFFRNPTTLTCNVTPANSALTKFSFDLFFLNTSY-YTNVNQHVKTLSVNIPFDNHQICLTCGVPV--TNITKCYILK 2673
            + L+I+P   L+Y+R+  M +IC V P +  +     N+  I  N +   +S  +M + G D+  +CF CG        RCY YY  NVS+ I P  TSV+F     + FC+  P + +  +  I    +     ++    ++I +       ICFYC  +++K   KCY+  T D  + I P +   +     ++V+C V P  +   +  I +      +       +S       +   +CV CG+ ++   + C++  +  N +ID +P   I   K    + C  SP    +    F +   N +  +  G   + + + L  D   +C  C    M +  KC++     + + I PN +Y        DV C  KP   + +   +   M++S    +  +   H+ I  P     +  CFTC  R +    KCY          I P    L++     L C   P           +  L + + Y +V +    +  +I     ++C  CG      N +KC+ LK
Sbjct:   66 IKLTILPNDTLIYMRNLSMNVICRVDPLEVINNNLLLNIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCYIYYEGNVSMFIIPNDTSVYFTDNKFEAFCEFDPPEFLTLIIGIQFFSNYRGAAKLSSTHMKIANFTAPFSVICFYCTFRLVKPKLKCYKPIT-DYKLKILPENISIFMVKFVMKVSCEVYPSSLLNVLPTISLTTSRVLYKLLGKRKISFGPFPITMTKDVCVSCGHRIMVNVTKCFK-PNAENITIDILPVENIIYYKYIHEITCKYSPVFILEQFVEFKVVNLNKTLYENVGTLSKRIPSRLEIDMFEICLVCGNMAMMNTSKCFTASKIEVEIVISPNVQYYLSYEDKKDVICGTKPGNAIFQFPQLHFTMVDSKHFHM--INKTHYQICYPANSCTSDICFTCEERQLGYKEKCYRIFSRPVDTTITPIEPDLYYMRYHELHCEFIPDFETKNHVGLIIPGLVSGWQYESVGELSLRIFPSIYLIGKKVCAFCGFRFHYMNFSKCWNLK 596          

HSP 4 Score: 113.62 bits (283), Expect = 5.840e-25
Identity = 117/532 (21.99%), Postives = 222/532 (41.73%), Query Frame = 1
Query: 1243 NATALTISRFEMQITGTDRSTICFQCGSSSTNFTIRCYKYYNQNVSVTIGPQKTSVFFRKTPLDVFCQVIPSDLI--NFMEDIFLEGDDPQLIRIDGRSLRIESVIHQKICFYCGNKVIKNATKCYELYTQDVIISIEPSSPPYYYKGQRIQVTCIVKPPDIFQKVQNIEIIWHNTSFNKDTDLSLTLTGKYVG-DIICVLCGNILIYLESMCYEYLDTSNPSIDFIPK-YQIFLPKVQMTVACILSPKEFYKPQYGFSLS-----FKNASGMKLSGLEFVMNGLNTDTVCFNCSGTPMKSLVKCYSLYSAAISLSIDPNSKXXXXXXXXXXXXCRVKPDEVVTKNLITDIMLNSNASKVTRVGSLHFNIPNIQSQTQF--CFTCGNRVIANISKCYMFMGNVPTFEIYPAAT-FLFFRNPTTLTCNVTPANSALTKFSFDLFFLNTSYYTNVNQHVKTLSVNIPFDNHQICLTCGV-PVTNITKCYIL--KKQDIVIEIIPKVNYYLVYDDTMDVICQVSPIKSLPNFPGL 2793
            NA+++ ++   + + G D   ICF+CG  +     +CY  Y   + +TI P  T ++ R   ++V C+V P ++I  N + +I     +  +  +  R + +  V   K+CF CG++++   T+CY  Y  +V + I P+    Y+   + +  C   PP+    +  I+   +     K +   + +        +IC  C   L+  +  CY+ +  ++  +  +P+   IF+ K  M V+C + P          SL+     +K     K+S   F +    T  VC +C    M ++ KC+   +  I++ I P  + +     + ++ C+  P   + +  +   ++N N +    VG+L   IP+      F  C  CGN  + N SKC+          I P    +L + +   + C   P N+           +++ ++  +N+    +          IC TC    +    KCY +  +  D  I  I    YY+ Y    ++ C+  P     N  GL
Sbjct:   22 NASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLIYMRNLSMNVICRVDPLEVINNNLLLNIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCYIYYEGNVSMFIIPNDTSVYFTDNKFEAFCEFDPPEFLTLIIGIQFFSNYRGAAKLSSTHMKIANFTAPFSVICFYCTFRLVKPKLKCYKPI--TDYKLKILPENISIFMVKFVMKVSCEVYPSSLLNVLPTISLTTSRVLYKLLGKRKISFGPFPITM--TKDVCVSCGHRIMVNVTKCFKPNAENITIDILP-VENIIYYKYIHEITCKYSP-VFILEQFVEFKVVNLNKTLYENVGTLSKRIPSRLEIDMFEICLVCGNMAMMNTSKCFTASKIEVEIVISPNVQYYLSYEDKKDVICGTKPGNAIFQFPQLHFTMVDSKHFHMINKTHYQICYPANSCTSDICFTCEERQLGYKEKCYRIFSRPVDTTITPIEPDLYYMRYH---ELHCEFIPDFETKNHVGL 544          

HSP 5 Score: 100.908 bits (250), Expect = 5.219e-21
Identity = 64/175 (36.57%), Postives = 94/175 (53.71%), Query Frame = 1
Query: 4522 ELEIIPNNTDIYIFSMVMEVECIVKPDDLNVVFPVIKFLSINSTQYVYKAF--RLILIGGVDYDVKDIICVVCGHDYLPFNVSRCFSPYMGDINVTILPLEWEIYYLMPHTITCKIVPQFSNYSKVSFFVIGIPKSSYKVSSDLTIRINSDKTLINKDICVICGNRPTMNKSRCY 5040
            +L+I+P N  I++   VM+V C V P  L  V P I   S+ +++ +YK    R I  G     +   +CV CGH  +  NV++CF P   +I + ILP+E  IYY   H ITCK  P F     V F V+ + K+ Y+    L+ RI S   +   +IC++CGN   MN S+C+
Sbjct:  242 KLKILPENISIFMVKFVMKVSCEVYPSSLLNVLPTI---SLTTSRVLYKLLGKRKISFGPFPITMTKDVCVSCGHRIM-VNVTKCFKPNAENITIDILPVENIIYYKYIHEITCKYSPVFILEQFVEFKVVNLNKTLYENVGTLSKRIPSRLEIDMFEICLVCGNMAMMNTSKCF 412          

HSP 6 Score: 70.4774 bits (171), Expect = 1.133e-11
Identity = 67/247 (27.13%), Postives = 108/247 (43.72%), Query Frame = 1
Query: 2224 VKPDEVVTKNLITDIMLNSNASKVTRVGSLHFNIPNIQSQTQFCFTCGNRVIANISKCYMFMGNVPTFEIYPAATFLFFRNPT-TLTCNVTPANSALTKFSFDLFFLN-TSYYTNVNQHVKTLSVNIPFDNHQICLTCG----VPVTNITKCYILKKQDIVIEIIPKVNYYLVYDDTMDVICQVSPIKSLPNFPGLGFTKMSLSYYKVITQRHYKICHPKSRCAGKFCFTCADPQLPTVFKCYKPWT 2946
            V P EVV + LIT+I  N N +    V + +  +    ++   CF CG+  + N+ KCY    +     I P  T ++ RN +  + C V P          ++ F+      T V++  + + VN   D  ++C TCG    VPV   T+CYI  + ++ + IIP        D+  +  C+  P + L    G+ F        K ++  H KI +  +  +   CF C    +    KCYKP T
Sbjct:    2 VDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKI-ICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLIYMRNLSMNVICRVDPLEVINNNLLLNIRFIEYNRSVTEVSE--RQMFVN-GVDKGKLCFTCGHRLLVPV---TRCYIYYEGNVSMFIIPNDTSVYFTDNKFEAFCEFDPPEFLTLIIGIQFFSNYRGAAK-LSSTHMKIANFTAPFS-VICFYCTFRLVKPKLKCYKPIT 239          

HSP 7 Score: 67.0106 bits (162), Expect = 1.273e-10
Identity = 49/190 (25.79%), Postives = 86/190 (45.26%), Query Frame = 1
Query: 4510 SNKVELEII--PNNTDIYIFSMVMEVECIVKPDDLNVVFPVIKFLSINSTQYVYKAFRLILIGGVDYDV-------KDIICVVCGHDYLPFNVSRCFSPYMGDINVTILPLEWEIYYLMPHTITCKIVPQFSNYSKVSFFVIGIPKS-SYKVSSDLTIRINSDKTLINKDICVICGNR-PTMNKSRCYRL 5046
            ++K+E+EI+  PN      +    +V C  KP +    FP + F  ++S  +        +I    Y +          IC  C    L +   +C+  +   ++ TI P+E ++YY+  H + C+ +P F   + V   + G+     Y+   +L++RI     LI K +C  CG R   MN S+C+ L
Sbjct:  414 ASKIEVEIVISPNVQYYLSYEDKKDVICGTKPGNAIFQFPQLHFTMVDSKHFH-------MINKTHYQICYPANSCTSDICFTCEERQLGYK-EKCYRIFSRPVDTTITPIEPDLYYMRYHELHCEFIPDFETKNHVGLIIPGLVSGWQYESVGELSLRIFPSIYLIGKKVCAFCGFRFHYMNFSKCWNL 595          
The following BLAST results are available for this feature:
BLAST of SMED30016814 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016814 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016814 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016814 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016814 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016814 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016814 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016814 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016814 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016814 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016814 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016814 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016814 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016814 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016214.10.000e+0100.00SMESG000016214.1[more]
SMESG000004613.12.232e-8030.72SMESG000004613.1[more]
SMESG000004618.16.358e-7425.95SMESG000004618.1[more]
SMESG000004618.17.119e-7425.95SMESG000004618.1[more]
SMESG000001257.11.202e-7028.26SMESG000001257.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016814 ID=SMED30016814|Name=SMED30016814|organism=Schmidtea mediterranea sexual|type=transcript|length=5231bp
TTTCATTCAATACATTTATCAATAGACCAATATCTGATGAGTTCTTGCTG
GAGTACTCCACCAACCTCCAGTCAATAAATGCTCATAGGGATCTCAATTC
TGCTCTCAATCCGTCTCTGTTGGAATTGCGTAAAACTAGAAGAGTTCTGC
ATTGAAGAAAACGGAATTCAACGAGAACTAAATCACGTTTGGATCAGAAA
TGGATGCCAGTGCAAATGTGAAATTCTGAGGGATAAAATCGGAATAACAT
GCAATGAATGCGCTGAGAAATCAGAAAAGTTATTAATGGTTCTGCCCGAT
GGACTGGACGGCTACTTTAGCGATAAAGATATGGAGGTTTATTGTAATTT
TGATAATGGGAGGTTAGAGATAAACACCACTGAGGGTTTCCGGAATAGTA
ACAATTCTATGAATATTGGCGGTGACTATAATGACAGCAATGAAACAATT
TGCGCTTCGTGCGTAACGTCATTCCAAAGAAGTTCTCTTAAATGTTACAA
AATGATTGGATACGCTCCAGATCTTTATTTTGATATTCCTACAAACTTTT
ATCCGATTGGAAGAAATTTGACAATAAAATGTGAGTTGAGGCCGAAGGGA
ATCAGCAAATACTTCCACAATATCGTTGTGATGACCCAAATAAACGATTC
GGTTCATTCTGGATATCTGAATGGAGTAGATCACGGTGAAATATGTTTCG
TATGTAAGCATCAATGCCCCGCCTGTACAATCCTATCATCAATTTACAAC
TGCTTTAAACCCTTAAACATCCTTTACCTGACACCGAATAAGTCAAGCGA
ATATTCCACCAACAAAACCTTGATGTTGCACTGTCTACCTGACAACAATG
CCCGGTTACATATCAACCTGAAAAACGTTAACTTTACGAGTGATTCGTCA
GTGGAGCTGAAAAATATCAGCAAAACCGTTTGTGCTTACTGCAGCTCGTT
TTATTTTACAAATCCCAAGACATGTTACTTAGTAAAAGAAATGGCGATAT
CGAAGGACGACGTTGATGACACAATGAAGTTATTGGATGAAAATCTTATG
AAAGAAAGAATTACCGAGTTGAGATCTAATGTAACTGGAAGAAAGATTTA
TTTGTTTCAAAAAACCGTTGTCAATTTGAGTATTATTCCCATTTACCTCG
TTTATCTACGCAGCACTCCTATGAAGATAATATGTTTGGTCCATCCGCAA
AAATTCAAGGACACCCAATACAATGTTACTTTGATATCGCTCAACGCCAC
GGCTCTTACGATATCTAGATTTGAAATGCAAATCACCGGAACTGACAGGT
CTACAATTTGCTTTCAATGCGGAAGTTCCTCCACTAATTTCACAATAAGA
TGCTATAAGTATTACAATCAAAATGTCTCCGTGACGATTGGACCTCAAAA
GACGTCTGTCTTCTTTCGGAAAACGCCACTAGATGTCTTTTGTCAAGTTA
TTCCCAGCGATTTAATCAATTTTATGGAAGACATCTTTCTAGAAGGCGAT
GATCCGCAATTAATACGAATAGATGGAAGAAGCTTAAGAATTGAAAGTGT
GATACATCAAAAGATTTGTTTCTACTGTGGAAACAAAGTCATTAAGAATG
CCACCAAATGCTATGAACTTTATACACAAGACGTCATAATTTCAATCGAA
CCTTCAAGCCCACCATATTACTATAAAGGTCAAAGAATACAAGTCACTTG
TATAGTAAAACCGCCGGATATATTTCAGAAAGTTCAAAACATTGAAATTA
TCTGGCATAATACCTCTTTCAACAAAGATACTGATCTCTCGCTGACTCTT
ACTGGCAAATACGTAGGTGACATCATATGCGTACTCTGTGGAAATATTCT
CATTTACTTGGAATCAATGTGCTACGAATACCTAGATACGTCAAATCCTA
GCATTGATTTCATTCCAAAATATCAAATATTTCTTCCTAAAGTACAGATG
ACGGTGGCGTGCATTCTGAGCCCCAAGGAGTTTTATAAACCACAATATGG
CTTTAGTTTAAGCTTTAAGAACGCTTCAGGCATGAAATTATCTGGATTAG
AGTTTGTCATGAATGGACTCAACACGGACACAGTTTGTTTTAATTGCAGC
GGTACTCCAATGAAATCTCTAGTCAAGTGCTATTCCTTATATAGTGCTGC
AATATCCCTATCAATTGATCCTAATAGTAAATATGTATACCCTCCAGTGG
TTCTTTTGGATGTTTACTGCCGAGTGAAACCCGATGAGGTGGTTACCAAA
AATCTCATTACCGATATAATGCTCAATAGCAATGCCTCCAAAGTGACGAG
GGTCGGCAGCCTTCATTTCAATATTCCGAATATTCAATCTCAGACTCAAT
TCTGTTTTACGTGTGGCAACCGGGTTATCGCAAACATTTCCAAGTGTTAT
ATGTTTATGGGTAATGTTCCGACATTTGAGATTTACCCGGCTGCAACGTT
TTTATTTTTCCGGAATCCTACAACATTGACATGCAATGTCACCCCCGCAA
ATTCGGCTTTGACTAAGTTTTCTTTTGATTTATTCTTCCTGAATACGTCG
TATTATACAAATGTCAACCAGCACGTTAAAACATTATCAGTTAATATCCC
ATTCGACAATCACCAAATCTGCCTGACTTGCGGCGTTCCGGTTACAAATA
TAACGAAATGTTATATACTAAAAAAACAAGATATTGTCATTGAAATTATC
CCGAAAGTGAATTATTATTTGGTCTACGACGACACAATGGACGTCATATG
CCAGGTGTCTCCCATAAAATCATTACCAAATTTCCCAGGACTTGGGTTCA
CCAAAATGTCTCTGTCATATTATAAGGTTATTACCCAAAGGCACTACAAA
ATTTGCCACCCAAAAAGTAGATGTGCTGGAAAATTTTGCTTCACTTGTGC
CGACCCGCAGCTGCCGACAGTATTCAAGTGCTATAAGCCTTGGACGGGAA
CCGTCAACTTTTTCATGACGCCAAGGAATCATATCTTATTTTACATGGAA
CCCCATTTGATTGTTTGCCATGTTGATAAGCCTTTTACCAAGAACGAGAG
CATCAAAATGGACATTAATGGGTTGAAGCTGAATGAGTATACGTATATTC
CGGCGGAAATGACCATTAAAATACTTCCGTTGCATTATTTATTGAACCGT
AGAGTTATTGCGGTATGCGGAACGAACTTCCCAACGATGAAGGCCAATCA
TATATACAATTTGACAGGAGCGGTGAACTTGGACTACGATCCCAATTTCT
TAATTTTCATGGGTTTTTATCAAAACTTTCGAATTGTGACCTATTTCACT
TTTGCAAAAAAAAATTACTCGGCCAACTGTGTCATCATCAGTCCGATACC
TTTGATTAGGGTAACTGGGTCGGTCATTGAATTGTTCAGATATCTCGGAA
GTGGCACATACCATTTCCGTTGTCCGTTCCCTAATACAACCAGTATTTAT
ATTTTCAGTCTTAATGTTCTAAACATATCTGTCCAGTCCCGTATTGAACC
TCAAGGACCTACCTTGTACTACATTTACAATTCGTTAGTCGAATGCATTT
ATGTCCCATTTTTTGTACCATTCTCCAGAATAGACAAAAGAGTAATTGGA
CTCAACCCATCTGACTATACATGGAGATCGTCTGGAATGGAGATAGCAAA
AAAATTATCGTTGAGGGGTGCAAAAGTCTGCATAACGTGCAGATTTTCAC
CGATGTTTATCAATACCAAATGTTACAACTTAAAAGCAAACATTTCATTC
ATATACCATCCGGTAATGGATTATTACACTATTTACTACCAAGATTACTA
CGTGGTTACCTATTTCAAGCACCGATTGTTAGCGGAGACTTTTCAGTCAA
CTTGTAGGATGAAAAGTGGATCTCATCAATTGAATATCTTGGGAGGAAAT
ATTACCCTTGCTATTCCATTGTGGTCTGGAACTTACCTGGTGGAATGTTA
TCCTCCCAATTCGACAGAAATGACTGAACTTCAGCTGAAAGTATTTAGCG
ATCCGATAAATTTGATAATTTATCCACCAGCTGGAACAGTTGTCATTATG
GACACCGTTAGAATTTATTGCGAGGTCCAACCGTCATTAAATCTCGGAAT
GATCATATTGAGCACGATGCAGTCCTTCCTACATGGGAATGATAGTAGTG
AAAAGATTATCCCAAATTCTGTACTGTTCCGTGACCGGTGCCTCTGTTTC
TCCTGTAATTGCGCCAAGATGTCCTCCGTCAGACAATGCTACAACTTTAC
AACTCCTTTGATCTTAAGAACCAAACCGAAACAAGACCTTTATTTTGCCT
GGAATAGAGTAACAATTGAAACATATTTTATCAATAAAAACAAACCAGGC
CGGAAATACTTGGCAATGTGCTCCCTTCCATATGAAAACTTTTCCGTGAG
CAATCTCGGCGAAATCCACATTTCCCCAATGTTAGTAAATTTGGTGTACG
ATTTCCATTGCACGATTCCAACAGTTGTCGACTATCAAATCTTAACGTTG
TTTGTTTACAGTAACAAGGTCGAGCTCGAAATCATTCCCAACAACACAGA
TATTTACATTTTCAGCATGGTCATGGAAGTTGAATGTATTGTCAAGCCGG
ACGATCTCAATGTTGTTTTCCCCGTCATTAAATTTCTGAGCATAAACTCC
ACCCAGTACGTCTATAAGGCTTTCAGATTGATACTCATAGGAGGCGTTGA
CTATGATGTCAAGGACATCATCTGTGTTGTCTGTGGACATGATTACTTGC
CGTTTAATGTATCACGATGTTTCAGTCCATACATGGGAGATATAAATGTC
ACCATCTTACCCCTGGAATGGGAAATTTATTATCTTATGCCTCACACGAT
CACTTGCAAAATCGTTCCTCAGTTCTCCAATTATTCCAAGGTGTCATTCT
TTGTGATTGGTATCCCAAAATCATCGTACAAGGTCAGCAGTGATTTGACG
ATACGTATCAATTCGGACAAAACCTTGATTAACAAGGATATCTGTGTTAT
ATGTGGAAACCGTCCAACCATGAACAAATCCCGATGTTACAGATTGGCAT
CGGATGACGAGAGTAGATGTTTTGATTACGTGATCGTGATGACTATTATG
CTGACGTTCCTAGTTCTAGCCGTATACATTAGTACATATGAGGTTATGTA
AACCTTTTGTAAGATTGATTGTGGTGCTTTCGGATATTCATATGTAATCA
GTATACAAATAAACTTTGTATTACTTAAAAA
back to top

protein sequence of SMED30016814-orf-1

>SMED30016814-orf-1 ID=SMED30016814-orf-1|Name=SMED30016814-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1691bp
MLIGISILLSIRLCWNCVKLEEFCIEENGIQRELNHVWIRNGCQCKCEIL
RDKIGITCNECAEKSEKLLMVLPDGLDGYFSDKDMEVYCNFDNGRLEINT
TEGFRNSNNSMNIGGDYNDSNETICASCVTSFQRSSLKCYKMIGYAPDLY
FDIPTNFYPIGRNLTIKCELRPKGISKYFHNIVVMTQINDSVHSGYLNGV
DHGEICFVCKHQCPACTILSSIYNCFKPLNILYLTPNKSSEYSTNKTLML
HCLPDNNARLHINLKNVNFTSDSSVELKNISKTVCAYCSSFYFTNPKTCY
LVKEMAISKDDVDDTMKLLDENLMKERITELRSNVTGRKIYLFQKTVVNL
SIIPIYLVYLRSTPMKIICLVHPQKFKDTQYNVTLISLNATALTISRFEM
QITGTDRSTICFQCGSSSTNFTIRCYKYYNQNVSVTIGPQKTSVFFRKTP
LDVFCQVIPSDLINFMEDIFLEGDDPQLIRIDGRSLRIESVIHQKICFYC
GNKVIKNATKCYELYTQDVIISIEPSSPPYYYKGQRIQVTCIVKPPDIFQ
KVQNIEIIWHNTSFNKDTDLSLTLTGKYVGDIICVLCGNILIYLESMCYE
YLDTSNPSIDFIPKYQIFLPKVQMTVACILSPKEFYKPQYGFSLSFKNAS
GMKLSGLEFVMNGLNTDTVCFNCSGTPMKSLVKCYSLYSAAISLSIDPNS
KYVYPPVVLLDVYCRVKPDEVVTKNLITDIMLNSNASKVTRVGSLHFNIP
NIQSQTQFCFTCGNRVIANISKCYMFMGNVPTFEIYPAATFLFFRNPTTL
TCNVTPANSALTKFSFDLFFLNTSYYTNVNQHVKTLSVNIPFDNHQICLT
CGVPVTNITKCYILKKQDIVIEIIPKVNYYLVYDDTMDVICQVSPIKSLP
NFPGLGFTKMSLSYYKVITQRHYKICHPKSRCAGKFCFTCADPQLPTVFK
CYKPWTGTVNFFMTPRNHILFYMEPHLIVCHVDKPFTKNESIKMDINGLK
LNEYTYIPAEMTIKILPLHYLLNRRVIAVCGTNFPTMKANHIYNLTGAVN
LDYDPNFLIFMGFYQNFRIVTYFTFAKKNYSANCVIISPIPLIRVTGSVI
ELFRYLGSGTYHFRCPFPNTTSIYIFSLNVLNISVQSRIEPQGPTLYYIY
NSLVECIYVPFFVPFSRIDKRVIGLNPSDYTWRSSGMEIAKKLSLRGAKV
CITCRFSPMFINTKCYNLKANISFIYHPVMDYYTIYYQDYYVVTYFKHRL
LAETFQSTCRMKSGSHQLNILGGNITLAIPLWSGTYLVECYPPNSTEMTE
LQLKVFSDPINLIIYPPAGTVVIMDTVRIYCEVQPSLNLGMIILSTMQSF
LHGNDSSEKIIPNSVLFRDRCLCFSCNCAKMSSVRQCYNFTTPLILRTKP
KQDLYFAWNRVTIETYFINKNKPGRKYLAMCSLPYENFSVSNLGEIHISP
MLVNLVYDFHCTIPTVVDYQILTLFVYSNKVELEIIPNNTDIYIFSMVME
VECIVKPDDLNVVFPVIKFLSINSTQYVYKAFRLILIGGVDYDVKDIICV
VCGHDYLPFNVSRCFSPYMGDINVTILPLEWEIYYLMPHTITCKIVPQFS
NYSKVSFFVIGIPKSSYKVSSDLTIRINSDKTLINKDICVICGNRPTMNK
SRCYRLASDDESRCFDYVIVMTIMLTFLVLAVYISTYEVM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.587
NoneNo IPR availableTMHMMTMhelixcoord: 1665..1687