something about silencing protein 10

Overview
Namesomething about silencing protein 10
Smed IDSMED30016808
Length (bp)1183
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of something about silencing protein 10 (SMED30016808) t-SNE clustered cells

Violin plots show distribution of expression levels for something about silencing protein 10 (SMED30016808) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of something about silencing protein 10 (SMED30016808) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for something about silencing protein 10 (SMED30016808) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016808

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30016808h1SMcG0007152 SmedASXL_014263SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30016808h1SMcG0007152 SmedASXL_014263SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of something about silencing protein 10 vs. Ensembl Human
Match: UTP3 (UTP3 small subunit processome component [Source:HGNC Symbol;Acc:HGNC:24477])

HSP 1 Score: 69.707 bits (169), Expect = 2.663e-12
Identity = 34/65 (52.31%), Postives = 43/65 (66.15%), Query Frame = 3
Query:  885 LLENRGLVPKRKKADANPRVKHRMKFKKALVRYHSQVPRTRDDAGNYQGEKSGIRAAVIRAQKFK 1079
            + +NRGL P+RKK D NPRVKHR KF++A +R   QV   R +   Y GE SGIRA V ++ K K
Sbjct:  415 IAKNRGLTPRRKKIDRNPRVKHREKFRRAKIRRRGQVREVRKEEQRYSGELSGIRAGVKKSIKLK 479          
BLAST of something about silencing protein 10 vs. Ensembl Fly
Match: Sas10 (gene:FBgn0029755 transcript:FBtr0070751)

HSP 1 Score: 63.5438 bits (153), Expect = 9.471e-11
Identity = 32/71 (45.07%), Postives = 44/71 (61.97%), Query Frame = 3
Query:  867 RPASKALLENRGLVPKRKKADANPRVKHRMKFKKALVRYHSQVPRTRDDAGNYQGEKSGIRAAVIRAQKFK 1079
            R  +  + +N+GL P RKK   NPRVKHR K++KAL+R    V   R +   Y GE SGI+A V ++ KF+
Sbjct:  357 RGITYQMAKNKGLTPHRKKELRNPRVKHRGKYRKALIRRKGAVRTVRKELQRYGGELSGIKAGVTKSVKFR 427          
BLAST of something about silencing protein 10 vs. Ensembl Zebrafish
Match: utp3 (UTP3 small subunit processome component [Source:ZFIN;Acc:ZDB-GENE-040912-163])

HSP 1 Score: 72.0182 bits (175), Expect = 2.904e-13
Identity = 35/62 (56.45%), Postives = 41/62 (66.13%), Query Frame = 3
Query:  894 NRGLVPKRKKADANPRVKHRMKFKKALVRYHSQVPRTRDDAGNYQGEKSGIRAAVIRAQKFK 1079
            N+GL PKRKK D NPRVKHR KF++A +R   QV   R +   Y GE SGIRA V R+ K K
Sbjct:  409 NKGLTPKRKKIDRNPRVKHREKFRRAQIRRKGQVREVRHEEARYSGEWSGIRAGVKRSVKLK 470          
BLAST of something about silencing protein 10 vs. Ensembl Xenopus
Match: apba2 (amyloid beta (A4) precursor protein-binding, family A, member 2 [Source:Xenbase;Acc:XB-GENE-952383])

HSP 1 Score: 71.2478 bits (173), Expect = 6.731e-13
Identity = 35/71 (49.30%), Postives = 45/71 (63.38%), Query Frame = 3
Query:  867 RPASKALLENRGLVPKRKKADANPRVKHRMKFKKALVRYHSQVPRTRDDAGNYQGEKSGIRAAVIRAQKFK 1079
            R  +  + +N+GL PKRKK D NPRVKHR KF++A +R   QV   R +   Y GE SGIRA V ++ K K
Sbjct:  430 RAITYQIAKNKGLTPKRKKLDRNPRVKHREKFRRAKIRRKGQVREVRKEEARYSGELSGIRAGVKKSIKLK 500          
BLAST of something about silencing protein 10 vs. Ensembl Xenopus
Match: apba2 (amyloid beta (A4) precursor protein-binding, family A, member 2 [Source:Xenbase;Acc:XB-GENE-952383])

HSP 1 Score: 51.6026 bits (122), Expect = 1.436e-6
Identity = 23/43 (53.49%), Postives = 30/43 (69.77%), Query Frame = 3
Query:  867 RPASKALLENRGLVPKRKKADANPRVKHRMKFKKALVRYHSQV 995
            R  +  + +N+GL PKRKK D NPRVKHR KF++A +R   QV
Sbjct:  430 RAITYQIAKNKGLTPKRKKLDRNPRVKHREKFRRAKIRRKGQV 472          
BLAST of something about silencing protein 10 vs. Ensembl Mouse
Match: Utp3 (UTP3 small subunit processome component [Source:MGI Symbol;Acc:MGI:1919230])

HSP 1 Score: 70.4774 bits (171), Expect = 9.368e-13
Identity = 35/65 (53.85%), Postives = 43/65 (66.15%), Query Frame = 3
Query:  885 LLENRGLVPKRKKADANPRVKHRMKFKKALVRYHSQVPRTRDDAGNYQGEKSGIRAAVIRAQKFK 1079
            + +NRGL P+RKK D NPRVKHR KF+KA +R   QV   R +   Y GE SGIRA V ++ K K
Sbjct:  405 IAKNRGLTPRRKKIDRNPRVKHREKFRKAKIRRRGQVREVRREEQRYSGELSGIRAGVKKSIKLK 469          
BLAST of something about silencing protein 10 vs. UniProt/SwissProt
Match: sp|Q9JI13|SAS10_MOUSE (Something about silencing protein 10 OS=Mus musculus OX=10090 GN=Utp3 PE=1 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 6.553e-12
Identity = 35/65 (53.85%), Postives = 43/65 (66.15%), Query Frame = 3
Query:  885 LLENRGLVPKRKKADANPRVKHRMKFKKALVRYHSQVPRTRDDAGNYQGEKSGIRAAVIRAQKFK 1079
            + +NRGL P+RKK D NPRVKHR KF+KA +R   QV   R +   Y GE SGIRA V ++ K K
Sbjct:  405 IAKNRGLTPRRKKIDRNPRVKHREKFRKAKIRRRGQVREVRREEQRYSGELSGIRAGVKKSIKLK 469          
BLAST of something about silencing protein 10 vs. UniProt/SwissProt
Match: sp|Q6AXX4|SAS10_RAT (Something about silencing protein 10 OS=Rattus norvegicus OX=10116 GN=Utp3 PE=1 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.178e-11
Identity = 34/65 (52.31%), Postives = 43/65 (66.15%), Query Frame = 3
Query:  885 LLENRGLVPKRKKADANPRVKHRMKFKKALVRYHSQVPRTRDDAGNYQGEKSGIRAAVIRAQKFK 1079
            + +NRGL P+RKK D NPRVKHR KF++A +R   QV   R +   Y GE SGIRA V ++ K K
Sbjct:  406 IAKNRGLTPRRKKIDRNPRVKHREKFRRAKIRRRGQVREVRREEQRYSGELSGIRAGVKKSIKLK 470          
BLAST of something about silencing protein 10 vs. UniProt/SwissProt
Match: sp|Q9NQZ2|SAS10_HUMAN (Something about silencing protein 10 OS=Homo sapiens OX=9606 GN=UTP3 PE=1 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.279e-11
Identity = 34/65 (52.31%), Postives = 43/65 (66.15%), Query Frame = 3
Query:  885 LLENRGLVPKRKKADANPRVKHRMKFKKALVRYHSQVPRTRDDAGNYQGEKSGIRAAVIRAQKFK 1079
            + +NRGL P+RKK D NPRVKHR KF++A +R   QV   R +   Y GE SGIRA V ++ K K
Sbjct:  415 IAKNRGLTPRRKKIDRNPRVKHREKFRRAKIRRRGQVREVRKEEQRYSGELSGIRAGVKKSIKLK 479          
BLAST of something about silencing protein 10 vs. UniProt/SwissProt
Match: sp|Q9I7W5|SAS10_DROME (Something about silencing protein 10 OS=Drosophila melanogaster OX=7227 GN=Sas10 PE=1 SV=2)

HSP 1 Score: 63.5438 bits (153), Expect = 9.494e-10
Identity = 32/71 (45.07%), Postives = 44/71 (61.97%), Query Frame = 3
Query:  867 RPASKALLENRGLVPKRKKADANPRVKHRMKFKKALVRYHSQVPRTRDDAGNYQGEKSGIRAAVIRAQKFK 1079
            R  +  + +N+GL P RKK   NPRVKHR K++KAL+R    V   R +   Y GE SGI+A V ++ KF+
Sbjct:  357 RGITYQMAKNKGLTPHRKKELRNPRVKHRGKYRKALIRRKGAVRTVRKELQRYGGELSGIKAGVTKSVKFR 427          
BLAST of something about silencing protein 10 vs. UniProt/SwissProt
Match: sp|Q12136|SAS10_YEAST (Something about silencing protein 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SAS10 PE=1 SV=1)

HSP 1 Score: 52.373 bits (124), Expect = 5.169e-6
Identity = 28/66 (42.42%), Postives = 43/66 (65.15%), Query Frame = 3
Query:  885 LLENRGLVPKRKKADANPRVKHRMKFKKALVRYHS-QVPRTRDDAGNYQGEKSGIRAAVIRAQKFK 1079
            +L+N+GL PKR K + N RVK R K++KA  +  S +   +   +G Y+GEK+GI+  + R+ KFK
Sbjct:  544 ILKNKGLTPKRNKDNRNSRVKKRKKYQKAQKKLKSVRAVYSGGQSGVYEGEKTGIKKGLTRSVKFK 609          
BLAST of something about silencing protein 10 vs. TrEMBL
Match: A0A3P7A2R6 (Sas10 domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS7235 PE=4 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 7.171e-14
Identity = 39/72 (54.17%), Postives = 52/72 (72.22%), Query Frame = 3
Query:  864 NRPASKALLENRGLVPKRKKADANPRVKHRMKFKKALVRYHSQVPRTRDDAGNYQGEKSGIRAAVIRAQKFK 1079
            NRP +K ++ENRG+V  R K + NPRV +R KF+KAL+RY S+VP  R +   Y GE  GIRA +IR+Q+FK
Sbjct:  372 NRPVTKEIMENRGIVKYRHKRERNPRVHNRYKFRKALIRYKSRVPEVRKEITPYAGELRGIRAHMIRSQQFK 443          
BLAST of something about silencing protein 10 vs. TrEMBL
Match: A0A0R3SQA3 (Sas10 domain-containing protein OS=Hymenolepis diminuta OX=6216 PE=4 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 7.304e-14
Identity = 39/72 (54.17%), Postives = 52/72 (72.22%), Query Frame = 3
Query:  864 NRPASKALLENRGLVPKRKKADANPRVKHRMKFKKALVRYHSQVPRTRDDAGNYQGEKSGIRAAVIRAQKFK 1079
            NRP +K ++ENRG+V  R K + NPRV +R KF+KAL+RY S+VP  R +   Y GE  GIRA +IR+Q+FK
Sbjct:  372 NRPVTKEIMENRGIVKYRHKRERNPRVHNRYKFRKALIRYKSRVPEVRKEITPYAGELRGIRAHMIRSQQFK 443          
BLAST of something about silencing protein 10 vs. TrEMBL
Match: A0A564YFH5 (Sas10 domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS5688 PE=4 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 7.955e-14
Identity = 39/72 (54.17%), Postives = 52/72 (72.22%), Query Frame = 3
Query:  864 NRPASKALLENRGLVPKRKKADANPRVKHRMKFKKALVRYHSQVPRTRDDAGNYQGEKSGIRAAVIRAQKFK 1079
            NRP +K ++ENRG+V  R K + NPRV +R KF+KAL+RY S+VP  R +   Y GE  GIRA +IR+Q+FK
Sbjct:  377 NRPVTKEIMENRGIVKYRHKRERNPRVHNRYKFRKALIRYKSRVPEVRKEITPYAGELRGIRAHMIRSQQFK 448          
BLAST of something about silencing protein 10 vs. TrEMBL
Match: A0A3S4ZWK7 (Sas10 domain-containing protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS7255 PE=4 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 1.389e-13
Identity = 38/72 (52.78%), Postives = 49/72 (68.06%), Query Frame = 3
Query:  861 DNRPASKALLENRGLVPKRKKADANPRVKHRMKFKKALVRYHSQVPRTRDDAGNYQGEKSGIRAAVIRAQKF 1076
            +NRP S+ + ENRGLV  R K + NPRV  R K+KKA +RY S++P  R +   Y GE  GIRA +IR+QKF
Sbjct:   73 ENRPMSRMMFENRGLVKYRHKRERNPRVHLRYKYKKATIRYRSRIPPVRKEDKPYSGEARGIRANLIRSQKF 144          
BLAST of something about silencing protein 10 vs. TrEMBL
Match: A0A0R3T674 (Sas10 domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS2561 PE=4 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 2.860e-13
Identity = 37/72 (51.39%), Postives = 52/72 (72.22%), Query Frame = 3
Query:  864 NRPASKALLENRGLVPKRKKADANPRVKHRMKFKKALVRYHSQVPRTRDDAGNYQGEKSGIRAAVIRAQKFK 1079
            NRP +K ++ENRG++  R K + NPRV +R K+KKAL+RY S+VP  R +   Y GE  GIRA ++R+Q+FK
Sbjct:  378 NRPVTKEIMENRGIIKYRHKRERNPRVHNRYKYKKALIRYKSRVPEVRKEITPYAGELRGIRAHMVRSQQFK 449          
BLAST of something about silencing protein 10 vs. Ensembl Cavefish
Match: utp3 (UTP3 small subunit processome component [Source:ZFIN;Acc:ZDB-GENE-040912-163])

HSP 1 Score: 62.3882 bits (150), Expect = 2.745e-10
Identity = 31/65 (47.69%), Postives = 41/65 (63.08%), Query Frame = 3
Query:  885 LLENRGLVPKRKKADANPRVKHRMKFKKALVRYHSQVPRTRDDAGNYQGEKSGIRAAVIRAQKFK 1079
            + +N+GL  KRKK D NPRVKHR K+++A +R   QV     +   Y GE SGIRA V ++ K K
Sbjct:  337 MAKNKGLTAKRKKIDRNPRVKHREKYRRAKIRRKGQVREVMREETRYSGELSGIRAGVKKSIKLK 401          
BLAST of something about silencing protein 10 vs. Ensembl Yeast
Match: SAS10 (Subunit of U3-containing Small Subunit (SSU) processome complex; involved in production of 18S rRNA and assembly of small ribosomal subunit; disrupts silencing when overproduced; mutant has increased aneuploidy tolerance; essential gene [Source:SGD;Acc:S000002312])

HSP 1 Score: 52.373 bits (124), Expect = 7.443e-8
Identity = 28/66 (42.42%), Postives = 43/66 (65.15%), Query Frame = 3
Query:  885 LLENRGLVPKRKKADANPRVKHRMKFKKALVRYHS-QVPRTRDDAGNYQGEKSGIRAAVIRAQKFK 1079
            +L+N+GL PKR K + N RVK R K++KA  +  S +   +   +G Y+GEK+GI+  + R+ KFK
Sbjct:  544 ILKNKGLTPKRNKDNRNSRVKKRKKYQKAQKKLKSVRAVYSGGQSGVYEGEKTGIKKGLTRSVKFK 609          
BLAST of something about silencing protein 10 vs. Ensembl Nematostella
Match: EDO42004 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2X4])

HSP 1 Score: 50.447 bits (119), Expect = 3.567e-7
Identity = 25/62 (40.32%), Postives = 40/62 (64.52%), Query Frame = 3
Query:  894 NRGLVPKRKKADANPRVKHRMKFKKALVRYHSQVPRTRDDAGNYQGEKSGIRAAVIRAQKFK 1079
            N+GL  ++KK + NPRVK + K+ KA+++  SQV    ++   Y GE +GIR+ + R+ K K
Sbjct:  197 NKGLTARKKKQERNPRVKLKKKYSKAVIKRKSQVRAVVNEETRYGGETTGIRSQLSRSIKIK 258          
BLAST of something about silencing protein 10 vs. Ensembl Medaka
Match: utp3 (UTP3 small subunit processome component [Source:NCBI gene;Acc:101158349])

HSP 1 Score: 69.707 bits (169), Expect = 1.174e-12
Identity = 34/65 (52.31%), Postives = 43/65 (66.15%), Query Frame = 3
Query:  885 LLENRGLVPKRKKADANPRVKHRMKFKKALVRYHSQVPRTRDDAGNYQGEKSGIRAAVIRAQKFK 1079
            + +N+GL PKRKK D NPRVKHR KF++A +R   QV   R +   Y GE SGIRA V ++ K K
Sbjct:  404 MAKNKGLTPKRKKIDRNPRVKHREKFRRAKIRRKGQVRDVRREEQRYSGEMSGIRAGVKKSTKLK 468          
BLAST of something about silencing protein 10 vs. Planmine SMEST
Match: SMESG000030757.1 (SMESG000030757.1)

HSP 1 Score: 699.508 bits (1804), Expect = 0.000e+0
Identity = 352/357 (98.60%), Postives = 355/357 (99.44%), Query Frame = 3
Query:    9 MSHSKSRKRNFRESNEFQPLTKGKLFQSDDENNCEYDWGFKKSTKPSQSNPTFNTKTSKTTDNVENVNKKMIYHKSIKPYEIKNDKEREMYMENLAKVYERSYVYIPSFYNVNGLDENIDKLIDQSFVNFFNAEIKSISILIDTLWKPLNDSYVTTKRLSENCAAYKLIVKCLPLYTKMKQLYENALEKGDTDYKSQLKAWEEEKVDTITKQFQNITGNILLEFKDSPEVIFEEMTKDSVNSIFIKMVKEDISQKQASVGTRKAKNKEDKAIXXXXXXXXXXXXDNRPASKALLENRGLVPKRKKADANPRVKHRMKFKKALVRYHSQVPRTRDDAGNYQGEKSGIRAAVIRAQKFK 1079
            MSHSKSRKRNFRESNEFQPLTKGKLFQSDDENNCEYDWGFKKSTKPSQSNPTFNTKTSKTTDNVENVNKKMIYHKSIKPYEIKNDKEREMYMENL+KVYERSYVYIPSFYNVNGLDENIDKLIDQSFVNFFNAEIKSISILIDTLWKPLNDSYVTTKRLSENCAAYKLIVKCLPLYTKMKQLYENALEKGDTDYKSQLKAWEEEKVDTITKQFQNITGNILLEFKDSPEV FEEMTKDS NSIFIK+VKEDISQKQA+VGTRKAKNKEDKAIESKPEEEPNESNDNRPASKALLENRGLVPKRKKADANPRVKHRMKFKKALVRYHSQVPRTRDDAGNYQGEKSGIRAAVIRAQKFK
Sbjct:    1 MSHSKSRKRNFRESNEFQPLTKGKLFQSDDENNCEYDWGFKKSTKPSQSNPTFNTKTSKTTDNVENVNKKMIYHKSIKPYEIKNDKEREMYMENLSKVYERSYVYIPSFYNVNGLDENIDKLIDQSFVNFFNAEIKSISILIDTLWKPLNDSYVTTKRLSENCAAYKLIVKCLPLYTKMKQLYENALEKGDTDYKSQLKAWEEEKVDTITKQFQNITGNILLEFKDSPEVTFEEMTKDSGNSIFIKLVKEDISQKQATVGTRKAKNKEDKAIESKPEEEPNESNDNRPASKALLENRGLVPKRKKADANPRVKHRMKFKKALVRYHSQVPRTRDDAGNYQGEKSGIRAAVIRAQKFK 357          
The following BLAST results are available for this feature:
BLAST of something about silencing protein 10 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
UTP32.663e-1252.31UTP3 small subunit processome component [Source:HG... [more]
back to top
BLAST of something about silencing protein 10 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of something about silencing protein 10 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Sas109.471e-1145.07gene:FBgn0029755 transcript:FBtr0070751[more]
back to top
BLAST of something about silencing protein 10 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
utp32.904e-1356.45UTP3 small subunit processome component [Source:ZF... [more]
back to top
BLAST of something about silencing protein 10 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
apba26.731e-1349.30amyloid beta (A4) precursor protein-binding, famil... [more]
apba21.436e-653.49amyloid beta (A4) precursor protein-binding, famil... [more]
back to top
BLAST of something about silencing protein 10 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Utp39.368e-1353.85UTP3 small subunit processome component [Source:MG... [more]
back to top
BLAST of something about silencing protein 10 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9JI13|SAS10_MOUSE6.553e-1253.85Something about silencing protein 10 OS=Mus muscul... [more]
sp|Q6AXX4|SAS10_RAT1.178e-1152.31Something about silencing protein 10 OS=Rattus nor... [more]
sp|Q9NQZ2|SAS10_HUMAN1.279e-1152.31Something about silencing protein 10 OS=Homo sapie... [more]
sp|Q9I7W5|SAS10_DROME9.494e-1045.07Something about silencing protein 10 OS=Drosophila... [more]
sp|Q12136|SAS10_YEAST5.169e-642.42Something about silencing protein 10 OS=Saccharomy... [more]
back to top
BLAST of something about silencing protein 10 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P7A2R67.171e-1454.17Sas10 domain-containing protein OS=Hymenolepis dim... [more]
A0A0R3SQA37.304e-1454.17Sas10 domain-containing protein OS=Hymenolepis dim... [more]
A0A564YFH57.955e-1454.17Sas10 domain-containing protein OS=Hymenolepis dim... [more]
A0A3S4ZWK71.389e-1352.78Sas10 domain-containing protein OS=Protopolystoma ... [more]
A0A0R3T6742.860e-1351.39Sas10 domain-containing protein OS=Rodentolepis na... [more]
back to top
BLAST of something about silencing protein 10 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
utp32.745e-1047.69UTP3 small subunit processome component [Source:ZF... [more]
back to top
BLAST of something about silencing protein 10 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of something about silencing protein 10 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SAS107.443e-842.42Subunit of U3-containing Small Subunit (SSU) proce... [more]
back to top
BLAST of something about silencing protein 10 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO420043.567e-740.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of something about silencing protein 10 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
utp31.174e-1252.31UTP3 small subunit processome component [Source:NC... [more]
back to top
BLAST of something about silencing protein 10 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000030757.10.000e+098.60SMESG000030757.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016808 ID=SMED30016808|Name=something about silencing protein 10|organism=Schmidtea mediterranea sexual|type=transcript|length=1183bp
AAAATTAAATGTCTCATAGTAAATCAAGAAAACGTAATTTTAGAGAATCT
AATGAATTTCAGCCACTAACAAAAGGCAAATTATTCCAATCCGACGATGA
AAATAATTGTGAATATGATTGGGGTTTCAAGAAGTCTACAAAACCATCCC
AATCCAACCCAACATTCAATACTAAGACATCTAAAACTACTGACAATGTT
GAAAATGTTAACAAAAAAATGATATATCACAAATCAATAAAACCTTATGA
AATAAAAAATGATAAAGAAAGAGAAATGTATATGGAAAATTTAGCAAAAG
TTTATGAAAGAAGTTATGTTTATATTCCATCTTTTTATAATGTAAATGGA
CTTGACGAAAACATTGATAAATTGATAGATCAATCATTTGTGAATTTTTT
CAATGCTGAAATTAAGTCAATTTCAATATTAATAGACACTTTATGGAAAC
CATTAAATGATAGTTATGTCACGACTAAGCGGTTATCAGAAAATTGCGCT
GCATATAAATTGATAGTAAAATGTCTGCCTCTATACACAAAAATGAAACA
ACTCTACGAAAATGCCTTGGAAAAAGGCGATACCGATTATAAAAGCCAGT
TAAAAGCATGGGAAGAAGAAAAGGTCGACACCATTACAAAGCAGTTTCAG
AATATAACTGGAAATATCTTATTGGAATTTAAGGATTCACCGGAGGTGAT
TTTTGAAGAAATGACAAAAGATTCTGTCAATAGCATATTCATAAAAATGG
TCAAGGAAGATATAAGCCAGAAACAGGCGAGTGTTGGAACTCGAAAAGCA
AAAAATAAAGAAGACAAAGCTATAGAATCGAAACCGGAAGAGGAACCTAA
TGAATCCAACGATAATAGGCCTGCGTCTAAAGCCTTGTTGGAAAATAGAG
GTCTCGTACCGAAACGTAAAAAGGCCGATGCCAATCCCAGAGTTAAGCAT
CGTATGAAATTCAAGAAAGCTCTTGTTAGGTACCATTCTCAGGTACCGCG
TACTCGAGACGACGCGGGAAATTACCAGGGAGAAAAATCCGGAATTAGAG
CCGCGGTTATCAGGGCTCAGAAATTCAAATAAATTTCACCCGAATTTTTT
TTAATCTTGTAACTGTAATATTTTATTAAAAATCTATTTGATTGGTTGTC
AGTTTTTTAATTTTATAAAAATTATTTTGAGTT
back to top

protein sequence of SMED30016808-orf-1

>SMED30016808-orf-1 ID=SMED30016808-orf-1|Name=SMED30016808-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=358bp
MSHSKSRKRNFRESNEFQPLTKGKLFQSDDENNCEYDWGFKKSTKPSQSN
PTFNTKTSKTTDNVENVNKKMIYHKSIKPYEIKNDKEREMYMENLAKVYE
RSYVYIPSFYNVNGLDENIDKLIDQSFVNFFNAEIKSISILIDTLWKPLN
DSYVTTKRLSENCAAYKLIVKCLPLYTKMKQLYENALEKGDTDYKSQLKA
WEEEKVDTITKQFQNITGNILLEFKDSPEVIFEEMTKDSVNSIFIKMVKE
DISQKQASVGTRKAKNKEDKAIESKPEEEPNESNDNRPASKALLENRGLV
PKRKKADANPRVKHRMKFKKALVRYHSQVPRTRDDAGNYQGEKSGIRAAV
IRAQKFK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR018972Sas10_C_dom
Vocabulary: biological process
TermDefinition
GO:0000462maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0007275multicellular organism development
GO:0007420brain development
GO:0016569covalent chromatin modification
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005730nucleolus
GO:0032040small-subunit processome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR018972Sas10 C-terminal domainPFAMPF09368Sas10coord: 284..356
e-value: 9.5E-24
score: 83.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..28
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 40..59
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 261..285
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 256..313
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 42..59
NoneNo IPR availablePANTHERPTHR13237:SF8SOMETHING ABOUT SILENCING PROTEIN 10coord: 211..357
NoneNo IPR availablePANTHERPTHR13237SOMETHING ABOUT SILENCING PROTEIN 10-RELATEDcoord: 211..357