neurexin-1 isoform X19

Overview
Nameneurexin-1 isoform X19
Smed IDSMED30016804
Length (bp)4108
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of neurexin-1 isoform X19 (SMED30016804) t-SNE clustered cells

Violin plots show distribution of expression levels for neurexin-1 isoform X19 (SMED30016804) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of neurexin-1 isoform X19 (SMED30016804) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for neurexin-1 isoform X19 (SMED30016804) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016804

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30016804SMESG000058569.1 SmedASXL_016975SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30016804SMESG000058569.1 dd_Smed_v4_13697_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30016804SMESG000058569.1 dd_Smed_v4_13697_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30016804SMESG000058569.1 dd_Smed_v4_13697_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
lateral region of the whole animalSMED30016804SMESG000058569.1 dd_Smed_v4_13697_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30016804SMESG000058569.1 dd_Smed_v6_13697_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30016804SMESG000058569.1 OX_Smed_1.0.07767ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
body wall musculatureSMED30016804SMESG000058569.1 dd_Smed_v4_13697_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of neurexin-1 isoform X19 vs. Ensembl Human
Match: NRXN1 (neurexin 1 [Source:HGNC Symbol;Acc:HGNC:8008])

HSP 1 Score: 366.311 bits (939), Expect = 1.447e-104
Identity = 317/1236 (25.65%), Postives = 552/1236 (44.66%), Query Frame = 1
Query:  226 VATFLQDAYI-YNSINIPTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAY--------QKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFL-PHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILL-------NFGRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEKKYN-FSGSSKLLSNDIIAVGKYETDKF----SRYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXX-XXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPT--KNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDNISYAGIKLLNRSNVYVENKFIPNFQSKQS----ILSEQGXXXXXXXXXXXXIVVAKSNCSNIEPLHNLDCKVSDSAGIIRPIVSYKINTVTHSQKI-TTTPDNDIYTENTKSESSTIYK-SLEINNSGVINIWLIIGFSVGGSLLLVFITCFIYRCFRKDEGSYNVEDDHIFIDPS 3837
            +ATF    Y  Y+    P  S  D I L FKT Q    + + G           Y+ + L +  + + I    L    F+     +     DN WH + V+R    + +  G  ++ + VDG +          T L S    + G  P T +D       S + N  NF GC+++++Y  ++  L++   AK     +    +   KC ++  + PI+F T  S+I+L  W   + G + F F+T E N L+ +        + ++  Q+ + DF+A E+ +  L+  ++ GSG  + K     V+DG  ++V    +  +  + ++  +         + LD   +LY+GG+PE     + P  +W+ +L  G+VGC+ D+ ++G   D+   AE ++  G+   CS +      C + PC + G C  G+NR++CDCS T Y G +C R A ++ ++G   M I +P    +E EDV+LRF + R  GI + T SR S  + RLE+     KL + L       N  +G + + + YN  D  WHT+++ RR  S+ L +DD +      +G    L    I  G     ++       F G++   TFNG+ Y +L K       E+ A  G      + P++F + +SY+ L  +  Y    L F  KT +  G +L   G   D++++E+V GYL+ +          K      ++DN WH V++ R+ S   +   +ID+     +   ++ AG  N +   +L++G   K   K+  +   V + +GF+GC++S  +N            +L++ AL  NG +E   E  +   +C+ + C + G C+QQW    CDC+MT+F G  C+    T  F+     + YK  P    +T  D LA G  T    +  + +    G   D++   + + K    + +++N+G+    + ES+  I DG YH V F R+G  A+LQ+D +  I   P G+    FN Q TI +G      +  G+          F G LSGLY+N + + +M    + A I ++    +  E   +P+  + +S    + SE        T         +      EP+     + +D       I+       +  + I    P +      T++     Y  S E+         +++G     +L ++ +   +Y+   +DEGSY+V++   +I  S
Sbjct:  283 IATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKSA-------DYVNLALKNGAVSLVIN---LGSGAFEALVEPVNGKFNDNAWHDVKVTRN-LRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPST-ADLP----GSPVSN--NFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVVAFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALLKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDIRQMAEVQSTAGVKPSCSKETAKP--CLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLELDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFHNIETGIITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGFRNIIAD-PVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHT--VKIDT-----KITTQITAGARNLDLKSDLYIGGVAKETYKS--LPKLVHAKEGFQGCLASVDLN--------GRLPDLISDALFCNGQIERGCEGPS--TTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSG-LGDYLELHIHQGK----IGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIG-----GKEQGQ---------PFQGQLSGLYYNGLKVLNMAAE-NDANIAIVGNVRLVGE---VPSSMTTESTATAMQSEMSTSIMETTTTLATSTARRGKPPTKEPIS----QTTDD------ILVASAECPSDDEDIDPCEPSSGGLANPTRAGGREPYPGSAEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYHVDESRNYISNS 1445          

HSP 2 Score: 125.561 bits (314), Expect = 3.571e-28
Identity = 205/899 (22.80%), Postives = 347/899 (38.60%), Query Frame = 1
Query:  886 TEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEI-RESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLD-ADKKIEHTNSLYKTLDTTRDLYIGGIPETL-VSFLPHSLWSGILRQGFVGCLLDISVNGDQF------DLALKAESENITGIVSGCSGDVTDKGLCANRPCMDGRCIIGYNRFICDCSRTNYTGDTC----------------------GRVAPLVKFNGFQQMIINMP-NGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGN-----KIIRSDYNCFDGNWHTLKLKR--RQLS------VILIIDDM--EKKYNFSGSSKLLSNDIIAVGKYET------DKFSRYFTGYMMHFTFNG----INYFELAKEESPS-NIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSG-------------DYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKS--SSFAFRIDSQPIGERAHI----ELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLI-------IEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKG-KTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDN 3327
             E  +     W    + ++ F  KT  +  L+ Y   E       DF    + R   L  S +         ++ TPV+DG  H V++  +  N  + +D  + K     S  + +     L++GG+P  L  + L  +L S   R+ F G + D+ VN  Q       ++ L  E  N  G     +G+  + G+C N     G C +  ++ +CDCSRT + G  C                      G+   +  F G +    ++  N  QS  +++TL F T + NG+ + T      ++D + + L+NG +++++N G G      + +   +N  D  WH +K+ R  RQ S      V + +D +     Y     + L S+D   VG   +         S  F G +    +      +    LAK+  P   I               PI+F +  S+I LPK +      + F  +T    G +L  +GK               D+  +E++ G+L LL + G+G  K      K++D  W+ V   R+      S    R      GE   +    EL  GGL  N    +F    E + +  N          G+ GCI   +++      +K + Q  +A   +  GV   C ++      C  N C + G C   W R  CDC+ T ++G  C++ +  L + D   ++  +L    +T  ++++   ++       +     D       + RL  D GR  L        I  N   G   L  +  N+ D  +H V   R G    L +DD   +     G  T + F+   T  + +     +R   SV ++     F G+L  L FN +   D+  N
Sbjct:   36 AEGQWTRFPKWNACCESEMSFQLKTRSARGLVLYFDDE----GFCDFLELILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSVRIRRQFRNTTLFIDQVEAKWVEVKSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSSQVLPVDSGEVKLDDEPPNSGGGSPCEAGEEGEGGVCLN----GGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAHLMMGDQGKSKGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGK----SADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFN--DNAWHDVKVTRNLRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVVAFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALLKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVF--PTEVWTALLN---------YGYVGCIRDLFIDG----QSKDIRQ--MAEVQSTAGVKPSCSKE--TAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSY-DGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSAD----TLRLELDAGRVKLTVNLDCIRINCNSSKGPETLF-AGYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFHNIETGIITE-----RRYLSSVPSN-----FIGHLQSLTFNGMAYIDLCKN 885          
BLAST of neurexin-1 isoform X19 vs. Ensembl Human
Match: NRXN1 (neurexin 1 [Source:HGNC Symbol;Acc:HGNC:8008])

HSP 1 Score: 357.451 bits (916), Expect = 2.073e-101
Identity = 321/1258 (25.52%), Postives = 557/1258 (44.28%), Query Frame = 1
Query:  226 VATFLQDAYI-YNSINIPTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAY--------QKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFL-PHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILL-------NFGRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEKKY-NFSGSSKLLSNDIIAVGKYETDKF----SRYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXX-XXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPT--KNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQN---DK-----TFDS--------------FSGYLSGLYFNRIPLSDMIDNISYAGIKLLNRSNVYVENKFIPNFQSKQS----ILSEQGXXXXXXXXXXXXIVVAKSNCSNIEPLHNLDCKVSDSAGIIRPIVSYKINTVTHSQKI-TTTPDNDIYTENTKSESSTIYK-SLEINNSGVINIWLIIGFSVGGSLLLVFITCFIYRCFRKDEGSYNVEDDHIFIDPS 3837
            +ATF    Y  Y+    P  S  D I L FKT Q    + + G           Y+ + L +  + + I    L    F+     +     DN WH + V+R    + +  G  ++ + VDG +          T L S    + G  P T +D       S + N  NF GC+++++Y  ++  L++   AK     +    +   KC ++  + PI+F T  S+I+L  W   + G + F F+T E N L+ +        + ++  Q+ + DF+A E+ +  L+  ++ GSG  + K     V+DG  ++V    +  +  + ++  +         + LD   +LY+GG+PE     + P  +W+ +L  G+VGC+ D+ ++G   D+   AE ++  G+   CS +      C + PC + G C  G+NR++CDCS T Y G +C R A ++ ++G   M I +P    +E EDV+LRF + R  GI + T SR S  + RLE+     KL + L       N  +G + + + YN  D  WHT+++ RR  S+ L +DD +      +G    L    I  G     ++       F G++   TFNG+ Y +L K       E+ A  G      + P++F + +SY+ L  +  Y    L F  KT +  G +L   G   D++++E+V GYL+ +          K      ++DN WH V++ R+ S   +   +ID+     +   ++ AG  N +   +L++G   K   K+  +   V + +GF+GC++S  +N            +L++ AL  NG +E   E  +   +C+ + C + G C+QQW    CDC+MT+F G  C+    T  F+     + YK  P    +T  D LA G  T    +  + +    G   D++   + + K    + +++N+G+    + ES+  I DG YH V F R+G  A+LQ+D +  I   P G      N++  I   + P+   R GR V     DK      F+S              F G LSGLY+N + + +M    + A I ++    +  E   +P+  + +S    + SE        T         +      EP+     + +D       I+       +  + I    P +      T++     Y  S E+         +++G     +L ++ +   +Y+   +DEGSY+V++   +I  S
Sbjct:  283 IATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKSA-------DYVNLALKNGAVSLVIN---LGSGAFEALVEPVNGKFNDNAWHDVKVTRN-LRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPST-ADLP----GSPVSN--NFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVVAFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALLKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDIRQMAEVQSTAGVKPSCSKETAKP--CLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLELDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFHNIETGIITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGFRNIIAD-PVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHT--VKIDT-----KITTQITAGARNLDLKSDLYIGGVAKETYKS--LPKLVHAKEGFQGCLASVDLN--------GRLPDLISDALFCNGQIERGCEGPS--TTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSG-LGDYLELHIHQGK----IGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGNND---NERLAIARQRIPY---RLGRVVDEWLLDKGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAE-NDANIAIVGNVRLVGE---VPSSMTTESTATAMQSEMSTSIMETTTTLATSTARRGKPPTKEPIS----QTTDD------ILVASAECPSDDEDIDPCEPSSGGLANPTRAGGREPYPGSAEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYHVDESRNYISNS 1475          

HSP 2 Score: 126.716 bits (317), Expect = 1.865e-28
Identity = 205/899 (22.80%), Postives = 347/899 (38.60%), Query Frame = 1
Query:  886 TEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEI-RESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLD-ADKKIEHTNSLYKTLDTTRDLYIGGIPETL-VSFLPHSLWSGILRQGFVGCLLDISVNGDQF------DLALKAESENITGIVSGCSGDVTDKGLCANRPCMDGRCIIGYNRFICDCSRTNYTGDTC----------------------GRVAPLVKFNGFQQMIINMP-NGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGN-----KIIRSDYNCFDGNWHTLKLKR--RQLS------VILIIDDM--EKKYNFSGSSKLLSNDIIAVGKYET------DKFSRYFTGYMMHFTFNG----INYFELAKEESPS-NIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSG-------------DYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKS--SSFAFRIDSQPIGERAHI----ELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLI-------IEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKG-KTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDN 3327
             E  +     W    + ++ F  KT  +  L+ Y   E       DF    + R   L  S +         ++ TPV+DG  H V++  +  N  + +D  + K     S  + +     L++GG+P  L  + L  +L S   R+ F G + D+ VN  Q       ++ L  E  N  G     +G+  + G+C N     G C +  ++ +CDCSRT + G  C                      G+   +  F G +    ++  N  QS  +++TL F T + NG+ + T      ++D + + L+NG +++++N G G      + +   +N  D  WH +K+ R  RQ S      V + +D +     Y     + L S+D   VG   +         S  F G +    +      +    LAK+  P   I               PI+F +  S+I LPK +      + F  +T    G +L  +GK               D+  +E++ G+L LL + G+G  K      K++D  W+ V   R+      S    R      GE   +    EL  GGL  N    +F    E + +  N          G+ GCI   +++      +K + Q  +A   +  GV   C ++      C  N C + G C   W R  CDC+ T ++G  C++ +  L + D   ++  +L    +T  ++++   ++       +     D       + RL  D GR  L        I  N   G   L  +  N+ D  +H V   R G    L +DD   +     G  T + F+   T  + +     +R   SV ++     F G+L  L FN +   D+  N
Sbjct:   36 AEGQWTRFPKWNACCESEMSFQLKTRSARGLVLYFDDE----GFCDFLELILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSVRIRRQFRNTTLFIDQVEAKWVEVKSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSSQVLPVDSGEVKLDDEPPNSGGGSPCEAGEEGEGGVCLN----GGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAHLMMGDQGKSKGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGK----SADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFN--DNAWHDVKVTRNLRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVVAFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALLKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVF--PTEVWTALLN---------YGYVGCIRDLFIDG----QSKDIRQ--MAEVQSTAGVKPSCSKE--TAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSY-DGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSAD----TLRLELDAGRVKLTVNLDCIRINCNSSKGPETLF-AGYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFHNIETGIITE-----RRYLSSVPSN-----FIGHLQSLTFNGMAYIDLCKN 885          
BLAST of neurexin-1 isoform X19 vs. Ensembl Human
Match: NRXN3 (neurexin 3 [Source:HGNC Symbol;Acc:HGNC:8010])

HSP 1 Score: 353.214 bits (905), Expect = 1.926e-100
Identity = 289/1074 (26.91%), Postives = 493/1074 (45.90%), Query Frame = 1
Query:  226 VATFLQDAYI-YNSINIPTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDI-----LAQAKIKRYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAY-------QKSETSQLN-QFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSF-LPHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMDGR-CIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEKKYNFSGSSKLLSNDIIAVGKYETDKF----SRYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXX-XXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFL-GSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPT--KNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDK-----TFDS--------------FSGYLSGLYFNRIPLSDM 3318
            VATF    Y+ Y+    P  S  D I L FKT Q    I + G           Y+ + L D  + + I    L    F+     +     DN WH + V+R       S   ++       +           T L S    + G  P T +D      ++      NF GC+++++Y  ++  L++     +A  K+K Y    GE+ F KC ++  + PI+F T  +YI+L  W   + G + F F+T E N L+ +       +K   SQ N + DF+A E+ +  L+  ++ GSG  + K +    +DG  ++V +  +  +  + +++ +     +   + LD   D+Y+GG+PE      LP  LW+ +L  G+VGC+ D+ ++G   ++   AE +N  G+ S CS     +  C + PC +   C  G+NRFICDC+ T Y G TC R A ++ ++G   M I MP    +E EDV+ RF++ R  G+ + T SR S  + RLE  L+ G++ +++N G+G + + +     D  WHT+++ RR  S+ L +DD   +    G    L    I  G     ++       F G++    FNG+ Y +L K       E+ A  G      + P++F + +SY+ L  +  Y    L F  KT +  G +L   G   D++ +E+V GY++ +          K   +  ++DN WH V++ R+NS + S   ++D++ +      ++  G  N +   +L++ G A+   S   ++   V S  GF+GC++S  +N            +L+  AL  +G +E   E  +   +C+ + C + G C+QQW    CDC+MT++ G +C+    T  F      ++Y        +T  D LA G  T+V     + +    G   DF+   + + K    + + +N+G+    + E    + DG YH V F RNG  A+LQ+D++      P G T    N++  +   K PF   R       +K      F++              F G LSGLY++ + + +M
Sbjct:  256 VATFRGSEYLCYDLSQNPIQSSSDEITLSFKTWQRNGLILHTGKSA-------DYVNLALKDGAVSLVIN---LGSGAFEAIVEPVNGKFNDNAWHDVKVTRNLRQVTISVDGILTTTGYTQED---------YTMLGSDDFFYVGGSPST-ADLPGSPVSN------NFMGCLKEVVYKNNDIRLELSRLARIADTKMKIY----GEVVF-KCENVATLDPINFETPEAYISLPKWNTKRMGSISFDFRTTEPNGLILFTHGKPQERKDARSQKNTKVDFFAVELLDGNLYLLLDMGSGTIKVKATQKKANDGEWYHVDIQRDGRSGTISVNSRRTPFTASGESEILDLEGDMYLGGLPENRAGLILPTELWTAMLNYGYVGCIRDLFIDGRSKNIRQLAEMQNAAGVKSSCSRMSAKQ--CDSYPCKNNAVCKDGWNRFICDCTGTGYWGRTCEREASILSYDGSMYMKIIMPMVMHTEAEDVSFRFMSQRAYGLLVATTSRDSADTLRLE--LDGGRVKLMVNLGKGPETLYAGQKLNDNEWHTVRVVRRGKSLKLTVDDDVAEGTMVGDHTRLEFHNIETGIMTEKRYISVVPSSFIGHLQSLMFNGLLYIDLCKNGDIDYCELKARFGLRNIIAD-PVTFKTKSSYLSLATLQAYTSMHLFFQFKTTSPDGFILFNSGDGNDFIAVELVKGYIHYVFDLGNGPNVIKGNSDRPLNDNQWHNVVITRDNSNTHS--LKVDTKVV-----TQVINGAKNLDLKGDLYMAGLAQGMYSNLPKL---VASRDGFQGCLASVDLN--------GRLPDLINDALHRSGQIERGCEGPS--TTCQEDSCANQGVCMQQWEGFTCDCSMTSYSGNQCNDPGATYIFGKSGGLILYTWPANDRPSTRSDRLAVGFSTTVKDGILVRIDSAPG-LGDFLQLHIEQGK----IGVVFNIGTVDISIKEERTPVNDGKYHVVRFTRNGGNATLQVDNWPVNEHYPTGNTD---NERFQMVKQKIPFKYNRPVEEWLQEKGRQLTIFNTQAQIAIGGKDKGRLFQGQLSGLYYDGLKVLNM 1265          

HSP 2 Score: 115.161 bits (287), Expect = 5.019e-25
Identity = 203/881 (23.04%), Postives = 337/881 (38.25%), Query Frame = 1
Query:  916 WAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESF--LHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFLPHSL-WSGI-LRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTD-KGLCANRPCMDGR-CIIGYNRFICDCSRTNYTGDTC----------------GRVAPLVKFNGFQQMIINMP-NGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRG--NKIIRSDYNCFDGN-WHTLKLKRRQLSVILIIDDM--EKKYNFSGSSKLLSNDIIAVGKYET------DKFSRYFTGYMMHFTF-NGINYFELAKEESPSNIEVT---ATIGDAEPTKEF-PISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSG-------------DYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRE--------NSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVG---KYPFPNQRTGRSVQNDKTF-----DSFSGYLSGLYFNRIPLSDMIDN--ISYAGIK 3348
            W  + +  L F FKT  S  LL Y           DF    + +    L FS++         +S+  V+D   H++ +  +     + LD + +          +D   DL++GG+P       P +L   G+    GF G +LD+     +  L              G  G   D +G C  RPC +G  C +      CDCS T Y G  C                 R   +  F G + +  ++  N  QS  +++TL F T + NG+ + T      ++D + + L++G +++++N G G    I+      F+ N WH +K+ R    V + +D +     Y     + L S+D   VG   +         S  F G +    + N     EL++    ++ ++      +   E      PI+F +  +YI LPK +      + F  +T    G +L  +GK               D+  +E++ G L LL + G+G  K    + K +D  W+ V + R+        NS+ + F    +S+ +     + L  GGL  N    L L   E + +  N          G+ GCI   +++      +K++ Q  LA      GV   C      Q    P  C +   C   W R  CDC  T + G  C++ +  L + D   Y+   +    +T  ++++F   +       +     D       + RL  D GR  L++  NLG G   L  +   + D  +H V   R G    L +DD                +      VG   +  F N  TG  +  +K +      SF G+L  L FN +   D+  N  I Y  +K
Sbjct:   43 WDASTRSDLSFQFKTNVSTGLLLYLDDG----GVCDFLCLSLVDGRVQLRFSMDCAETAV---LSNKQVNDSSWHFLMVSRDRLRTVLMLDGEGQSGELQPQRPYMDVVSDLFLGGVP---TDIRPSALTLDGVQAMPGFKGLILDLKYGNSEPRLL-------------GSRGVQMDAEGPCGERPCENGGICFLLDGHPTCDCSTTGYGGKLCSEGLSHLMMSEQGRSKAREENVATFRGSEYLCYDLSQNPIQSSSDEITLSFKTWQRNGLILHTGK----SADYVNLALKDGAVSLVINLGSGAFEAIVEPVNGKFNDNAWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDIRLELSRLARIADTKMKIYGEVVFKCENVATLDPINFETPEAYISLPKWNTKRMGSISFDFRTTEPNGLILFTHGKPQERKDARSQKNTKVDFFAVELLDGNLYLLLDMGSGTIKVKATQKKANDGEWYHVDIQRDGRSGTISVNSRRTPFTASGESEILDLEGDMYL--GGLPENR-AGLIL-PTELWTAMLN---------YGYVGCIRDLFIDG----RSKNIRQ--LAEMQNAAGVKSSCSRMSAKQCDSYP--CKNNAVCKDGWNRFICDCTGTGYWGRTCEREASILSY-DGSMYMKIIMPMVMHTEAEDVSFRFMSQRAYGLLVATTSRDSAD----TLRLELDGGRVKLMV--NLGKGPETLY-AGQKLNDNEWHTVRVVRRGKSLKLTVDD----------------DVAEGTMVGDHTRLEFHNIETG--IMTEKRYISVVPSSFIGHLQSLMFNGLLYIDLCKNGDIDYCELK 849          
BLAST of neurexin-1 isoform X19 vs. Ensembl Human
Match: NRXN1 (neurexin 1 [Source:HGNC Symbol;Acc:HGNC:8008])

HSP 1 Score: 353.599 bits (906), Expect = 3.631e-100
Identity = 318/1258 (25.28%), Postives = 551/1258 (43.80%), Query Frame = 1
Query:  226 VATFLQDAYI-YNSINIPTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAY--------QKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFL-PHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILL-------NFGRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEKKY-NFSGSSKLLSNDIIAVGKYETDKF----SRYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXX-XXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPT--KNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQN---DK-----TFDS--------------FSGYLSGLYFNRIPLSDMIDNISYAGIKLLNRSNVYVENKFIPNFQSKQS----ILSEQGXXXXXXXXXXXXIVVAKSNCSNIEPLHNLDCKVSDSAGIIRPIVSYKINTVTHSQKI-TTTPDNDIYTENTKSESSTIYK-SLEINNSGVINIWLIIGFSVGGSLLLVFITCFIYRCFRKDEGSYNVEDDHIFIDPS 3837
            +ATF    Y  Y+    P  S  D I L FKT Q    + + G           Y+ + L +  + + I    L    F+     +     DN WH + V+R       S   ++       +           T L S    + G  P T +D       S + N  NF GC+++++Y  ++  L++   AK     +    +   KC ++  + PI+F T  S+I+L  W   + G + F F+T E N L+ +        + ++  Q+ + DF+A E+ +  L+  ++ GSG  + K     V+DG  ++V    +  +  + ++  +         + LD   +LY+GG+PE     + P  +W+ +L  G+VGC+ D+ ++G   D+   AE ++  G+   CS +      C + PC + G C  G+NR++CDCS T Y G +C R A ++ ++G   M I +P    +E EDV+LRF + R  GI + T SR S  + RLE+     KL + L       N  +G + + + YN  D  WHT+++ RR  S+ L +DD +      +G    L    I  G     ++       F G++   TFNG+ Y +L K       E+ A  G      + P++F + +SY+ L  +  Y    L F  KT +  G +L   G   D++++E+V GYL+ +          K      ++DN WH V++ R+ S   +   +ID+     +   ++ AG  N +   +L++G   K   K+  +   V + +GF+GC++S  +N            +L++ AL  NG +E   E  +   +C+ + C + G C+QQW    CDC+MT+F G  C+    T  F+     + YK  P    +T  D LA G  T    +  + +    G   D++   + + K    + +++N+G+    + ES+  I DG YH V F R+G  A+LQ+D +  I   P G      N++  I   + P+   R GR V     DK      F+S              F G LSGLY+N + + +M    + A I ++    +  E   +P+  + +S    + SE        T         +      EP+     + +D       I+       +  + I    P +      T++     Y  S E+         +++G     +L ++ +   +Y+   +DEGSY+V++   +I  S
Sbjct:  283 IATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKSA-------DYVNLALKNGAVSLVIN---LGSGAFEALVEPVNGKFNDNAWHDVKVTRNLRQVTISVDGILTTTGYTQED---------YTMLGSDDFFYVGGSPST-ADLP----GSPVSN--NFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVVAFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALLKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDIRQMAEVQSTAGVKPSCSKETAKP--CLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLELDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFHNIETGIITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGFRNIIAD-PVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHT--VKIDT-----KITTQITAGARNLDLKSDLYIGGVAKETYKS--LPKLVHAKEGFQGCLASVDLN--------GRLPDLISDALFCNGQIERGCEGPS--TTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSG-LGDYLELHIHQGK----IGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGNND---NERLAIARQRIPY---RLGRVVDEWLLDKGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAE-NDANIAIVGNVRLVGE---VPSSMTTESTATAMQSEMSTSIMETTTTLATSTARRGKPPTKEPIS----QTTDD------ILVASAECPSDDEDIDPCEPSSGGLANPTRAGGREPYPGSAEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYHVDESRNYISNS 1467          

HSP 2 Score: 130.954 bits (328), Expect = 7.602e-30
Identity = 202/891 (22.67%), Postives = 344/891 (38.61%), Query Frame = 1
Query:  886 TEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEI-RESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLD-ADKKIEHTNSLYKTLDTTRDLYIGGIPETL-VSFLPHSLWSGILRQGFVGCLLDISVNGDQF------DLALKAESENITGIVSGCSGDVTDKGLCANRPCMDGRCIIGYNRFICDCSRTNYTGDTC----------------------GRVAPLVKFNGFQQMIINMP-NGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGN-----KIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDM--EKKYNFSGSSKLLSNDIIAVGKYET------DKFSRYFTGYMMHFTFNG----INYFELAKEESPS-NIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSG-------------DYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKS--SSFAFRIDSQPIGERAHI----ELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLI-------IEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKG-KTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDN 3327
             E  +     W    + ++ F  KT  +  L+ Y   E       DF    + R   L  S +         ++ TPV+DG  H V++  +  N  + +D  + K     S  + +     L++GG+P  L  + L  +L S   R+ F G + D+ VN  Q       ++ L  E  N  G     +G+  + G+C N     G C +  ++ +CDCSRT + G  C                      G+   +  F G +    ++  N  QS  +++TL F T + NG+ + T      ++D + + L+NG +++++N G G      + +   +N  D  WH +K+ R    V + +D +     Y     + L S+D   VG   +         S  F G +    +      +    LAK+  P   I               PI+F +  S+I LPK +      + F  +T    G +L  +GK               D+  +E++ G+L LL + G+G  K      K++D  W+ V   R+      S    R      GE   +    EL  GGL  N    +F    E + +  N          G+ GCI   +++      +K + Q  +A   +  GV   C ++      C  N C + G C   W R  CDC+ T ++G  C++ +  L + D   ++  +L    +T  ++++   ++       +     D       + RL  D GR  L        I  N   G   L  +  N+ D  +H V   R G    L +DD   +     G  T + F+   T  + +     +R   SV ++     F G+L  L FN +   D+  N
Sbjct:   36 AEGQWTRFPKWNACCESEMSFQLKTRSARGLVLYFDDE----GFCDFLELILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSVRIRRQFRNTTLFIDQVEAKWVEVKSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSSQVLPVDSGEVKLDDEPPNSGGGSPCEAGEEGEGGVCLN----GGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAHLMMGDQGKSKGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGK----SADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFN--DNAWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVVAFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALLKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVF--PTEVWTALLN---------YGYVGCIRDLFIDG----QSKDIRQ--MAEVQSTAGVKPSCSKE--TAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSY-DGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSAD----TLRLELDAGRVKLTVNLDCIRINCNSSKGPETLF-AGYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFHNIETGIITE-----RRYLSSVPSN-----FIGHLQSLTFNGMAYIDLCKN 877          
BLAST of neurexin-1 isoform X19 vs. Ensembl Human
Match: NRXN1 (neurexin 1 [Source:HGNC Symbol;Acc:HGNC:8008])

HSP 1 Score: 353.599 bits (906), Expect = 4.084e-100
Identity = 316/1257 (25.14%), Postives = 549/1257 (43.68%), Query Frame = 1
Query:  226 VATFLQDAYI-YNSINIPTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAY--------QKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFL-PHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILL-------NFGRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEKKY-NFSGSSKLLSNDIIAVGKYETDKF----SRYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXX-XXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPT--KNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQN---DK-----TFDS--------------FSGYLSGLYFNRIPLSDMIDNISYAGIKLLNRSNVYVENKFIPNFQSKQS----ILSEQGXXXXXXXXXXXXIVVAKSNCSNIEPLHNLDCKVSDSAGIIRPIVSYKINTVTHSQKITTTPDNDIYTENTKSESSTIYK-SLEINNSGVINIWLIIGFSVGGSLLLVFITCFIYRCFRKDEGSYNVEDDHIFIDPS 3837
            +ATF    Y  Y+    P  S  D I L FKT Q    + + G           Y+ + L +  + + I    L    F+     +     DN WH + V+R       S   ++       +           T L S    + G  P T +D       S + N  NF GC+++++Y  ++  L++   AK     +    +   KC ++  + PI+F T  S+I+L  W   + G + F F+T E N L+ +        + ++  Q+ + DF+A E+ +  L+  ++ GSG  + K     V+DG  ++V    +  +  + ++  +         + LD   +LY+GG+PE     + P  +W+ +L  G+VGC+ D+ ++G   D+   AE ++  G+   CS +      C + PC + G C  G+NR++CDCS T Y G +C R A ++ ++G   M I +P    +E EDV+LRF + R  GI + T SR S  + RLE+     KL + L       N  +G + + + YN  D  WHT+++ RR  S+ L +DD +      +G    L    I  G     ++       F G++   TFNG+ Y +L K       E+ A  G      + P++F + +SY+ L  +  Y    L F  KT +  G +L   G   D++++E+V GYL+ +          K      ++DN WH V++ R+ S   +   +ID+     +   ++ AG  N +   +L++G   K   K+  +   V + +GF+GC++S  +N            +L++ AL  NG +E   E  +   +C+ + C + G C+QQW    CDC+MT+F G  C+    T  F+     + YK  P    +T  D LA G  T    +  + +    G   D++   + + K    + +++N+G+    + ES+  I DG YH V F R+G  A+LQ+D +  I   P G      N++  I   + P+   R GR V     DK      F+S              F G LSGLY+N + + +M    + A I ++    +  E   +P+  + +S    + SE        T         +      EP+     + +D   +           +   +  +  P        T++     Y  S E+         +++G     +L ++ +   +Y+   +DEGSY+V++   +I  S
Sbjct:  283 IATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKSA-------DYVNLALKNGAVSLVIN---LGSGAFEALVEPVNGKFNDNAWHDVKVTRNLRQVTISVDGILTTTGYTQED---------YTMLGSDDFFYVGGSPST-ADLP----GSPVSN--NFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVVAFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALLKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDIRQMAEVQSTAGVKPSCSKETAKP--CLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLELDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFHNIETGIITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGFRNIIAD-PVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHT--VKIDT-----KITTQITAGARNLDLKSDLYIGGVAKETYKS--LPKLVHAKEGFQGCLASVDLN--------GRLPDLISDALFCNGQIERGCEGPS--TTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSG-LGDYLELHIHQGK----IGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGNND---NERLAIARQRIPY---RLGRVVDEWLLDKGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAE-NDANIAIVGNVRLVGE---VPSSMTTESTATAMQSEMSTSIMETTTTLATSTARRGKPPTKEPIS----QTTDDILVASAECPSDDEDIDPCEPSSANP--------TRAGGREPYPGSAEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYHVDESRNYISNS 1464          

HSP 2 Score: 131.339 bits (329), Expect = 5.886e-30
Identity = 202/891 (22.67%), Postives = 344/891 (38.61%), Query Frame = 1
Query:  886 TEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEI-RESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLD-ADKKIEHTNSLYKTLDTTRDLYIGGIPETL-VSFLPHSLWSGILRQGFVGCLLDISVNGDQF------DLALKAESENITGIVSGCSGDVTDKGLCANRPCMDGRCIIGYNRFICDCSRTNYTGDTC----------------------GRVAPLVKFNGFQQMIINMP-NGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGN-----KIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDM--EKKYNFSGSSKLLSNDIIAVGKYET------DKFSRYFTGYMMHFTFNG----INYFELAKEESPS-NIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSG-------------DYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKS--SSFAFRIDSQPIGERAHI----ELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLI-------IEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKG-KTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDN 3327
             E  +     W    + ++ F  KT  +  L+ Y   E       DF    + R   L  S +         ++ TPV+DG  H V++  +  N  + +D  + K     S  + +     L++GG+P  L  + L  +L S   R+ F G + D+ VN  Q       ++ L  E  N  G     +G+  + G+C N     G C +  ++ +CDCSRT + G  C                      G+   +  F G +    ++  N  QS  +++TL F T + NG+ + T      ++D + + L+NG +++++N G G      + +   +N  D  WH +K+ R    V + +D +     Y     + L S+D   VG   +         S  F G +    +      +    LAK+  P   I               PI+F +  S+I LPK +      + F  +T    G +L  +GK               D+  +E++ G+L LL + G+G  K      K++D  W+ V   R+      S    R      GE   +    EL  GGL  N    +F    E + +  N          G+ GCI   +++      +K + Q  +A   +  GV   C ++      C  N C + G C   W R  CDC+ T ++G  C++ +  L + D   ++  +L    +T  ++++   ++       +     D       + RL  D GR  L        I  N   G   L  +  N+ D  +H V   R G    L +DD   +     G  T + F+   T  + +     +R   SV ++     F G+L  L FN +   D+  N
Sbjct:   36 AEGQWTRFPKWNACCESEMSFQLKTRSARGLVLYFDDE----GFCDFLELILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSVRIRRQFRNTTLFIDQVEAKWVEVKSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSSQVLPVDSGEVKLDDEPPNSGGGSPCEAGEEGEGGVCLN----GGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAHLMMGDQGKSKGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGK----SADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFN--DNAWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVVAFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALLKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVF--PTEVWTALLN---------YGYVGCIRDLFIDG----QSKDIRQ--MAEVQSTAGVKPSCSKE--TAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSY-DGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSAD----TLRLELDAGRVKLTVNLDCIRINCNSSKGPETLF-AGYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFHNIETGIITE-----RRYLSSVPSN-----FIGHLQSLTFNGMAYIDLCKN 877          
BLAST of neurexin-1 isoform X19 vs. Ensembl Celegans
Match: nrx-1 (NeuReXin related [Source:UniProtKB/TrEMBL;Acc:I2HAJ7])

HSP 1 Score: 271.937 bits (694), Expect = 7.297e-74
Identity = 277/1079 (25.67%), Postives = 462/1079 (42.82%), Query Frame = 1
Query:  232 TFLQDAYI-YN-SINIPTV--SDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSR--KKTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANL---DILAQAKIKRYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEKKYNFSGSSKLLSNDI----------IAVGKYETDKFSRYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAE---PTKEFPISFPSVNSYIRLP--KID-MYGDFKLEFLIKTRNNKGSVLQLYGKSGDY---LILEIVHGYXXXXXXXX----XXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQP----IGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNL---LAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTS-IHFNQQRTIYVGKY----PFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDNIS 3333
            TF  D ++ Y+ S+NI     +  + + L FKT    S +FY G + S       Y+ + L D  +    K D       ++          D+ WHTI + R  +  SE+  +  + + V      +      L     IS S  F G IP        +   S   N  +F+GCM+K+ Y  D   +   ++  Q+       T G+I +   +       +SFT  +SY+TL  W     G L F F+T  S+ L+ Y      Q N  D+ AFE+ +S L   IN GSGV + + +S  VSDG  H+V+L        V +DA K    T  +   L     ++IG +P   + + P S+WS  L++G+ GC+ +I +NG    +  + E+ N TGI  GCS    +  +C   PC + G+C    N F CDCS TN+ G  C      V+ NG +  +  + +   S+ E + +RF TT   G+   T +  +G +D++ +FL + +LN+ L     N       +  D +WH L+++R    ++L +D       F   S  L N I           +V          +F G++    FNG +Y    K  S    + ++     +    T+   ISF +   Y+     KI  + G F+++F  +T   + ++L       DY     L++++G L   +       +  + K+     + D  WH V LI ++ K+      +D+      I +   +E K  G        L+ GS    +S+          S GF GCIS+  +N+        +Y++    + +    +G +  C ED           C + GRCIQ W  IRCDC++T   G+RC   S T++F+  P+ + Y+ +P +  T  +  F         + +++        D+ +  L K      L   YNLG+        +  + DGF H +   R     ++Q+D    +   PK  +  +  N Q  I +G          +R  R  +N + FDS+ G +SG+  N + + D+ +N S
Sbjct:  273 TFGGDEWVGYDVSLNISAAVRAKKENLTLTFKTVHGTSMLFYAGDEKS-------YLHVMLQDGAIIASSKFDGSDARIIRMFNSFPSQRYDDDSWHTIILERSLQMHSEEMVAIHMTLIVDGRRDEIRQYAPELD---WISNSFGFLGSIP--------KHNPSKEVNRVSFRGCMKKVRYDIDATRILLVNLADQSYGGSVVKTEGDISYSCKNPSQRSDVLSFTETSSYLTLPRWNSLSSGSLSFHFRTTSSDGLILYHG--VMQHNATDYVAFELIDSHLFMIINLGSGVVRLQTTSMKVSDGEWHHVQLDRLSRTGSVIVDAIKIDFSTPGVSANLIIDDPIFIGNVPNNSLVY-PSSVWSIALQKGYTGCIKNIRMNGVSTKIGQEFEASNSTGIELGCSLS-NELDICEPNPCQNFGKCSKNLNSFDCDCSNTNFEGKQCELEQTAVEVNGEESKVHVLAHTKVSQVEHIKIRFRTTSSRGVLFDTGA--NGKNDKITVFLNDSQLNLFLQDSSTNNTFSWGKSLSDNHWHELQVRRLGQKLLLYLD------GFWSHSIYLQNPISVEIDEVGAAFSVHSSAPPPRDEHFKGFLSKLVFNGNDYLAKTKMNSAQLSKSSSRESKGQRNVKTRIASISFTNSTGYVAFSSDKISGLTGSFRVQFKFQTLM-RSALLFFTLPKHDYDQSFRLQMLNGRLKYTYRTSGQEFHTTSPKLPHRQHLSDMRWHNV-LIYQDEKTHDHVLLVDNSSTTLIIDKIKKVESKMSG-------KLYFGSNPLGVSR---------PSNGFRGCISTLRINENAL----DLYEDADSRMKVNRGCSGPIARCIED----------ACANHGRCIQLWSSIRCDCSLTAHSGDRCQNPSTTVRFDGSPSAIFYEYAPNERPTTSKDYFVFSFRTTQPNGVLISIECAADQDYFTIFLNK----GYLNAHYNLGNRDHTTSYHTRILNDGFPHVIKISRTEANMTIQVDKLPSLRYRPKRASDLVLLNMQTRISIGAAFNTRHLDQKRLLRHRRNTEIFDSYQGEISGVNVNGLMILDLYENGS 1285          

HSP 2 Score: 87.8113 bits (216), Expect = 5.199e-17
Identity = 149/704 (21.16%), Postives = 280/704 (39.77%), Query Frame = 1
Query:  895 SYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESF--LHFSINTGSGVYQQK-------VSSTPVSDGLSHYVKLWFEDGNVEVQLDAD---KKIEHTNSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITG--IVSGCSGDVTDKGLCANRP--------CM-DGRCIIGYNRFICDCSRTNYTGDTC--GRVAPLVKFNGFQ----QMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNF-GRGNKIIRSDYNCF------DGNWHTLKLKRR---------QLSVILIIDDMEKKY-NFSGSSKLLSNDIIAVGKYETDKFSR-----YFTGYM--MHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFP------ISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQ---LYGKSGDYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSF--AFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFN 2814
            SY     WA + +  L    KT +S+ +L Y     +  N   FY+  I E    L F +   S  + Q+       +    + D   H + ++    NV+++LD     K +   + ++  +    D++IGG+P  +   LP  + S  LR+      +++       +L  +   + +T   ++        +   C ++         C+ DG C    +   CDC  +++ G  C   +    + F G +     + +N+    +++ E++TL F T     +        S     L + L++G +     F G   +IIR  +N F      D +WHT+ L+R           + + LI+D    +   ++     +SN    +G       S+      F G M  + +  +      +   +      V  T GD   + + P      +SF   +SY+ LP+ +      L F  +T ++ G +L    +   + DY+  E++  +L ++ N G+G  +     +K+ D  WH V L R +   S    A +ID    G  A++ +          + +F+G+              +   +G+ GCI +  MN    VSTK + Q   A    + G+   C   +   + C PN C + G+C +      CDC+ T F G++C+     ++ N
Sbjct:   37 SYARYPKWAHSFENSLSMELKTRQSDGMLLYTDDGGTHGN---FYSLTIVEGHIQLDFRLGDNSNEFGQRRPVNTIRIEEVRIDDDKWHTLTIFQSWENVKLELDYTLVFKILNQRSFVFGNILKNSDVFIGGLPPNM-HMLP--VMSSPLRRYARHLAVNVR------NLMYRQYPQGVTSPQLLESVGTRTNEDDHCKSKSMSSREQFVCLNDGECYSSNDGPHCDCQFSDHDGRNCEIEKNDGELTFGGDEWVGYDVSLNISAAVRAKKENLTLTFKTVHGTSMLFYAGDEKS----YLHVMLQDGAIIASSKFDGSDARIIRM-FNSFPSQRYDDDSWHTIILERSLQMHSEEMVAIHMTLIVDGRRDEIRQYAPELDWISNSFGFLGSIPKHNPSKEVNRVSFRGCMKKVRYDIDATRILLVNLADQSYGGSVVKTEGDISYSCKNPSQRSDVLSFTETSSYLTLPRWNSLSSGSLSFHFRTTSSDGLILYHGVMQHNATDYVAFELIDSHLFMIINLGSGVVRLQTTSMKVSDGEWHHVQLDRLSRTGSVIVDAIKIDFSTPGVSANLIID---------DPIFIGNVPNNSLVYPSSVWSIALQKGYTGCIKNIRMNG---VSTK-IGQEFEAS--NSTGIELGCSLSNELDI-CEPNPCQNFGKCSKNLNSFDCDCSNTNFEGKQCELEQTAVEVN 707          
BLAST of neurexin-1 isoform X19 vs. Ensembl Celegans
Match: nrx-1 (NeuReXin related [Source:UniProtKB/TrEMBL;Acc:I2HAJ7])

HSP 1 Score: 271.166 bits (692), Expect = 1.738e-73
Identity = 277/1079 (25.67%), Postives = 462/1079 (42.82%), Query Frame = 1
Query:  232 TFLQDAYI-YN-SINIPTV--SDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSR--KKTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANL---DILAQAKIKRYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEKKYNFSGSSKLLSNDI----------IAVGKYETDKFSRYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAE---PTKEFPISFPSVNSYIRLP--KID-MYGDFKLEFLIKTRNNKGSVLQLYGKSGDY---LILEIVHGYXXXXXXXX----XXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQP----IGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNL---LAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTS-IHFNQQRTIYVGKY----PFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDNIS 3333
            TF  D ++ Y+ S+NI     +  + + L FKT    S +FY G + S       Y+ + L D  +    K D       ++          D+ WHTI + R  +  SE+  +  + + V      +      L     IS S  F G IP        +   S   N  +F+GCM+K+ Y  D   +   ++  Q+       T G+I +   +       +SFT  +SY+TL  W     G L F F+T  S+ L+ Y      Q N  D+ AFE+ +S L   IN GSGV + + +S  VSDG  H+V+L        V +DA K    T  +   L     ++IG +P   + + P S+WS  L++G+ GC+ +I +NG    +  + E+ N TGI  GCS    +  +C   PC + G+C    N F CDCS TN+ G  C      V+ NG +  +  + +   S+ E + +RF TT   G+   T +  +G +D++ +FL + +LN+ L     N       +  D +WH L+++R    ++L +D       F   S  L N I           +V          +F G++    FNG +Y    K  S    + ++     +    T+   ISF +   Y+     KI  + G F+++F  +T   + ++L       DY     L++++G L   +       +  + K+     + D  WH V LI ++ K+      +D+      I +   +E K  G        L+ GS    +S+          S GF GCIS+  +N+        +Y++    + +    +G +  C ED           C + GRCIQ W  IRCDC++T   G+RC   S T++F+  P+ + Y+ +P +  T  +  F         + +++        D+ +  L K      L   YNLG+        +  + DGF H +   R     ++Q+D    +   PK  +  +  N Q  I +G          +R  R  +N + FDS+ G +SG+  N + + D+ +N S
Sbjct:  273 TFGGDEWVGYDVSLNISAAVRAKKENLTLTFKTVHGTSMLFYAGDEKS-------YLHVMLQDGAIIASSKFDGSDARIIRMFNSFPSQRYDDDSWHTIILERSLQMHSEEMVAIHMTLIVDGRRDEIRQYAPELD---WISNSFGFLGSIP--------KHNPSKEVNRVSFRGCMKKVRYDIDATRILLVNLADQSYGGSVVKTEGDISYSCKNPSQRSDVLSFTETSSYLTLPRWNSLSSGSLSFHFRTTSSDGLILYHG--VMQHNATDYVAFELIDSHLFMIINLGSGVVRLQTTSMKVSDGEWHHVQLDRLSRTGSVIVDAIKIDFSTPGVSANLIIDDPIFIGNVPNNSLVY-PSSVWSIALQKGYTGCIKNIRMNGVSTKIGQEFEASNSTGIELGCSLS-NELDICEPNPCQNFGKCSKNLNSFDCDCSNTNFEGKQCELEQTAVEVNGEESKVHVLAHTKVSQVEHIKIRFRTTSSRGVLFDTGA--NGKNDKITVFLNDSQLNLFLQDSSTNNTFSWGKSLSDNHWHELQVRRLGQKLLLYLD------GFWSHSIYLQNPISVEIDEVGAAFSVHSSAPPPRDEHFKGFLSKLVFNGNDYLAKTKMNSAQLSKSSSRESKGQRNVKTRIASISFTNSTGYVAFSSDKISGLTGSFRVQFKFQTLM-RSALLFFTLPKHDYDQSFRLQMLNGRLKYTYRTSGQEFHTTSPKLPHRQHLSDMRWHNV-LIYQDEKTHDHVLLVDNSSTTLIIDKIKKVESKMSG-------KLYFGSNPLGVSR---------PSNGFRGCISTLRINENAL----DLYEDADSRMKVNRGCSGPIARCIED----------ACANHGRCIQLWSSIRCDCSLTAHSGDRCQNPSTTVRFDGSPSAIFYEYAPNERPTTSKDYFVFSFRTTQPNGVLISIECAADQDYFTIFLNK----GYLNAHYNLGNRDHTTSYHTRILNDGFPHVIKISRTEANMTIQVDKLPSLRYRPKRASDLVLLNMQTRISIGAAFNTRHLDQKRLLRHRRNTEIFDSYQGEISGVNVNGLMILDLYENGS 1285          

HSP 2 Score: 87.4261 bits (215), Expect = 7.277e-17
Identity = 149/704 (21.16%), Postives = 280/704 (39.77%), Query Frame = 1
Query:  895 SYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESF--LHFSINTGSGVYQQK-------VSSTPVSDGLSHYVKLWFEDGNVEVQLDAD---KKIEHTNSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITG--IVSGCSGDVTDKGLCANRP--------CM-DGRCIIGYNRFICDCSRTNYTGDTC--GRVAPLVKFNGFQ----QMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNF-GRGNKIIRSDYNCF------DGNWHTLKLKRR---------QLSVILIIDDMEKK-YNFSGSSKLLSNDIIAVGKYETDKFSR-----YFTGYM--MHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFP------ISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQ---LYGKSGDYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSF--AFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFN 2814
            SY     WA + +  L    KT +S+ +L Y     +  N   FY+  I E    L F +   S  + Q+       +    + D   H + ++    NV+++LD     K +   + ++  +    D++IGG+P  +   LP  + S  LR+      +++       +L  +   + +T   ++        +   C ++         C+ DG C    +   CDC  +++ G  C   +    + F G +     + +N+    +++ E++TL F T     +        S     L + L++G +     F G   +IIR  +N F      D +WHT+ L+R           + + LI+D    +   ++     +SN    +G       S+      F G M  + +  +      +   +      V  T GD   + + P      +SF   +SY+ LP+ +      L F  +T ++ G +L    +   + DY+  E++  +L ++ N G+G  +     +K+ D  WH V L R +   S    A +ID    G  A++ +          + +F+G+              +   +G+ GCI +  MN    VSTK + Q   A    + G+   C   +   + C PN C + G+C +      CDC+ T F G++C+     ++ N
Sbjct:   37 SYARYPKWAHSFENSLSMELKTRQSDGMLLYTDDGGTHGN---FYSLTIVEGHIQLDFRLGDNSNEFGQRRPVNTIRIEEVRIDDDKWHTLTIFQSWENVKLELDYTLVFKILNQRSFVFGNILKNSDVFIGGLPPNM-HMLP--VMSSPLRRYARHLAVNVR------NLMYRQYPQGVTSPQLLESVGTRTNEDDHCKSKSMSSREQFVCLNDGECYSSNDGPHCDCQFSDHDGRNCEIEKNDGELTFGGDEWVGYDVSLNISAAVRAKKENLTLTFKTVHGTSMLFYAGDEKS----YLHVMLQDGAIIASSKFDGSDARIIRM-FNSFPSQRYDDDSWHTIILERSLQMHSEEMVAIHMTLIVDGRRDEIRQYAPELDWISNSFGFLGSIPKHNPSKEVNRVSFRGCMKKVRYDIDATRILLVNLADQSYGGSVVKTEGDISYSCKNPSQRSDVLSFTETSSYLTLPRWNSLSSGSLSFHFRTTSSDGLILYHGVMQHNATDYVAFELIDSHLFMIINLGSGVVRLQTTSMKVSDGEWHHVQLDRLSRTGSVIVDAIKIDFSTPGVSANLIID---------DPIFIGNVPNNSLVYPSSVWSIALQKGYTGCIKNIRMNG---VSTK-IGQEFEAS--NSTGIELGCSLSNELDI-CEPNPCQNFGKCSKNLNSFDCDCSNTNFEGKQCELEQTAVEVN 707          
BLAST of neurexin-1 isoform X19 vs. Ensembl Celegans
Match: nrx-1 (NeuReXin related [Source:UniProtKB/TrEMBL;Acc:I2HAJ7])

HSP 1 Score: 270.396 bits (690), Expect = 2.488e-73
Identity = 274/1077 (25.44%), Postives = 457/1077 (42.43%), Query Frame = 1
Query:  232 TFLQDAYI-YN-SINIPTV--SDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANL---DILAQAKIKRYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEKKYNFSGSSKLLSNDI----------IAVGKYETDKFSRYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAE---PTKEFPISFPSVNSYIRLP--KID-MYGDFKLEFLIKTRNNKGSVLQLYGKSGDY---LILEIVHGYXXXXXXXX----XXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQP----IGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNL---LAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTS-IHFNQQRTIYVGKY----PFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDNIS 3333
            TF  D ++ Y+ S+NI     +  + + L FKT    S +FY G + S       Y+ + L D  +    K D       ++          D+ WHTI + R           L +  ++      +          IS S  F G IP        +   S   N  +F+GCM+K+ Y  D   +   ++  Q+       T G+I +   +       +SFT  +SY+TL  W     G L F F+T  S+ L+ Y      Q N  D+ AFE+ +S L   IN GSGV + + +S  VSDG  H+V+L        V +DA K    T  +   L     ++IG +P   + + P S+WS  L++G+ GC+ +I +NG    +  + E+ N TGI  GCS    +  +C   PC + G+C    N F CDCS TN+ G  C      V+ NG +  +  + +   S+ E + +RF TT   G+   T +  +G +D++ +FL + +LN+ L     N       +  D +WH L+++R    ++L +D       F   S  L N I           +V          +F G++    FNG +Y    K  S    + ++     +    T+   ISF +   Y+     KI  + G F+++F  +T   + ++L       DY     L++++G L   +       +  + K+     + D  WH V LI ++ K+      +D+      I +   +E K  G        L+ GS    +S+          S GF GCIS+  +N+        +Y++    + +    +G +  C ED           C + GRCIQ W  IRCDC++T   G+RC   S T++F+  P+ + Y+ +P +  T  +  F         + +++        D+ +  L K      L   YNLG+        +  + DGF H +   R     ++Q+D    +   PK  +  +  N Q  I +G          +R  R  +N + FDS+ G +SG+  N + + D+ +N S
Sbjct:  273 TFGGDEWVGYDVSLNISAAVRAKKENLTLTFKTVHGTSMLFYAGDEKS-------YLHVMLQDGAIIASSKFDGSDARIIRMFNSFPSQRYDDDSWHTIILERS----------LQMMTLIVDGRRDEIRQYAPELDWISNSFGFLGSIP--------KHNPSKEVNRVSFRGCMKKVRYDIDATRILLVNLADQSYGGSVVKTEGDISYSCKNPSQRSDVLSFTETSSYLTLPRWNSLSSGSLSFHFRTTSSDGLILYHG--VMQHNATDYVAFELIDSHLFMIINLGSGVVRLQTTSMKVSDGEWHHVQLDRLSRTGSVIVDAIKIDFSTPGVSANLIIDDPIFIGNVPNNSLVY-PSSVWSIALQKGYTGCIKNIRMNGVSTKIGQEFEASNSTGIELGCSLS-NELDICEPNPCQNFGKCSKNLNSFDCDCSNTNFEGKQCELEQTAVEVNGEESKVHVLAHTKVSQVEHIKIRFRTTSSRGVLFDTGA--NGKNDKITVFLNDSQLNLFLQDSSTNNTFSWGKSLSDNHWHELQVRRLGQKLLLYLD------GFWSHSIYLQNPISVEIDEVGAAFSVHSSAPPPRDEHFKGFLSKLVFNGNDYLAKTKMNSAQLSKSSSRESKGQRNVKTRIASISFTNSTGYVAFSSDKISGLTGSFRVQFKFQTLM-RSALLFFTLPKHDYDQSFRLQMLNGRLKYTYRTSGQEFHTTSPKLPHRQHLSDMRWHNV-LIYQDEKTHDHVLLVDNSSTTLIIDKIKKVESKMSG-------KLYFGSNPLGVSR---------PSNGFRGCISTLRINENAL----DLYEDADSRMKVNRGCSGPIARCIED----------ACANHGRCIQLWSSIRCDCSLTAHSGDRCQNPSTTVRFDGSPSAIFYEYAPNERPTTSKDYFVFSFRTTQPNGVLISIECAADQDYFTIFLNK----GYLNAHYNLGNRDHTTSYHTRILNDGFPHVIKISRTEANMTIQVDKLPSLRYRPKRASDLVLLNMQTRISIGAAFNTRHLDQKRLLRHRRNTEIFDSYQGEISGVNVNGLMILDLYENGS 1276          

HSP 2 Score: 92.8189 bits (229), Expect = 1.346e-18
Identity = 149/695 (21.44%), Postives = 279/695 (40.14%), Query Frame = 1
Query:  895 SYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESF--LHFSINTGSGVYQQK-------VSSTPVSDGLSHYVKLWFEDGNVEVQLDAD---KKIEHTNSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITG--IVSGCSGDVTDKGLCANRP--------CM-DGRCIIGYNRFICDCSRTNYTGDTCG--RVAPLVKFNGFQ----QMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNF-GRGNKIIRSDYNCF------DGNWHTLKLKRRQLSVILIIDDMEKKY-NFSGSSKLLSNDIIAVGKYETDKFSR-----YFTGYM--MHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFP------ISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQ---LYGKSGDYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSF--AFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFN 2814
            SY     WA + +  L    KT +S+ +L Y     +  N   FY+  I E    L F +   S  + Q+       +    + D   H + ++    NV+++LD     K +   + ++  +    D++IGG+P  +   LP  + S  LR+      +++       +L  +   + +T   ++        +   C ++         C+ DG C    +   CDC  +++ G  C   +    + F G +     + +N+    +++ E++TL F T     +        S     L + L++G +     F G   +IIR  +N F      D +WHT+ L+R    + LI+D    +   ++     +SN    +G       S+      F G M  + +  +      +   +      V  T GD   + + P      +SF   +SY+ LP+ +      L F  +T ++ G +L    +   + DY+  E++  +L ++ N G+G  +     +K+ D  WH V L R +   S    A +ID    G  A++ +          + +F+G+              +   +G+ GCI +  MN    VSTK + Q   A    + G+   C   +   + C PN C + G+C +      CDC+ T F G++C+     ++ N
Sbjct:   37 SYARYPKWAHSFENSLSMELKTRQSDGMLLYTDDGGTHGN---FYSLTIVEGHIQLDFRLGDNSNEFGQRRPVNTIRIEEVRIDDDKWHTLTIFQSWENVKLELDYTLVFKILNQRSFVFGNILKNSDVFIGGLPPNM-HMLP--VMSSPLRRYARHLAVNVR------NLMYRQYPQGVTSPQLLESVGTRTNEDDHCKSKSMSSREQFVCLNDGECYSSNDGPHCDCQFSDHDGRNCEIEKNDGELTFGGDEWVGYDVSLNISAAVRAKKENLTLTFKTVHGTSMLFYAGDEKS----YLHVMLQDGAIIASSKFDGSDARIIRM-FNSFPSQRYDDDSWHTIILERSLQMMTLIVDGRRDEIRQYAPELDWISNSFGFLGSIPKHNPSKEVNRVSFRGCMKKVRYDIDATRILLVNLADQSYGGSVVKTEGDISYSCKNPSQRSDVLSFTETSSYLTLPRWNSLSSGSLSFHFRTTSSDGLILYHGVMQHNATDYVAFELIDSHLFMIINLGSGVVRLQTTSMKVSDGEWHHVQLDRLSRTGSVIVDAIKIDFSTPGVSANLIID---------DPIFIGNVPNNSLVYPSSVWSIALQKGYTGCIKNIRMNG---VSTK-IGQEFEAS--NSTGIELGCSLSNELDI-CEPNPCQNFGKCSKNLNSFDCDCSNTNFEGKQCELEQTAVEVN 698          
BLAST of neurexin-1 isoform X19 vs. Ensembl Celegans
Match: nrx-1 (NeuReXin related [Source:UniProtKB/TrEMBL;Acc:I2HAJ7])

HSP 1 Score: 270.396 bits (690), Expect = 3.142e-73
Identity = 274/1077 (25.44%), Postives = 457/1077 (42.43%), Query Frame = 1
Query:  232 TFLQDAYI-YN-SINIPTV--SDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANL---DILAQAKIKRYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEKKYNFSGSSKLLSNDI----------IAVGKYETDKFSRYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAE---PTKEFPISFPSVNSYIRLP--KID-MYGDFKLEFLIKTRNNKGSVLQLYGKSGDY---LILEIVHGYXXXXXXXX----XXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQP----IGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNL---LAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTS-IHFNQQRTIYVGKY----PFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDNIS 3333
            TF  D ++ Y+ S+NI     +  + + L FKT    S +FY G + S       Y+ + L D  +    K D       ++          D+ WHTI + R           L +  ++      +          IS S  F G IP        +   S   N  +F+GCM+K+ Y  D   +   ++  Q+       T G+I +   +       +SFT  +SY+TL  W     G L F F+T  S+ L+ Y      Q N  D+ AFE+ +S L   IN GSGV + + +S  VSDG  H+V+L        V +DA K    T  +   L     ++IG +P   + + P S+WS  L++G+ GC+ +I +NG    +  + E+ N TGI  GCS    +  +C   PC + G+C    N F CDCS TN+ G  C      V+ NG +  +  + +   S+ E + +RF TT   G+   T +  +G +D++ +FL + +LN+ L     N       +  D +WH L+++R    ++L +D       F   S  L N I           +V          +F G++    FNG +Y    K  S    + ++     +    T+   ISF +   Y+     KI  + G F+++F  +T   + ++L       DY     L++++G L   +       +  + K+     + D  WH V LI ++ K+      +D+      I +   +E K  G        L+ GS    +S+          S GF GCIS+  +N+        +Y++    + +    +G +  C ED           C + GRCIQ W  IRCDC++T   G+RC   S T++F+  P+ + Y+ +P +  T  +  F         + +++        D+ +  L K      L   YNLG+        +  + DGF H +   R     ++Q+D    +   PK  +  +  N Q  I +G          +R  R  +N + FDS+ G +SG+  N + + D+ +N S
Sbjct:  273 TFGGDEWVGYDVSLNISAAVRAKKENLTLTFKTVHGTSMLFYAGDEKS-------YLHVMLQDGAIIASSKFDGSDARIIRMFNSFPSQRYDDDSWHTIILERS----------LQMMTLIVDGRRDEIRQYAPELDWISNSFGFLGSIP--------KHNPSKEVNRVSFRGCMKKVRYDIDATRILLVNLADQSYGGSVVKTEGDISYSCKNPSQRSDVLSFTETSSYLTLPRWNSLSSGSLSFHFRTTSSDGLILYHG--VMQHNATDYVAFELIDSHLFMIINLGSGVVRLQTTSMKVSDGEWHHVQLDRLSRTGSVIVDAIKIDFSTPGVSANLIIDDPIFIGNVPNNSLVY-PSSVWSIALQKGYTGCIKNIRMNGVSTKIGQEFEASNSTGIELGCSLS-NELDICEPNPCQNFGKCSKNLNSFDCDCSNTNFEGKQCELEQTAVEVNGEESKVHVLAHTKVSQVEHIKIRFRTTSSRGVLFDTGA--NGKNDKITVFLNDSQLNLFLQDSSTNNTFSWGKSLSDNHWHELQVRRLGQKLLLYLD------GFWSHSIYLQNPISVEIDEVGAAFSVHSSAPPPRDEHFKGFLSKLVFNGNDYLAKTKMNSAQLSKSSSRESKGQRNVKTRIASISFTNSTGYVAFSSDKISGLTGSFRVQFKFQTLM-RSALLFFTLPKHDYDQSFRLQMLNGRLKYTYRTSGQEFHTTSPKLPHRQHLSDMRWHNV-LIYQDEKTHDHVLLVDNSSTTLIIDKIKKVESKMSG-------KLYFGSNPLGVSR---------PSNGFRGCISTLRINENAL----DLYEDADSRMKVNRGCSGPIARCIED----------ACANHGRCIQLWSSIRCDCSLTAHSGDRCQNPSTTVRFDGSPSAIFYEYAPNERPTTSKDYFVFSFRTTQPNGVLISIECAADQDYFTIFLNK----GYLNAHYNLGNRDHTTSYHTRILNDGFPHVIKISRTEANMTIQVDKLPSLRYRPKRASDLVLLNMQTRISIGAAFNTRHLDQKRLLRHRRNTEIFDSYQGEISGVNVNGLMILDLYENGS 1276          

HSP 2 Score: 92.8189 bits (229), Expect = 1.442e-18
Identity = 149/695 (21.44%), Postives = 279/695 (40.14%), Query Frame = 1
Query:  895 SYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESF--LHFSINTGSGVYQQK-------VSSTPVSDGLSHYVKLWFEDGNVEVQLDAD---KKIEHTNSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITG--IVSGCSGDVTDKGLCANRP--------CM-DGRCIIGYNRFICDCSRTNYTGDTCG--RVAPLVKFNGFQ----QMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNF-GRGNKIIRSDYNCF------DGNWHTLKLKRRQLSVILIIDDMEKK-YNFSGSSKLLSNDIIAVGKYETDKFSR-----YFTGYM--MHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFP------ISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQ---LYGKSGDYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSF--AFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFN 2814
            SY     WA + +  L    KT +S+ +L Y     +  N   FY+  I E    L F +   S  + Q+       +    + D   H + ++    NV+++LD     K +   + ++  +    D++IGG+P  +   LP  + S  LR+      +++       +L  +   + +T   ++        +   C ++         C+ DG C    +   CDC  +++ G  C   +    + F G +     + +N+    +++ E++TL F T     +        S     L + L++G +     F G   +IIR  +N F      D +WHT+ L+R    + LI+D    +   ++     +SN    +G       S+      F G M  + +  +      +   +      V  T GD   + + P      +SF   +SY+ LP+ +      L F  +T ++ G +L    +   + DY+  E++  +L ++ N G+G  +     +K+ D  WH V L R +   S    A +ID    G  A++ +          + +F+G+              +   +G+ GCI +  MN    VSTK + Q   A    + G+   C   +   + C PN C + G+C +      CDC+ T F G++C+     ++ N
Sbjct:   37 SYARYPKWAHSFENSLSMELKTRQSDGMLLYTDDGGTHGN---FYSLTIVEGHIQLDFRLGDNSNEFGQRRPVNTIRIEEVRIDDDKWHTLTIFQSWENVKLELDYTLVFKILNQRSFVFGNILKNSDVFIGGLPPNM-HMLP--VMSSPLRRYARHLAVNVR------NLMYRQYPQGVTSPQLLESVGTRTNEDDHCKSKSMSSREQFVCLNDGECYSSNDGPHCDCQFSDHDGRNCEIEKNDGELTFGGDEWVGYDVSLNISAAVRAKKENLTLTFKTVHGTSMLFYAGDEKS----YLHVMLQDGAIIASSKFDGSDARIIRM-FNSFPSQRYDDDSWHTIILERSLQMMTLIVDGRRDEIRQYAPELDWISNSFGFLGSIPKHNPSKEVNRVSFRGCMKKVRYDIDATRILLVNLADQSYGGSVVKTEGDISYSCKNPSQRSDVLSFTETSSYLTLPRWNSLSSGSLSFHFRTTSSDGLILYHGVMQHNATDYVAFELIDSHLFMIINLGSGVVRLQTTSMKVSDGEWHHVQLDRLSRTGSVIVDAIKIDFSTPGVSANLIID---------DPIFIGNVPNNSLVYPSSVWSIALQKGYTGCIKNIRMNG---VSTK-IGQEFEAS--NSTGIELGCSLSNELDI-CEPNPCQNFGKCSKNLNSFDCDCSNTNFEGKQCELEQTAVEVN 698          
BLAST of neurexin-1 isoform X19 vs. Ensembl Celegans
Match: unc-52 (Basement membrane proteoglycan [Source:UniProtKB/Swiss-Prot;Acc:Q06561])

HSP 1 Score: 62.3882 bits (150), Expect = 3.008e-9
Identity = 42/149 (28.19%), Postives = 65/149 (43.62%), Query Frame = 1
Query:  946 FSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIE---HTNSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGILRQGFVGCLLDISVNGDQFDLALKA 1383
            F FKT + N +L +Q    +     D+ +  I    LHFS   G G     +S   V DG  H V+  FE    E Q+  D   E    +  +   L+   ++++GG+P+            G+    FVGC+ D+ +NG + DL   A
Sbjct: 3211 FKFKTEQQNGVLLWQGQRPTVQQMEDYISVGIVNGHLHFSYELGGGA-AHLISEERVDDGKEHSVR--FERKGREGQMRIDNYREVDGRSTGILAMLNVDGNIFVGGVPDI------SKATGGLFSNNFVGCIADVELNGVKLDLMATA 3350          
BLAST of neurexin-1 isoform X19 vs. Ensembl Fly
Match: Nrx-1 (gene:FBgn0038975 transcript:FBtr0334611)

HSP 1 Score: 308.916 bits (790), Expect = 1.389e-85
Identity = 268/1054 (25.43%), Postives = 468/1054 (44.40%), Query Frame = 1
Query:  274 PTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIK-HDRLPESTFKVTCVSIYSTCTDNRWHTISVSRK--KTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMI-PMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQK-SETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSF-LPHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMDG-RCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPN--GFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGNKIIRSDYNCF-DGNWHTLKLKRRQLSVILIIDDMEKKYNFSGSSKLLSNDIIAV------GKYETDKFSRY------FTGYMMHFTFNGINYFELAKEESP-------SNIEVTATIGDAEPTKEF-PISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXX-XXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSF----AFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYM-NQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKL--SPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYV-GKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDM 3318
            P VS  DAI+  F+T+Q    +FY G        G  Y+ + L D  + + +   +   E   K + V       D++WH ++V R+  + S   S  +LV  V              T+  L S  +  GG + P       +          TNF GC++K+ +S D  NL+++  AK     +        +C       P++FTT  S++ L  W   ++  + F F+T E N ++     S+  +       A E+    ++  ++ GSG  + + S   V DG  H + L     + +V +D       T      L+    +Y+GG+     S   P ++W+  LRQGFVGCL D+ ++G   D+A  A  ++   +   C        +C   PC++G  C+ G+NR ICDCS T Y G TCGR    + FNG Q M I + N  G +++ E++ +RF T+RP G+ ++T +  S + DRLEI L  G++   +      K + +  +   D NWHT++  RR  ++ L +D           + L  +  + +      G +  ++  +       F G M    FNG  Y ++ K   P       +  ++TA   ++   + +   +F S +SY+ L  +  Y    ++F  KT    G ++   G+  D++ +E+V+G+++            + +  I ++DN WH+V + R   K+ +     +F I S   G   H+EL            L++G   K +   +++   ++S  GFEGC++S  + + +  +++ +V  + L        VV  C         C  N C + G C+QQW    C+C MT++ G  C   S   +F +    + Y    +   +T  D +A G  T+   +  + +        D++   +++      + + YN+GS    L E    + D  YH V F+R G  A+LQ+DDYN    +P+   S  FN    + V GK+     R GR    ++    F+G ++GL  N++ + D+
Sbjct:  374 PIVSAQDAISFYFRTRQPNGLLFYTGH-------GTDYLNLALRDGGVSLTMGLANGKQEMHIKPSKVRF----DDHQWHKVTVHRRIQEISSITSFCRLVTVVDDVYTDHSHIAGKFTM--LSSSRVYVGGAVNPRALLGARVH---------TNFVGCLRKVEFSADTLNLNLIDLAKSGSKLIQVAGNLEYQCPSGDPQDPVTFTTRESHLVLPPWETGKQSSISFKFRTKEPNGIIVLATGSKQPRAKNPVLIAIELLNGHIYIHLDLGSGASKVRASRRRVDDGDWHDLILRRNGRDAKVSVDGVWNDFRTPGDGTILELDGHMYLGGVGPAYNSVSWPAAIWTATLRQGFVGCLRDLVLSGKAIDIAAFARVQDSASVKPSCH---VQANVCNGNPCLNGGTCLEGWNRPICDCSATLYGGPTCGRELATLAFNGSQHMTIWLGNGQGTKTQTEELVIRFKTSRPAGLLLLTSAE-SNSPDRLEIALVAGRVRASVRLSDREKNLLAGQSVLNDNNWHTIRFSRRASNLRLQVDGAPPVRGMLSETILGRHSTMEIRSVHLGGLFHAEEEIQMTSTMPNFVGQMQGLVFNGQRYLDIVKSLGPELSALPSATFKLTARFVNSPAGQPYHAATFRSKHSYVGLAMLKAYNSISIDFRFKTVEPNGLLVFNGGRRNDFVAVELVNGHIHYTFDLGDGPVTMRDKSRIHMNDNRWHQVSIRRPGPKTHTLTVDDSFEIISL-TGNNMHLELAG---------ILYIGGVFKDM--YSKLPASISSRSGFEGCLASLDLGDASPSLTSDAVVPSSL--------VVSGC----EGPTKCSQNACANRGNCVQQWNAYACECDMTSYTGPTCYDESIAYEFGNNKGMVQYTFPENAQADTEEDNIALGFITTRPDAVLLRVES--ATTQDYMELEIVEGN----IFMVYNIGSVDLPLGEIGTKVNDNAYHVVRFQRKGGNATLQLDDYNVQALTPQSHHSTVFNTMSNVQVGGKF----SRNGR----NRIERPFAGVIAGLSVNKLRILDL 1363          

HSP 2 Score: 133.65 bits (335), Expect = 5.460e-31
Identity = 199/890 (22.36%), Postives = 349/890 (39.21%), Query Frame = 1
Query:  886 TEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNS---LYKTLDTTRDLYIGGIPETLVSFLPH-SLWSGILRQGFVGCLLDISVNGDQFDLA-----------------------LKAESENITGIVSGCSGDVTDKGLCANRPCMDGR-CIIGYNRFICDCSRTNYTGDTCGR-VAPL-VKFNGFQQMIINM----PNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGNK---IIRSDYNCFDGNWHTLKLKRR--QLS-------VILIIDDMEKKY-NFSGSSKLLSNDIIAVGKYETDKFSRYFTGYMMHFTFNG-------------INYFELAKEES-----PSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVL------QLYGKSGDYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIR--ENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSS--QGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDC----PEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLII---EYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIA----SPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFN 3297
            ++ S+ T   W     G L+  FKT + N L+ Y    T     +DF+  ++ E  L    N G G  Q       + DG  H V++   D    + +D   +   T      +    +  D+Y+GG+P    S L   +L S I    F G + ++ V  DQ   +                       L A    + G+  G + D  ++    N PC  G  CI   +  IC+C    Y G  C +  AP    F G Q +  ++         S  + ++  F T +PNG+   T       +D L + L +G +++ +    G +   I  S     D  WH + + RR  ++S       ++ ++DD+   + + +G   +LS+  + VG        R   G  +H  F G             +N  +LAK  S       N+E     GD +     P++F +  S++ LP  +      + F  +T+   G ++      Q   K+   + +E+++G++ +  + G+G +K      ++DD  WH +IL R   ++K S      D +  G+   +EL           +++LG      +  +      T++  QGF GC+    ++               AI +A    V+D     P  H     C  N C +GG C++ W R  CDC+ T + G  C +   TL FN      I+  +     T  E       +   +  ++L   +    D +   L+  + RA + +   E NL +G     +S +N  D  +H + F R  +   LQ+D    +      +  G+ S    + R++++G      +     +Q   T  +F G + GL FN
Sbjct:  110 SQNSFYTFRKWYTGLNGTLELEFKTEQPNGLVLY----TDDGGTYDFFELKLVEGALRLRYNLGGGA-QIITVGRELHDGHWHKVQVLRNDEQTSLIVDGVSQQRSTKGKEFQFGKFASNSDVYVGGMPNWYSSKLALLALPSVIFEPRFRGAIRNL-VYADQPGGSTRRQEIKQQRDIKCGDVPCDHGELPARERPLRGVRGGNTTDACER----NDPCQHGGICISTDSGPICECRNLEYDGQYCEKEKAPSEATFRGTQFLSYDLGQTGAEPIVSAQDAISFYFRTRQPNGLLFYTGH----GTDYLNLALRDGGVSLTMGLANGKQEMHIKPSKVRFDDHQWHKVTVHRRIQEISSITSFCRLVTVVDDVYTDHSHIAGKFTMLSSSRVYVGGAVN---PRALLGARVHTNFVGCLRKVEFSADTLNLNLIDLAKSGSKLIQVAGNLEYQCPSGDPQD----PVTFTTRESHLVLPPWETGKQSSISFKFRTKEPNGIIVLATGSKQPRAKNPVLIAIELLNGHIYIHLDLGSGASKVRASRRRVDDGDWHDLILRRNGRDAKVSVDGVWNDFRTPGDGTILELDG---------HMYLGGVGPAYNSVSWPAAIWTATLRQGFVGCLRDLVLSGK-------------AIDIAAFARVQDSASVKPSCHVQANVCNGNPCLNGGTCLEGWNRPICDCSATLYGGPTCGRELATLAFNGSQHMTIWLGNGQGTKTQTEELVIRFKTSRPAGLLLLTSAESNSPDRLEIALVAGRVRASVRLSDREKNLLAG-----QSVLN--DNNWHTIRFSRRASNLRLQVDGAPPVRGMLSETILGRHSTM--EIRSVHLGGLFHAEEE----IQMTSTMPNFVGQMQGLVFN 943          
BLAST of neurexin-1 isoform X19 vs. Ensembl Fly
Match: Nrx-1 (gene:FBgn0038975 transcript:FBtr0334609)

HSP 1 Score: 309.301 bits (791), Expect = 1.919e-85
Identity = 270/1055 (25.59%), Postives = 473/1055 (44.83%), Query Frame = 1
Query:  274 PTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIK-HDRLPESTFKVTCVSIYSTCTDNRWHTISVSRK--KTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMI-PMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKI-KRYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQK-SETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSF-LPHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMDG-RCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPN--GFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGNKIIRSDYNCF-DGNWHTLKLKRRQLSVILIIDDMEKKYNFSGSSKLLSNDIIAV------GKYETDKFSRY------FTGYMMHFTFNGINYFELAKEESP-------SNIEVTATIGDAEPTKEF-PISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXX-XXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSF----AFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYM-NQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKL--SPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYV-GKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDM 3318
            P VS  DAI+  F+T+Q    +FY G        G  Y+ + L D  + + +   +   E   K + V       D++WH ++V R+  + S   S  +LV  V              T+  L S  +  GG + P       +          TNF GC++K+ +S D  NL+++  AK   +     G + + +C       P++FTT  S++ L  W   ++  + F F+T E N ++     S+  +       A E+    ++  ++ GSG  + + S   V DG  H + L     + +V +D       T      L+    +Y+GG+     S   P ++W+  LRQGFVGCL D+ ++G   D+A  A  ++   +   C        +C   PC++G  C+ G+NR ICDCS T Y G TCGR    + FNG Q M I + N  G +++ E++ +RF T+RP G+ ++T +  S + DRLEI L  G++   +      K + +  +   D NWHT++  RR  ++ L +D           + L  +  + +      G +  ++  +       F G M    FNG  Y ++ K   P       +  ++TA   ++   + +   +F S +SY+ L  +  Y    ++F  KT    G ++   G+  D++ +E+V+G+++            + +  I ++DN WH+V + R   K+ +     +F I S   G   H+EL   G+       L++G   K +   +++   ++S  GFEGC++S  + + +  +++ +V  + L        VV  C         C  N C + G C+QQW    C+C MT++ G  C   S   +F +    + Y    +   +T  D +A G  T+   +  + +        D++   +++      + + YN+GS    L E    + D  YH V F+R G  A+LQ+DDYN    +P+   S  FN    + V GK+     R GR    ++    F+G ++GL  N++ + D+
Sbjct:  374 PIVSAQDAISFYFRTRQPNGLLFYTGH-------GTDYLNLALRDGGVSLTMGLANGKQEMHIKPSKVRF----DDHQWHKVTVHRRIQEISSITSFCRLVTVVDDVYTDHSHIAGKFTM--LSSSRVYVGGAVNPRALLGARVH---------TNFVGCLRKVEFSADTLNLNLIDLAKSGSKLIQVAGNLEY-QCPSGDPQDPVTFTTRESHLVLPPWETGKQSSISFKFRTKEPNGIIVLATGSKQPRAKNPVLIAIELLNGHIYIHLDLGSGASKVRASRRRVDDGDWHDLILRRNGRDAKVSVDGVWNDFRTPGDGTILELDGHMYLGGVGPAYNSVSWPAAIWTATLRQGFVGCLRDLVLSGKAIDIAAFARVQDSASVKPSCH---VQANVCNGNPCLNGGTCLEGWNRPICDCSATLYGGPTCGRELATLAFNGSQHMTIWLGNGQGTKTQTEELVIRFKTSRPAGLLLLTSAE-SNSPDRLEIALVAGRVRASVRLSDREKNLLAGQSVLNDNNWHTIRFSRRASNLRLQVDGAPPVRGMLSETILGRHSTMEIRSVHLGGLFHAEEEIQMTSTMPNFVGQMQGLVFNGQRYLDIVKSLGPELSALPSATFKLTARFVNSPAGQPYHAATFRSKHSYVGLAMLKAYNSISIDFRFKTVEPNGLLVFNGGRRNDFVAVELVNGHIHYTFDLGDGPVTMRDKSRIHMNDNRWHQVSIRRPGPKTHTLTVDDSFEIISL-TGNNMHLEL--AGI-------LYIGGVFKDM--YSKLPASISSRSGFEGCLASLDLGDASPSLTSDAVVPSSL--------VVSGC----EGPTKCSQNACANRGNCVQQWNAYACECDMTSYTGPTCYDESIAYEFGNNKGMVQYTFPENAQADTEEDNIALGFITTRPDAVLLRVES--ATTQDYMELEIVEGN----IFMVYNIGSVDLPLGEIGTKVNDNAYHVVRFQRKGGNATLQLDDYNVQALTPQSHHSTVFNTMSNVQVGGKF----SRNGR----NRIERPFAGVIAGLSVNKLRILDL 1363          

HSP 2 Score: 133.65 bits (335), Expect = 7.390e-31
Identity = 202/893 (22.62%), Postives = 350/893 (39.19%), Query Frame = 1
Query:  886 TEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNS---LYKTLDTTRDLYIGGIPETLVSFLPH-SLWSGILRQGFVGCLLDISVNGDQFDLA-----------------------LKAESENITGIVSGCSGDVTDKGLCANRPCMDGR-CIIGYNRFICDCSRTNYTGDTCGR-VAPL-VKFNGFQQMIINM----PNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGNK---IIRSDYNCFDGNWHTLKLKRR--QLS-------VILIIDDMEKKY-NFSGSSKLLSNDIIAVGKYETDKFSRYFTGYMMHFTFNG-------------INYFELAKEES-----PSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVL------QLYGKSGDYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIR--ENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSS--QGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDC----PEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLII---EYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASP-KGKTS-----IHFNQQ-RTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFN 3297
            ++ S+ T   W     G L+  FKT + N L+ Y    T     +DF+  ++ E  L    N G G  Q       + DG  H V++   D    + +D   +   T      +    +  D+Y+GG+P    S L   +L S I    F G + ++ V  DQ   +                       L A    + G+  G + D  ++    N PC  G  CI   +  IC+C    Y G  C +  AP    F G Q +  ++         S  + ++  F T +PNG+   T       +D L + L +G +++ +    G +   I  S     D  WH + + RR  ++S       ++ ++DD+   + + +G   +LS+  + VG        R   G  +H  F G             +N  +LAK  S       N+E     GD +     P++F +  S++ LP  +      + F  +T+   G ++      Q   K+   + +E+++G++ +  + G+G +K      ++DD  WH +IL R   ++K S      D +  G+   +EL           +++LG      +  +      T++  QGF GC+    ++               AI +A    V+D     P  H     C  N C +GG C++ W R  CDC+ T + G  C +   TL FN      I+  +     T  E       +   +  ++L   +    D +   L+  + RA + +   E NL +G     +S +N  D  +H + F R  +   LQ+D      A P +G  S      H   + R++++G      +     +Q   T  +F G + GL FN
Sbjct:  110 SQNSFYTFRKWYTGLNGTLELEFKTEQPNGLVLY----TDDGGTYDFFELKLVEGALRLRYNLGGGA-QIITVGRELHDGHWHKVQVLRNDEQTSLIVDGVSQQRSTKGKEFQFGKFASNSDVYVGGMPNWYSSKLALLALPSVIFEPRFRGAIRNL-VYADQPGGSTRRQEIKQQRDIKCGDVPCDHGELPARERPLRGVRGGNTTDACER----NDPCQHGGICISTDSGPICECRNLEYDGQYCEKEKAPSEATFRGTQFLSYDLGQTGAEPIVSAQDAISFYFRTRQPNGLLFYTGH----GTDYLNLALRDGGVSLTMGLANGKQEMHIKPSKVRFDDHQWHKVTVHRRIQEISSITSFCRLVTVVDDVYTDHSHIAGKFTMLSSSRVYVGGAVN---PRALLGARVHTNFVGCLRKVEFSADTLNLNLIDLAKSGSKLIQVAGNLEYQCPSGDPQD----PVTFTTRESHLVLPPWETGKQSSISFKFRTKEPNGIIVLATGSKQPRAKNPVLIAIELLNGHIYIHLDLGSGASKVRASRRRVDDGDWHDLILRRNGRDAKVSVDGVWNDFRTPGDGTILELDG---------HMYLGGVGPAYNSVSWPAAIWTATLRQGFVGCLRDLVLSGK-------------AIDIAAFARVQDSASVKPSCHVQANVCNGNPCLNGGTCLEGWNRPICDCSATLYGGPTCGRELATLAFNGSQHMTIWLGNGQGTKTQTEELVIRFKTSRPAGLLLLTSAESNSPDRLEIALVAGRVRASVRLSDREKNLLAG-----QSVLN--DNNWHTIRFSRRASNLRLQVDG-----APPVRGMLSETILGRHSTMEIRSVHLGGLFHAEE----EIQMTSTMPNFVGQMQGLVFN 943          
BLAST of neurexin-1 isoform X19 vs. Ensembl Fly
Match: Nrx-1 (gene:FBgn0038975 transcript:FBtr0334610)

HSP 1 Score: 308.916 bits (790), Expect = 2.656e-85
Identity = 270/1055 (25.59%), Postives = 473/1055 (44.83%), Query Frame = 1
Query:  274 PTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIK-HDRLPESTFKVTCVSIYSTCTDNRWHTISVSRK--KTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMI-PMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKI-KRYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQK-SETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSF-LPHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMDG-RCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPN--GFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGNKIIRSDYNCF-DGNWHTLKLKRRQLSVILIIDDMEKKYNFSGSSKLLSNDIIAV------GKYETDKFSRY------FTGYMMHFTFNGINYFELAKEESP-------SNIEVTATIGDAEPTKEF-PISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXX-XXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSF----AFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYM-NQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKL--SPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYV-GKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDM 3318
            P VS  DAI+  F+T+Q    +FY G        G  Y+ + L D  + + +   +   E   K + V       D++WH ++V R+  + S   S  +LV  V              T+  L S  +  GG + P       +          TNF GC++K+ +S D  NL+++  AK   +     G + + +C       P++FTT  S++ L  W   ++  + F F+T E N ++     S+  +       A E+    ++  ++ GSG  + + S   V DG  H + L     + +V +D       T      L+    +Y+GG+     S   P ++W+  LRQGFVGCL D+ ++G   D+A  A  ++   +   C        +C   PC++G  C+ G+NR ICDCS T Y G TCGR    + FNG Q M I + N  G +++ E++ +RF T+RP G+ ++T +  S + DRLEI L  G++   +      K + +  +   D NWHT++  RR  ++ L +D           + L  +  + +      G +  ++  +       F G M    FNG  Y ++ K   P       +  ++TA   ++   + +   +F S +SY+ L  +  Y    ++F  KT    G ++   G+  D++ +E+V+G+++            + +  I ++DN WH+V + R   K+ +     +F I S   G   H+EL   G+       L++G   K +   +++   ++S  GFEGC++S  + + +  +++ +V  + L        VV  C         C  N C + G C+QQW    C+C MT++ G  C   S   +F +    + Y    +   +T  D +A G  T+   +  + +        D++   +++      + + YN+GS    L E    + D  YH V F+R G  A+LQ+DDYN    +P+   S  FN    + V GK+     R GR    ++    F+G ++GL  N++ + D+
Sbjct:  374 PIVSAQDAISFYFRTRQPNGLLFYTGH-------GTDYLNLALRDGGVSLTMGLANGKQEMHIKPSKVRF----DDHQWHKVTVHRRIQEISSITSFCRLVTVVDDVYTDHSHIAGKFTM--LSSSRVYVGGAVNPRALLGARVH---------TNFVGCLRKVEFSADTLNLNLIDLAKSGSKLIQVAGNLEY-QCPSGDPQDPVTFTTRESHLVLPPWETGKQSSISFKFRTKEPNGIIVLATGSKQPRAKNPVLIAIELLNGHIYIHLDLGSGASKVRASRRRVDDGDWHDLILRRNGRDAKVSVDGVWNDFRTPGDGTILELDGHMYLGGVGPAYNSVSWPAAIWTATLRQGFVGCLRDLVLSGKAIDIAAFARVQDSASVKPSCH---VQANVCNGNPCLNGGTCLEGWNRPICDCSATLYGGPTCGRELATLAFNGSQHMTIWLGNGQGTKTQTEELVIRFKTSRPAGLLLLTSAE-SNSPDRLEIALVAGRVRASVRLSDREKNLLAGQSVLNDNNWHTIRFSRRASNLRLQVDGAPPVRGMLSETILGRHSTMEIRSVHLGGLFHAEEEIQMTSTMPNFVGQMQGLVFNGQRYLDIVKSLGPELSALPSATFKLTARFVNSPAGQPYHAATFRSKHSYVGLAMLKAYNSISIDFRFKTVEPNGLLVFNGGRRNDFVAVELVNGHIHYTFDLGDGPVTMRDKSRIHMNDNRWHQVSIRRPGPKTHTLTVDDSFEIISL-TGNNMHLEL--AGI-------LYIGGVFKDM--YSKLPASISSRSGFEGCLASLDLGDASPSLTSDAVVPSSL--------VVSGC----EGPTKCSQNACANRGNCVQQWNAYACECDMTSYTGPTCYDESIAYEFGNNKGMVQYTFPENAQADTEEDNIALGFITTRPDAVLLRVES--ATTQDYMELEIVEGN----IFMVYNIGSVDLPLGEIGTKVNDNAYHVVRFQRKGGNATLQLDDYNVQALTPQSHHSTVFNTMSNVQVGGKF----SRNGR----NRIERPFAGVIAGLSVNKLRILDL 1363          

HSP 2 Score: 133.265 bits (334), Expect = 8.729e-31
Identity = 202/893 (22.62%), Postives = 350/893 (39.19%), Query Frame = 1
Query:  886 TEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNS---LYKTLDTTRDLYIGGIPETLVSFLPH-SLWSGILRQGFVGCLLDISVNGDQFDLA-----------------------LKAESENITGIVSGCSGDVTDKGLCANRPCMDGR-CIIGYNRFICDCSRTNYTGDTCGR-VAPL-VKFNGFQQMIINM----PNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGNK---IIRSDYNCFDGNWHTLKLKRR--QLS-------VILIIDDMEKKY-NFSGSSKLLSNDIIAVGKYETDKFSRYFTGYMMHFTFNG-------------INYFELAKEES-----PSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVL------QLYGKSGDYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIR--ENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSS--QGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDC----PEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLII---EYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASP-KGKTS-----IHFNQQ-RTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFN 3297
            ++ S+ T   W     G L+  FKT + N L+ Y    T     +DF+  ++ E  L    N G G  Q       + DG  H V++   D    + +D   +   T      +    +  D+Y+GG+P    S L   +L S I    F G + ++ V  DQ   +                       L A    + G+  G + D  ++    N PC  G  CI   +  IC+C    Y G  C +  AP    F G Q +  ++         S  + ++  F T +PNG+   T       +D L + L +G +++ +    G +   I  S     D  WH + + RR  ++S       ++ ++DD+   + + +G   +LS+  + VG        R   G  +H  F G             +N  +LAK  S       N+E     GD +     P++F +  S++ LP  +      + F  +T+   G ++      Q   K+   + +E+++G++ +  + G+G +K      ++DD  WH +IL R   ++K S      D +  G+   +EL           +++LG      +  +      T++  QGF GC+    ++               AI +A    V+D     P  H     C  N C +GG C++ W R  CDC+ T + G  C +   TL FN      I+  +     T  E       +   +  ++L   +    D +   L+  + RA + +   E NL +G     +S +N  D  +H + F R  +   LQ+D      A P +G  S      H   + R++++G      +     +Q   T  +F G + GL FN
Sbjct:  110 SQNSFYTFRKWYTGLNGTLELEFKTEQPNGLVLY----TDDGGTYDFFELKLVEGALRLRYNLGGGA-QIITVGRELHDGHWHKVQVLRNDEQTSLIVDGVSQQRSTKGKEFQFGKFASNSDVYVGGMPNWYSSKLALLALPSVIFEPRFRGAIRNL-VYADQPGGSTRRQEIKQQRDIKCGDVPCDHGELPARERPLRGVRGGNTTDACER----NDPCQHGGICISTDSGPICECRNLEYDGQYCEKEKAPSEATFRGTQFLSYDLGQTGAEPIVSAQDAISFYFRTRQPNGLLFYTGH----GTDYLNLALRDGGVSLTMGLANGKQEMHIKPSKVRFDDHQWHKVTVHRRIQEISSITSFCRLVTVVDDVYTDHSHIAGKFTMLSSSRVYVGGAVN---PRALLGARVHTNFVGCLRKVEFSADTLNLNLIDLAKSGSKLIQVAGNLEYQCPSGDPQD----PVTFTTRESHLVLPPWETGKQSSISFKFRTKEPNGIIVLATGSKQPRAKNPVLIAIELLNGHIYIHLDLGSGASKVRASRRRVDDGDWHDLILRRNGRDAKVSVDGVWNDFRTPGDGTILELDG---------HMYLGGVGPAYNSVSWPAAIWTATLRQGFVGCLRDLVLSGK-------------AIDIAAFARVQDSASVKPSCHVQANVCNGNPCLNGGTCLEGWNRPICDCSATLYGGPTCGRELATLAFNGSQHMTIWLGNGQGTKTQTEELVIRFKTSRPAGLLLLTSAESNSPDRLEIALVAGRVRASVRLSDREKNLLAG-----QSVLN--DNNWHTIRFSRRASNLRLQVDG-----APPVRGMLSETILGRHSTMEIRSVHLGGLFHAEE----EIQMTSTMPNFVGQMQGLVFN 943          
BLAST of neurexin-1 isoform X19 vs. Ensembl Fly
Match: Nrx-1 (gene:FBgn0038975 transcript:FBtr0334612)

HSP 1 Score: 308.916 bits (790), Expect = 2.684e-85
Identity = 269/1054 (25.52%), Postives = 470/1054 (44.59%), Query Frame = 1
Query:  274 PTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIK-HDRLPESTFKVTCVSIYSTCTDNRWHTISVSRK--KTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMI-PMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQK-SETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSF-LPHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMDG-RCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPN--GFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGNKIIRSDYNCF-DGNWHTLKLKRRQLSVILIIDDMEKKYNFSGSSKLLSNDIIAV------GKYETDKFSRY------FTGYMMHFTFNGINYFELAKEESP-------SNIEVTATIGDAEPTKEF-PISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXX-XXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSF----AFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYM-NQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKL--SPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYV-GKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDM 3318
            P VS  DAI+  F+T+Q    +FY G        G  Y+ + L D  + + +   +   E   K + V       D++WH ++V R+  + S   S  +LV  V              T+  L S  +  GG + P       +          TNF GC++K+ +S D  NL+++  AK     +        +C       P++FTT  S++ L  W   ++  + F F+T E N ++     S+  +       A E+    ++  ++ GSG  + + S   V DG  H + L     + +V +D       T      L+    +Y+GG+     S   P ++W+  LRQGFVGCL D+ ++G   D+A  A  ++   +   C        +C   PC++G  C+ G+NR ICDCS T Y G TCGR    + FNG Q M I + N  G +++ E++ +RF T+RP G+ ++T +  S + DRLEI L  G++   +      K + +  +   D NWHT++  RR  ++ L +D           + L  +  + +      G +  ++  +       F G M    FNG  Y ++ K   P       +  ++TA   ++   + +   +F S +SY+ L  +  Y    ++F  KT    G ++   G+  D++ +E+V+G+++            + +  I ++DN WH+V + R   K+ +     +F I S   G   H+EL   G+       L++G   K +   +++   ++S  GFEGC++S  + + +  +++ +V  + L        VV  C         C  N C + G C+QQW    C+C MT++ G  C   S   +F +    + Y    +   +T  D +A G  T+   +  + +        D++   +++      + + YN+GS    L E    + D  YH V F+R G  A+LQ+DDYN    +P+   S  FN    + V GK+     R GR    ++    F+G ++GL  N++ + D+
Sbjct:  374 PIVSAQDAISFYFRTRQPNGLLFYTGH-------GTDYLNLALRDGGVSLTMGLANGKQEMHIKPSKVRF----DDHQWHKVTVHRRIQEISSITSFCRLVTVVDDVYTDHSHIAGKFTM--LSSSRVYVGGAVNPRALLGARVH---------TNFVGCLRKVEFSADTLNLNLIDLAKSGSKLIQVAGNLEYQCPSGDPQDPVTFTTRESHLVLPPWETGKQSSISFKFRTKEPNGIIVLATGSKQPRAKNPVLIAIELLNGHIYIHLDLGSGASKVRASRRRVDDGDWHDLILRRNGRDAKVSVDGVWNDFRTPGDGTILELDGHMYLGGVGPAYNSVSWPAAIWTATLRQGFVGCLRDLVLSGKAIDIAAFARVQDSASVKPSCH---VQANVCNGNPCLNGGTCLEGWNRPICDCSATLYGGPTCGRELATLAFNGSQHMTIWLGNGQGTKTQTEELVIRFKTSRPAGLLLLTSAE-SNSPDRLEIALVAGRVRASVRLSDREKNLLAGQSVLNDNNWHTIRFSRRASNLRLQVDGAPPVRGMLSETILGRHSTMEIRSVHLGGLFHAEEEIQMTSTMPNFVGQMQGLVFNGQRYLDIVKSLGPELSALPSATFKLTARFVNSPAGQPYHAATFRSKHSYVGLAMLKAYNSISIDFRFKTVEPNGLLVFNGGRRNDFVAVELVNGHIHYTFDLGDGPVTMRDKSRIHMNDNRWHQVSIRRPGPKTHTLTVDDSFEIISL-TGNNMHLEL--AGI-------LYIGGVFKDM--YSKLPASISSRSGFEGCLASLDLGDASPSLTSDAVVPSSL--------VVSGC----EGPTKCSQNACANRGNCVQQWNAYACECDMTSYTGPTCYDESIAYEFGNNKGMVQYTFPENAQADTEEDNIALGFITTRPDAVLLRVES--ATTQDYMELEIVEGN----IFMVYNIGSVDLPLGEIGTKVNDNAYHVVRFQRKGGNATLQLDDYNVQALTPQSHHSTVFNTMSNVQVGGKF----SRNGR----NRIERPFAGVIAGLSVNKLRILDL 1363          

HSP 2 Score: 133.265 bits (334), Expect = 9.977e-31
Identity = 202/893 (22.62%), Postives = 350/893 (39.19%), Query Frame = 1
Query:  886 TEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNS---LYKTLDTTRDLYIGGIPETLVSFLPH-SLWSGILRQGFVGCLLDISVNGDQFDLA-----------------------LKAESENITGIVSGCSGDVTDKGLCANRPCMDGR-CIIGYNRFICDCSRTNYTGDTCGR-VAPL-VKFNGFQQMIINM----PNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGNK---IIRSDYNCFDGNWHTLKLKRR--QLS-------VILIIDDMEKKY-NFSGSSKLLSNDIIAVGKYETDKFSRYFTGYMMHFTFNG-------------INYFELAKEES-----PSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVL------QLYGKSGDYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIR--ENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSS--QGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDC----PEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLII---EYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASP-KGKTS-----IHFNQQ-RTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFN 3297
            ++ S+ T   W     G L+  FKT + N L+ Y    T     +DF+  ++ E  L    N G G  Q       + DG  H V++   D    + +D   +   T      +    +  D+Y+GG+P    S L   +L S I    F G + ++ V  DQ   +                       L A    + G+  G + D  ++    N PC  G  CI   +  IC+C    Y G  C +  AP    F G Q +  ++         S  + ++  F T +PNG+   T       +D L + L +G +++ +    G +   I  S     D  WH + + RR  ++S       ++ ++DD+   + + +G   +LS+  + VG        R   G  +H  F G             +N  +LAK  S       N+E     GD +     P++F +  S++ LP  +      + F  +T+   G ++      Q   K+   + +E+++G++ +  + G+G +K      ++DD  WH +IL R   ++K S      D +  G+   +EL           +++LG      +  +      T++  QGF GC+    ++               AI +A    V+D     P  H     C  N C +GG C++ W R  CDC+ T + G  C +   TL FN      I+  +     T  E       +   +  ++L   +    D +   L+  + RA + +   E NL +G     +S +N  D  +H + F R  +   LQ+D      A P +G  S      H   + R++++G      +     +Q   T  +F G + GL FN
Sbjct:  110 SQNSFYTFRKWYTGLNGTLELEFKTEQPNGLVLY----TDDGGTYDFFELKLVEGALRLRYNLGGGA-QIITVGRELHDGHWHKVQVLRNDEQTSLIVDGVSQQRSTKGKEFQFGKFASNSDVYVGGMPNWYSSKLALLALPSVIFEPRFRGAIRNL-VYADQPGGSTRRQEIKQQRDIKCGDVPCDHGELPARERPLRGVRGGNTTDACER----NDPCQHGGICISTDSGPICECRNLEYDGQYCEKEKAPSEATFRGTQFLSYDLGQTGAEPIVSAQDAISFYFRTRQPNGLLFYTGH----GTDYLNLALRDGGVSLTMGLANGKQEMHIKPSKVRFDDHQWHKVTVHRRIQEISSITSFCRLVTVVDDVYTDHSHIAGKFTMLSSSRVYVGGAVN---PRALLGARVHTNFVGCLRKVEFSADTLNLNLIDLAKSGSKLIQVAGNLEYQCPSGDPQD----PVTFTTRESHLVLPPWETGKQSSISFKFRTKEPNGIIVLATGSKQPRAKNPVLIAIELLNGHIYIHLDLGSGASKVRASRRRVDDGDWHDLILRRNGRDAKVSVDGVWNDFRTPGDGTILELDG---------HMYLGGVGPAYNSVSWPAAIWTATLRQGFVGCLRDLVLSGK-------------AIDIAAFARVQDSASVKPSCHVQANVCNGNPCLNGGTCLEGWNRPICDCSATLYGGPTCGRELATLAFNGSQHMTIWLGNGQGTKTQTEELVIRFKTSRPAGLLLLTSAESNSPDRLEIALVAGRVRASVRLSDREKNLLAG-----QSVLN--DNNWHTIRFSRRASNLRLQVDG-----APPVRGMLSETILGRHSTMEIRSVHLGGLFHAEE----EIQMTSTMPNFVGQMQGLVFN 943          
BLAST of neurexin-1 isoform X19 vs. Ensembl Fly
Match: Nrx-1 (gene:FBgn0038975 transcript:FBtr0334608)

HSP 1 Score: 308.916 bits (790), Expect = 2.684e-85
Identity = 269/1054 (25.52%), Postives = 470/1054 (44.59%), Query Frame = 1
Query:  274 PTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIK-HDRLPESTFKVTCVSIYSTCTDNRWHTISVSRK--KTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMI-PMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQK-SETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSF-LPHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMDG-RCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPN--GFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGNKIIRSDYNCF-DGNWHTLKLKRRQLSVILIIDDMEKKYNFSGSSKLLSNDIIAV------GKYETDKFSRY------FTGYMMHFTFNGINYFELAKEESP-------SNIEVTATIGDAEPTKEF-PISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXX-XXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSF----AFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYM-NQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKL--SPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYV-GKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDM 3318
            P VS  DAI+  F+T+Q    +FY G        G  Y+ + L D  + + +   +   E   K + V       D++WH ++V R+  + S   S  +LV  V              T+  L S  +  GG + P       +          TNF GC++K+ +S D  NL+++  AK     +        +C       P++FTT  S++ L  W   ++  + F F+T E N ++     S+  +       A E+    ++  ++ GSG  + + S   V DG  H + L     + +V +D       T      L+    +Y+GG+     S   P ++W+  LRQGFVGCL D+ ++G   D+A  A  ++   +   C        +C   PC++G  C+ G+NR ICDCS T Y G TCGR    + FNG Q M I + N  G +++ E++ +RF T+RP G+ ++T +  S + DRLEI L  G++   +      K + +  +   D NWHT++  RR  ++ L +D           + L  +  + +      G +  ++  +       F G M    FNG  Y ++ K   P       +  ++TA   ++   + +   +F S +SY+ L  +  Y    ++F  KT    G ++   G+  D++ +E+V+G+++            + +  I ++DN WH+V + R   K+ +     +F I S   G   H+EL   G+       L++G   K +   +++   ++S  GFEGC++S  + + +  +++ +V  + L        VV  C         C  N C + G C+QQW    C+C MT++ G  C   S   +F +    + Y    +   +T  D +A G  T+   +  + +        D++   +++      + + YN+GS    L E    + D  YH V F+R G  A+LQ+DDYN    +P+   S  FN    + V GK+     R GR    ++    F+G ++GL  N++ + D+
Sbjct:  374 PIVSAQDAISFYFRTRQPNGLLFYTGH-------GTDYLNLALRDGGVSLTMGLANGKQEMHIKPSKVRF----DDHQWHKVTVHRRIQEISSITSFCRLVTVVDDVYTDHSHIAGKFTM--LSSSRVYVGGAVNPRALLGARVH---------TNFVGCLRKVEFSADTLNLNLIDLAKSGSKLIQVAGNLEYQCPSGDPQDPVTFTTRESHLVLPPWETGKQSSISFKFRTKEPNGIIVLATGSKQPRAKNPVLIAIELLNGHIYIHLDLGSGASKVRASRRRVDDGDWHDLILRRNGRDAKVSVDGVWNDFRTPGDGTILELDGHMYLGGVGPAYNSVSWPAAIWTATLRQGFVGCLRDLVLSGKAIDIAAFARVQDSASVKPSCH---VQANVCNGNPCLNGGTCLEGWNRPICDCSATLYGGPTCGRELATLAFNGSQHMTIWLGNGQGTKTQTEELVIRFKTSRPAGLLLLTSAE-SNSPDRLEIALVAGRVRASVRLSDREKNLLAGQSVLNDNNWHTIRFSRRASNLRLQVDGAPPVRGMLSETILGRHSTMEIRSVHLGGLFHAEEEIQMTSTMPNFVGQMQGLVFNGQRYLDIVKSLGPELSALPSATFKLTARFVNSPAGQPYHAATFRSKHSYVGLAMLKAYNSISIDFRFKTVEPNGLLVFNGGRRNDFVAVELVNGHIHYTFDLGDGPVTMRDKSRIHMNDNRWHQVSIRRPGPKTHTLTVDDSFEIISL-TGNNMHLEL--AGI-------LYIGGVFKDM--YSKLPASISSRSGFEGCLASLDLGDASPSLTSDAVVPSSL--------VVSGC----EGPTKCSQNACANRGNCVQQWNAYACECDMTSYTGPTCYDESIAYEFGNNKGMVQYTFPENAQADTEEDNIALGFITTRPDAVLLRVES--ATTQDYMELEIVEGN----IFMVYNIGSVDLPLGEIGTKVNDNAYHVVRFQRKGGNATLQLDDYNVQALTPQSHHSTVFNTMSNVQVGGKF----SRNGR----NRIERPFAGVIAGLSVNKLRILDL 1363          

HSP 2 Score: 133.265 bits (334), Expect = 9.977e-31
Identity = 202/893 (22.62%), Postives = 350/893 (39.19%), Query Frame = 1
Query:  886 TEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNS---LYKTLDTTRDLYIGGIPETLVSFLPH-SLWSGILRQGFVGCLLDISVNGDQFDLA-----------------------LKAESENITGIVSGCSGDVTDKGLCANRPCMDGR-CIIGYNRFICDCSRTNYTGDTCGR-VAPL-VKFNGFQQMIINM----PNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGNK---IIRSDYNCFDGNWHTLKLKRR--QLS-------VILIIDDMEKKY-NFSGSSKLLSNDIIAVGKYETDKFSRYFTGYMMHFTFNG-------------INYFELAKEES-----PSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVL------QLYGKSGDYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIR--ENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSS--QGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDC----PEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLII---EYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASP-KGKTS-----IHFNQQ-RTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFN 3297
            ++ S+ T   W     G L+  FKT + N L+ Y    T     +DF+  ++ E  L    N G G  Q       + DG  H V++   D    + +D   +   T      +    +  D+Y+GG+P    S L   +L S I    F G + ++ V  DQ   +                       L A    + G+  G + D  ++    N PC  G  CI   +  IC+C    Y G  C +  AP    F G Q +  ++         S  + ++  F T +PNG+   T       +D L + L +G +++ +    G +   I  S     D  WH + + RR  ++S       ++ ++DD+   + + +G   +LS+  + VG        R   G  +H  F G             +N  +LAK  S       N+E     GD +     P++F +  S++ LP  +      + F  +T+   G ++      Q   K+   + +E+++G++ +  + G+G +K      ++DD  WH +IL R   ++K S      D +  G+   +EL           +++LG      +  +      T++  QGF GC+    ++               AI +A    V+D     P  H     C  N C +GG C++ W R  CDC+ T + G  C +   TL FN      I+  +     T  E       +   +  ++L   +    D +   L+  + RA + +   E NL +G     +S +N  D  +H + F R  +   LQ+D      A P +G  S      H   + R++++G      +     +Q   T  +F G + GL FN
Sbjct:  110 SQNSFYTFRKWYTGLNGTLELEFKTEQPNGLVLY----TDDGGTYDFFELKLVEGALRLRYNLGGGA-QIITVGRELHDGHWHKVQVLRNDEQTSLIVDGVSQQRSTKGKEFQFGKFASNSDVYVGGMPNWYSSKLALLALPSVIFEPRFRGAIRNL-VYADQPGGSTRRQEIKQQRDIKCGDVPCDHGELPARERPLRGVRGGNTTDACER----NDPCQHGGICISTDSGPICECRNLEYDGQYCEKEKAPSEATFRGTQFLSYDLGQTGAEPIVSAQDAISFYFRTRQPNGLLFYTGH----GTDYLNLALRDGGVSLTMGLANGKQEMHIKPSKVRFDDHQWHKVTVHRRIQEISSITSFCRLVTVVDDVYTDHSHIAGKFTMLSSSRVYVGGAVN---PRALLGARVHTNFVGCLRKVEFSADTLNLNLIDLAKSGSKLIQVAGNLEYQCPSGDPQD----PVTFTTRESHLVLPPWETGKQSSISFKFRTKEPNGIIVLATGSKQPRAKNPVLIAIELLNGHIYIHLDLGSGASKVRASRRRVDDGDWHDLILRRNGRDAKVSVDGVWNDFRTPGDGTILELDG---------HMYLGGVGPAYNSVSWPAAIWTATLRQGFVGCLRDLVLSGK-------------AIDIAAFARVQDSASVKPSCHVQANVCNGNPCLNGGTCLEGWNRPICDCSATLYGGPTCGRELATLAFNGSQHMTIWLGNGQGTKTQTEELVIRFKTSRPAGLLLLTSAESNSPDRLEIALVAGRVRASVRLSDREKNLLAG-----QSVLN--DNNWHTIRFSRRASNLRLQVDG-----APPVRGMLSETILGRHSTMEIRSVHLGGLFHAEE----EIQMTSTMPNFVGQMQGLVFN 943          
BLAST of neurexin-1 isoform X19 vs. Ensembl Zebrafish
Match: nrxn1a (neurexin 1a [Source:NCBI gene;Acc:565531])

HSP 1 Score: 375.941 bits (964), Expect = 4.469e-108
Identity = 326/1270 (25.67%), Postives = 564/1270 (44.41%), Query Frame = 1
Query:  226 VATFLQDAYI-YNSINIPTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQ----------FDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFL-PHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEK-KYNFSGSSKLLSNDIIAVGKYETDKF----SRYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXXXXXXXXXXK-KVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPT--KNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQN-----------------------DKTFDSFSGYLSGLYFNRIPLSDMIDNISYAGIKLLNRS-----NVYVENKFIPNFQSKQSILSEQGXXXXXXXXXXXXIVVAKSNCSNIEPLHNLDCKVSDSAGIIRPIVSYKINTVTHSQ-KITTTPDNDIYTENTKSES-------------------STIYKSLEINNSGVINIWLIIGFSVGGSLLLVFITCFIYRCFRKDEGSYNVEDDHIFI 3828
            +ATF    Y  Y+    P  S  D I L FKT Q    + + G           Y+ + L +  + + I    L    F+     +     DN WH + V+R    + +  G  ++ + VDG +          T L S    + G  P T +D       S + N  NF GC+++++Y  ++  L++   AK+    +    +   KC ++  + P++F T  S+ITL  W+  + G + F F+T E N LL +   +     Q           DF+A E+ +  L+  ++ GSG  + +  +  V+DG  ++V    +  +  + +++ +   +     + LD    LY+GG+PE     + P  +W+ +L  G+VGC+ D+ ++G   D+   AE++   G+   CS +   +  C + PC++ G C  G+NR++CDCS T Y G +C R A ++ ++G + M I +P    +E EDV+LRF + R  G+ + T S+ S  + RLE  L+ G++ + +N G+G + I S  N  D  WHT+++ RR  S+ L++DD++  +   +G    L    +  G     ++       F G++   +FNG++Y +L K       E+ A IG      + P++F S +SY+ LP +  Y    L F  KT +  G +L   G   D++++E+V GYL+ + + GNG +  K      ++DN WH V++ R+ +   +   +ID+     +   +   G  N +   +L++G   K + K   +   V S +GF+GC++S  +N            +L + AL+  G VE   E  +   +C+ + C + G C+QQW    CDC+MT++ G  C+    T  F      ++Y   P    +T  D LA G  T    +  + +    G   D++  ++     R  + + +N+G+    + E+S  + DG YH V F R+G  A+LQ+DD   I   P G      N++  I   + P+   R GR V +                       +K    F G LSGLY+N              G+K+LN +     NV VE           S ++ Q              V A  N S   P                 I      T ++ Q K TTTP +D+   + +  S                   +  Y S E+         +++G     +L ++ +   +Y+   +DEGSY+V++   +I
Sbjct:  259 MATFKGSEYFCYDLSPNPIQSSSDEITLSFKTLQRNGLMLHTGKS-------ADYVNLALKNGAVSLVIN---LGSGAFEALVEPVNGKFNDNAWHDVKVTRN-LRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPST-ADLP----GSPVSN--NFMGCLKEVVYKNNDVRLELSRLAKLGDPKMKVSGVVAFKCENVATLDPVTFETPESFITLDKWSAKKAGSISFDFRTTEPNGLLLFSHGKPKPQQQKDPKSPKTLKVDFFAIEMLDGHLYLLLDMGSGTTKTRAVNKKVNDGEWYHVDFQRDGRSGTISVNSIRTPYNAPGESEILDLDDKLYLGGLPEDRAGLIFPTEVWTALLNYGYVGCVRDLFMDGQSKDIRRIAEAQRAVGVKPSCSKEPPKQ--CLSNPCLNSGTCREGWNRYVCDCSGTGYLGRSCERDATILSYDGSKFMKIQLPVVMHTEAEDVSLRFRSQRAYGVLMATTSQNSADTLRLE--LDGGRVRLTVNLGKGPETIFSGQNLNDNEWHTVRVVRRGKSLKLMVDDLQPSEGQITGDHTQLEFHNVETGIVTEKRYMPAVPSNFIGHLQGLSFNGMSYIDLCKNGDIDYCELNAMIGYRSIVAD-PVTFKSRSSYVTLPTLQAYYSMHLFFQFKTTSPDGLILYNRGDGNDFIVVELVKGYLHYVSDLGNGAHLIKGNSNTPLNDNHWHNVMISRDTNNLHT--VKIDT-----KITTQTTMGAKNLDLKGDLYVGGVAKDMYK--DLPKLVHSKEGFQGCLASVDLN--------GRLPDLQSDALSTAGQVERGCEGPS--TTCQEDSCSNQGVCLQQWEGFSCDCSMTSYGGPLCNDPGTTYIFGRDGGLIVYTWPPNDRPSTRADRLAVGFSTQQKDAVLVRVDSSSG-LGDYLQLQIE----RGNIKVVFNVGTDDINIEETSKFVNDGKYHIVRFTRSGGNATLQVDDLPVIERYPSGNID---NERLAIARQRIPY---RLGRVVDDWLLDKGRQLTIFNSQTTIKIGGWEKGSRPFQGQLSGLYYN--------------GLKVLNMAAEGDPNVRVEGSARLVGDMPSSSITPQSS------------VSAAGNRSETSP----------------SITDITTTTASNRQGKQTTTPQDDLLVASAECPSDDEDIDPCDPSSAHPPLPEAKGYPSPEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYHVDESRNYI 1433          

HSP 2 Score: 127.102 bits (318), Expect = 9.057e-29
Identity = 207/890 (23.26%), Postives = 350/890 (39.33%), Query Frame = 1
Query:  874 ISFT-TEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGILRQ-GFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMDGR-CIIGYNRFICDCSRTNYTGDTC-------GRVAPLV-----------KFNGFQQMIINM-PNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGN-----KIIRSDYNCFDGNWHTLKLKR--RQLS------VILIIDDM--EKKYNFSGSSKLLSNDIIAVGKYET------DKFSRYFTGYMMHFTFNG----INYFELAKEESPSNIEVTATIG-DAEPTKEF-PISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSG---------------DYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKS--SSFAFRIDSQPIGERAHIELK----AGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMN-QTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKG-KTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDN 3327
            + FT  E  +     W    + ++ F+ KT  ++ LL Y   E       DF    I    L    +          S T V+D   H V L     N  + +D + K     S  + +     L++GGIP  L S       S I  +  + G + ++ VNG          SE +     G + D+ +    A+  C++G  C I  +  ICDCS T + G  C       G +A L+            F G +    ++ PN  QS  +++TL F T + NG+ + T      ++D + + L+NG +++++N G G      + +   +N  D  WH +K+ R  RQ S      V + +D +     Y     + L S+D   VG   +         S  F G +    +      +    LAK   P  ++V+  +    E      P++F +  S+I L K        + F  +T    G +L  +GK                 D+  +E++ G+L LL + G+G  K      K++D  W+ V   R+      S  + R      GE   ++L      GGL  +    +F    E + +  N          G+ GC+   +M+ Q+K +   +  Q  +       GV   C ++   Q  C  N C + G C + W R  CDC+ T ++G  C++ +  L + D   ++  +L    +T  ++++   ++       +        Q+   + RL  D GR  L +  NLG G    + S  N+ D  +H V   R G    L +DD         G  T + F+   T  V +     +R   +V ++     F G+L GL FN +   D+  N
Sbjct:   28 MEFTGAEGQWARFPMWNACCESEMSFNMKTKSAHGLLVYFDDE----GFCDFLELLIHNGRLSLRFSIFCAEPATVFSDTAVNDSRWHAVTLRRNFKNTTLVVDEEIKWVEVKSKRRDMTVFSHLFLGGIPPELRSVALRLTSSAIKDEVPYKGWITNLRVNG----------SEPVLIGSDGVNSDICE----ADHICLNGGVCSIVNDEPICDCSETGFQGKDCSEEEAYVGGLAHLMMGDQEREEYMATFKGSEYFCYDLSPNPIQSSSDEITLSFKTLQRNGLMLHTGK----SADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFN--DNAWHDVKVTRNLRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKLGDP-KMKVSGVVAFKCENVATLDPVTFETPESFITLDKWSAKKAGSISFDFRTTEPNGLLLFSHGKPKPQQQKDPKSPKTLKVDFFAIEMLDGHLYLLLDMGSGTTKTRAVNKKVNDGEWYHVDFQRDGRSGTISVNSIRTPYNAPGESEILDLDDKLYLGGLPEDRAGLIF--PTEVWTALLN---------YGYVGCVRDLFMDGQSKDIRRIAEAQRAV-------GVKPSCSKEPPKQ--CLSNPCLNSGTCREGWNRYVCDCSGTGYLGRSCERDATILSY-DGSKFMKIQLPVVMHTEAEDVSLRFRSQRAYGVLMATT----SQNSADTLRLELDGGRVRLTV--NLGKG-PETIFSGQNLNDNEWHTVRVVRRGKSLKLMVDDLQPSEGQITGDHTQLEFHNVETGIVTE-----KRYMPAVPSN-----FIGHLQGLSFNGMSYIDLCKN 854          
BLAST of neurexin-1 isoform X19 vs. Ensembl Zebrafish
Match: nrxn1a (neurexin 1a [Source:NCBI gene;Acc:565531])

HSP 1 Score: 366.311 bits (939), Expect = 1.012e-104
Identity = 325/1279 (25.41%), Postives = 563/1279 (44.02%), Query Frame = 1
Query:  226 VATFLQDAYI-YNSINIPTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQ----------FDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFL-PHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNF---------GRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEK-KYNFSGSSKLLSNDIIAVGKYETDKF----SRYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXXXXXXXXXXK-KVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPT--KNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQN-----------------------DKTFDSFSGYLSGLYFNRIPLSDMIDNISYAGIKLLNRS-----NVYVENKFIPNFQSKQSILSEQGXXXXXXXXXXXXIVVAKSNCSNIEPLHNLDCKVSDSAGIIRPIVSYKINTVTHSQ-KITTTPDNDIYTENTKSES-------------------STIYKSLEINNSGVINIWLIIGFSVGGSLLLVFITCFIYRCFRKDEGSYNVEDDHIFI 3828
            +ATF    Y  Y+    P  S  D I L FKT Q    + + G           Y+ + L +  + + I    L    F+     +     DN WH + V+R    + +  G  ++ + VDG +          T L S    + G  P T +D       S + N  NF GC+++++Y  ++  L++   AK+    +    +   KC ++  + P++F T  S+ITL  W+  + G + F F+T E N LL +   +     Q           DF+A E+ +  L+  ++ GSG  + +  +  V+DG  ++V    +  +  + +++ +   +     + LD    LY+GG+PE     + P  +W+ +L  G+VGC+ D+ ++G   D+   AE++   G+   CS +   +  C + PC++ G C  G+NR++CDCS T Y G +C R A ++ ++G + M I +P    +E EDV+LRF + R  G+ + T S+ S  + RLE  L+ G++ + +N           +G + I S  N  D  WHT+++ RR  S+ L++DD++  +   +G    L    +  G     ++       F G++   +FNG++Y +L K       E+ A IG      + P++F S +SY+ LP +  Y    L F  KT +  G +L   G   D++++E+V GYL+ + + GNG +  K      ++DN WH V++ R+ +   +   +ID+     +   +   G  N +   +L++G   K + K   +   V S +GF+GC++S  +N            +L + AL+  G VE   E  +   +C+ + C + G C+QQW    CDC+MT++ G  C+    T  F      ++Y   P    +T  D LA G  T    +  + +    G   D++  ++     R  + + +N+G+    + E+S  + DG YH V F R+G  A+LQ+DD   I   P G      N++  I   + P+   R GR V +                       +K    F G LSGLY+N              G+K+LN +     NV VE           S ++ Q              V A  N S   P                 I      T ++ Q K TTTP +D+   + +  S                   +  Y S E+         +++G     +L ++ +   +Y+   +DEGSY+V++   +I
Sbjct:  259 MATFKGSEYFCYDLSPNPIQSSSDEITLSFKTLQRNGLMLHTGKS-------ADYVNLALKNGAVSLVIN---LGSGAFEALVEPVNGKFNDNAWHDVKVTRN-LRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPST-ADLP----GSPVSN--NFMGCLKEVVYKNNDVRLELSRLAKLGDPKMKVSGVVAFKCENVATLDPVTFETPESFITLDKWSAKKAGSISFDFRTTEPNGLLLFSHGKPKPQQQKDPKSPKTLKVDFFAIEMLDGHLYLLLDMGSGTTKTRAVNKKVNDGEWYHVDFQRDGRSGTISVNSIRTPYNAPGESEILDLDDKLYLGGLPEDRAGLIFPTEVWTALLNYGYVGCVRDLFMDGQSKDIRRIAEAQRAVGVKPSCSKEPPKQ--CLSNPCLNSGTCREGWNRYVCDCSGTGYLGRSCERDATILSYDGSKFMKIQLPVVMHTEAEDVSLRFRSQRAYGVLMATTSQNSADTLRLE--LDGGRVRLTVNLDCIRINCTTSKGPETIFSGQNLNDNEWHTVRVVRRGKSLKLMVDDLQPSEGQITGDHTQLEFHNVETGIVTEKRYMPAVPSNFIGHLQGLSFNGMSYIDLCKNGDIDYCELNAMIGYRSIVAD-PVTFKSRSSYVTLPTLQAYYSMHLFFQFKTTSPDGLILYNRGDGNDFIVVELVKGYLHYVSDLGNGAHLIKGNSNTPLNDNHWHNVMISRDTNNLHT--VKIDT-----KITTQTTMGAKNLDLKGDLYVGGVAKDMYK--DLPKLVHSKEGFQGCLASVDLN--------GRLPDLQSDALSTAGQVERGCEGPS--TTCQEDSCSNQGVCLQQWEGFSCDCSMTSYGGPLCNDPGTTYIFGRDGGLIVYTWPPNDRPSTRADRLAVGFSTQQKDAVLVRVDSSSG-LGDYLQLQIE----RGNIKVVFNVGTDDINIEETSKFVNDGKYHIVRFTRSGGNATLQVDDLPVIERYPSGNID---NERLAIARQRIPY---RLGRVVDDWLLDKGRQLTIFNSQTTIKIGGWEKGSRPFQGQLSGLYYN--------------GLKVLNMAAEGDPNVRVEGSARLVGDMPSSSITPQSS------------VSAAGNRSETSP----------------SITDITTTTASNRQGKQTTTPQDDLLVASAECPSDDEDIDPCDPSSAHPPLPEAKGYPSPEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYHVDESRNYI 1442          

HSP 2 Score: 120.553 bits (301), Expect = 7.992e-27
Identity = 204/896 (22.77%), Postives = 348/896 (38.84%), Query Frame = 1
Query:  874 ISFT-TEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGILRQ-GFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMDGR-CIIGYNRFICDCSRTNYTGDTC-------GRVAPLV-----------KFNGFQQMIINM-PNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGN-----KIIRSDYNCFDGNWHTLKLKR--RQLS------VILIIDDM--EKKYNFSGSSKLLSNDIIAVGKYET------DKFSRYFTGYMMHFTFNG----INYFELAKEESPSNIEVTATIG-DAEPTKEF-PISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSG---------------DYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKS--SSFAFRIDSQPIGERAHIELK----AGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMN-QTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNL------GSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKG-KTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDN 3327
            + FT  E  +     W    + ++ F+ KT  ++ LL Y   E       DF    I    L    +          S T V+D   H V L     N  + +D + K     S  + +     L++GGIP  L S       S I  +  + G + ++ VNG          SE +     G + D+ +    A+  C++G  C I  +  ICDCS T + G  C       G +A L+            F G +    ++ PN  QS  +++TL F T + NG+ + T      ++D + + L+NG +++++N G G      + +   +N  D  WH +K+ R  RQ S      V + +D +     Y     + L S+D   VG   +         S  F G +    +      +    LAK   P  ++V+  +    E      P++F +  S+I L K        + F  +T    G +L  +GK                 D+  +E++ G+L LL + G+G  K      K++D  W+ V   R+      S  + R      GE   ++L      GGL  +    +F    E + +  N          G+ GC+   +M+ Q+K +   +  Q  +       GV   C ++   Q  C  N C + G C + W R  CDC+ T ++G  C++ +  L + D   ++  +L    +T  ++++   ++       +        Q+   + RL  D GR  L +  +        S     + S  N+ D  +H V   R G    L +DD         G  T + F+   T  V +     +R   +V ++     F G+L GL FN +   D+  N
Sbjct:   28 MEFTGAEGQWARFPMWNACCESEMSFNMKTKSAHGLLVYFDDE----GFCDFLELLIHNGRLSLRFSIFCAEPATVFSDTAVNDSRWHAVTLRRNFKNTTLVVDEEIKWVEVKSKRRDMTVFSHLFLGGIPPELRSVALRLTSSAIKDEVPYKGWITNLRVNG----------SEPVLIGSDGVNSDICE----ADHICLNGGVCSIVNDEPICDCSETGFQGKDCSEEEAYVGGLAHLMMGDQEREEYMATFKGSEYFCYDLSPNPIQSSSDEITLSFKTLQRNGLMLHTGK----SADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFN--DNAWHDVKVTRNLRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKLGDP-KMKVSGVVAFKCENVATLDPVTFETPESFITLDKWSAKKAGSISFDFRTTEPNGLLLFSHGKPKPQQQKDPKSPKTLKVDFFAIEMLDGHLYLLLDMGSGTTKTRAVNKKVNDGEWYHVDFQRDGRSGTISVNSIRTPYNAPGESEILDLDDKLYLGGLPEDRAGLIF--PTEVWTALLN---------YGYVGCVRDLFMDGQSKDIRRIAEAQRAV-------GVKPSCSKEPPKQ--CLSNPCLNSGTCREGWNRYVCDCSGTGYLGRSCERDATILSY-DGSKFMKIQLPVVMHTEAEDVSLRFRSQRAYGVLMATT----SQNSADTLRLELDGGRVRLTVNLDCIRINCTTSKGPETIFSGQNLNDNEWHTVRVVRRGKSLKLMVDDLQPSEGQITGDHTQLEFHNVETGIVTE-----KRYMPAVPSN-----FIGHLQGLSFNGMSYIDLCKN 863          
BLAST of neurexin-1 isoform X19 vs. Ensembl Zebrafish
Match: nrxn1a (neurexin 1a [Source:NCBI gene;Acc:565531])

HSP 1 Score: 366.311 bits (939), Expect = 1.142e-104
Identity = 325/1279 (25.41%), Postives = 563/1279 (44.02%), Query Frame = 1
Query:  226 VATFLQDAYI-YNSINIPTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQ----------FDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFL-PHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNF---------GRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEK-KYNFSGSSKLLSNDIIAVGKYETDKF----SRYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXXXXXXXXXXK-KVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPT--KNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQN-----------------------DKTFDSFSGYLSGLYFNRIPLSDMIDNISYAGIKLLNRS-----NVYVENKFIPNFQSKQSILSEQGXXXXXXXXXXXXIVVAKSNCSNIEPLHNLDCKVSDSAGIIRPIVSYKINTVTHSQ-KITTTPDNDIYTENTKSES-------------------STIYKSLEINNSGVINIWLIIGFSVGGSLLLVFITCFIYRCFRKDEGSYNVEDDHIFI 3828
            +ATF    Y  Y+    P  S  D I L FKT Q    + + G           Y+ + L +  + + I    L    F+     +     DN WH + V+R    + +  G  ++ + VDG +          T L S    + G  P T +D       S + N  NF GC+++++Y  ++  L++   AK+    +    +   KC ++  + P++F T  S+ITL  W+  + G + F F+T E N LL +   +     Q           DF+A E+ +  L+  ++ GSG  + +  +  V+DG  ++V    +  +  + +++ +   +     + LD    LY+GG+PE     + P  +W+ +L  G+VGC+ D+ ++G   D+   AE++   G+   CS +   +  C + PC++ G C  G+NR++CDCS T Y G +C R A ++ ++G + M I +P    +E EDV+LRF + R  G+ + T S+ S  + RLE  L+ G++ + +N           +G + I S  N  D  WHT+++ RR  S+ L++DD++  +   +G    L    +  G     ++       F G++   +FNG++Y +L K       E+ A IG      + P++F S +SY+ LP +  Y    L F  KT +  G +L   G   D++++E+V GYL+ + + GNG +  K      ++DN WH V++ R+ +   +   +ID+     +   +   G  N +   +L++G   K + K   +   V S +GF+GC++S  +N            +L + AL+  G VE   E  +   +C+ + C + G C+QQW    CDC+MT++ G  C+    T  F      ++Y   P    +T  D LA G  T    +  + +    G   D++  ++     R  + + +N+G+    + E+S  + DG YH V F R+G  A+LQ+DD   I   P G      N++  I   + P+   R GR V +                       +K    F G LSGLY+N              G+K+LN +     NV VE           S ++ Q              V A  N S   P                 I      T ++ Q K TTTP +D+   + +  S                   +  Y S E+         +++G     +L ++ +   +Y+   +DEGSY+V++   +I
Sbjct:  263 MATFKGSEYFCYDLSPNPIQSSSDEITLSFKTLQRNGLMLHTGKS-------ADYVNLALKNGAVSLVIN---LGSGAFEALVEPVNGKFNDNAWHDVKVTRN-LRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPST-ADLP----GSPVSN--NFMGCLKEVVYKNNDVRLELSRLAKLGDPKMKVSGVVAFKCENVATLDPVTFETPESFITLDKWSAKKAGSISFDFRTTEPNGLLLFSHGKPKPQQQKDPKSPKTLKVDFFAIEMLDGHLYLLLDMGSGTTKTRAVNKKVNDGEWYHVDFQRDGRSGTISVNSIRTPYNAPGESEILDLDDKLYLGGLPEDRAGLIFPTEVWTALLNYGYVGCVRDLFMDGQSKDIRRIAEAQRAVGVKPSCSKEPPKQ--CLSNPCLNSGTCREGWNRYVCDCSGTGYLGRSCERDATILSYDGSKFMKIQLPVVMHTEAEDVSLRFRSQRAYGVLMATTSQNSADTLRLE--LDGGRVRLTVNLDCIRINCTTSKGPETIFSGQNLNDNEWHTVRVVRRGKSLKLMVDDLQPSEGQITGDHTQLEFHNVETGIVTEKRYMPAVPSNFIGHLQGLSFNGMSYIDLCKNGDIDYCELNAMIGYRSIVAD-PVTFKSRSSYVTLPTLQAYYSMHLFFQFKTTSPDGLILYNRGDGNDFIVVELVKGYLHYVSDLGNGAHLIKGNSNTPLNDNHWHNVMISRDTNNLHT--VKIDT-----KITTQTTMGAKNLDLKGDLYVGGVAKDMYK--DLPKLVHSKEGFQGCLASVDLN--------GRLPDLQSDALSTAGQVERGCEGPS--TTCQEDSCSNQGVCLQQWEGFSCDCSMTSYGGPLCNDPGTTYIFGRDGGLIVYTWPPNDRPSTRADRLAVGFSTQQKDAVLVRVDSSSG-LGDYLQLQIE----RGNIKVVFNVGTDDINIEETSKFVNDGKYHIVRFTRSGGNATLQVDDLPVIERYPSGNID---NERLAIARQRIPY---RLGRVVDDWLLDKGRQLTIFNSQTTIKIGGWEKGSRPFQGQLSGLYYN--------------GLKVLNMAAEGDPNVRVEGSARLVGDMPSSSITPQSS------------VSAAGNRSETSP----------------SITDITTTTASNRQGKQTTTPQDDLLVASAECPSDDEDIDPCDPSSAHPPLPEAKGYPSPEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYHVDESRNYI 1446          

HSP 2 Score: 118.627 bits (296), Expect = 2.782e-26
Identity = 204/900 (22.67%), Postives = 348/900 (38.67%), Query Frame = 1
Query:  874 ISFT-TEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGILRQ-GFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMDGR-CIIGYNRFICDCSRTNYTGDTC-------GRVAPLV---------------KFNGFQQMIINM-PNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGN-----KIIRSDYNCFDGNWHTLKLKR--RQLS------VILIIDDM--EKKYNFSGSSKLLSNDIIAVGKYET------DKFSRYFTGYMMHFTFNG----INYFELAKEESPSNIEVTATIG-DAEPTKEF-PISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSG---------------DYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKS--SSFAFRIDSQPIGERAHIELK----AGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMN-QTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNL------GSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKG-KTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDN 3327
            + FT  E  +     W    + ++ F+ KT  ++ LL Y   E       DF    I    L    +          S T V+D   H V L     N  + +D + K     S  + +     L++GGIP  L S       S I  +  + G + ++ VNG          SE +     G + D+ +    A+  C++G  C I  +  ICDCS T + G  C       G +A L+                F G +    ++ PN  QS  +++TL F T + NG+ + T      ++D + + L+NG +++++N G G      + +   +N  D  WH +K+ R  RQ S      V + +D +     Y     + L S+D   VG   +         S  F G +    +      +    LAK   P  ++V+  +    E      P++F +  S+I L K        + F  +T    G +L  +GK                 D+  +E++ G+L LL + G+G  K      K++D  W+ V   R+      S  + R      GE   ++L      GGL  +    +F    E + +  N          G+ GC+   +M+ Q+K +   +  Q  +       GV   C ++   Q  C  N C + G C + W R  CDC+ T ++G  C++ +  L + D   ++  +L    +T  ++++   ++       +        Q+   + RL  D GR  L +  +        S     + S  N+ D  +H V   R G    L +DD         G  T + F+   T  V +     +R   +V ++     F G+L GL FN +   D+  N
Sbjct:   28 MEFTGAEGQWARFPMWNACCESEMSFNMKTKSAHGLLVYFDDE----GFCDFLELLIHNGRLSLRFSIFCAEPATVFSDTAVNDSRWHAVTLRRNFKNTTLVVDEEIKWVEVKSKRRDMTVFSHLFLGGIPPELRSVALRLTSSAIKDEVPYKGWITNLRVNG----------SEPVLIGSDGVNSDICE----ADHICLNGGVCSIVNDEPICDCSETGFQGKDCSEEEAYVGGLAHLMMGDQGKRKEREEYMATFKGSEYFCYDLSPNPIQSSSDEITLSFKTLQRNGLMLHTGK----SADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFN--DNAWHDVKVTRNLRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKLGDP-KMKVSGVVAFKCENVATLDPVTFETPESFITLDKWSAKKAGSISFDFRTTEPNGLLLFSHGKPKPQQQKDPKSPKTLKVDFFAIEMLDGHLYLLLDMGSGTTKTRAVNKKVNDGEWYHVDFQRDGRSGTISVNSIRTPYNAPGESEILDLDDKLYLGGLPEDRAGLIF--PTEVWTALLN---------YGYVGCVRDLFMDGQSKDIRRIAEAQRAV-------GVKPSCSKEPPKQ--CLSNPCLNSGTCREGWNRYVCDCSGTGYLGRSCERDATILSY-DGSKFMKIQLPVVMHTEAEDVSLRFRSQRAYGVLMATT----SQNSADTLRLELDGGRVRLTVNLDCIRINCTTSKGPETIFSGQNLNDNEWHTVRVVRRGKSLKLMVDDLQPSEGQITGDHTQLEFHNVETGIVTE-----KRYMPAVPSN-----FIGHLQGLSFNGMSYIDLCKN 867          
BLAST of neurexin-1 isoform X19 vs. Ensembl Zebrafish
Match: nrxn1a (neurexin 1a [Source:NCBI gene;Acc:565531])

HSP 1 Score: 364.77 bits (935), Expect = 3.230e-104
Identity = 325/1282 (25.35%), Postives = 563/1282 (43.92%), Query Frame = 1
Query:  226 VATFLQDAYI-YNSINIPTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQ----------FDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFL-PHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNF---------GRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEK-KYNFSGSSKLLSNDIIAVGKYETDKF----SRYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXXXXXXXXXXK-KVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPT--KNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQN-----------------------DKTFDSFSGYLSGLYFNRIPLSDMIDNISYAGIKLLNRS-----NVYVENKFIPNFQSKQSILSEQGXXXXXXXXXXXXIVVAKSNCSNIEPLHNLDCKVSDSAGIIRPIVSYKINTVTHSQ-KITTTPDNDIYTENTKSES----------------------STIYKSLEINNSGVINIWLIIGFSVGGSLLLVFITCFIYRCFRKDEGSYNVEDDHIFI 3828
            +ATF    Y  Y+    P  S  D I L FKT Q    + + G           Y+ + L +  + + I    L    F+     +     DN WH + V+R    + +  G  ++ + VDG +          T L S    + G  P T +D       S + N  NF GC+++++Y  ++  L++   AK+    +    +   KC ++  + P++F T  S+ITL  W+  + G + F F+T E N LL +   +     Q           DF+A E+ +  L+  ++ GSG  + +  +  V+DG  ++V    +  +  + +++ +   +     + LD    LY+GG+PE     + P  +W+ +L  G+VGC+ D+ ++G   D+   AE++   G+   CS +   +  C + PC++ G C  G+NR++CDCS T Y G +C R A ++ ++G + M I +P    +E EDV+LRF + R  G+ + T S+ S  + RLE  L+ G++ + +N           +G + I S  N  D  WHT+++ RR  S+ L++DD++  +   +G    L    +  G     ++       F G++   +FNG++Y +L K       E+ A IG      + P++F S +SY+ LP +  Y    L F  KT +  G +L   G   D++++E+V GYL+ + + GNG +  K      ++DN WH V++ R+ +   +   +ID+     +   +   G  N +   +L++G   K + K   +   V S +GF+GC++S  +N            +L + AL+  G VE   E  +   +C+ + C + G C+QQW    CDC+MT++ G  C+    T  F      ++Y   P    +T  D LA G  T    +  + +    G   D++  ++     R  + + +N+G+    + E+S  + DG YH V F R+G  A+LQ+DD   I   P G      N++  I   + P+   R GR V +                       +K    F G LSGLY+N              G+K+LN +     NV VE           S ++ Q              V A  N S   P                 I      T ++ Q K TTTP +D+   + +  S                      +  Y S E+         +++G     +L ++ +   +Y+   +DEGSY+V++   +I
Sbjct:  263 MATFKGSEYFCYDLSPNPIQSSSDEITLSFKTLQRNGLMLHTGKS-------ADYVNLALKNGAVSLVIN---LGSGAFEALVEPVNGKFNDNAWHDVKVTRN-LRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPST-ADLP----GSPVSN--NFMGCLKEVVYKNNDVRLELSRLAKLGDPKMKVSGVVAFKCENVATLDPVTFETPESFITLDKWSAKKAGSISFDFRTTEPNGLLLFSHGKPKPQQQKDPKSPKTLKVDFFAIEMLDGHLYLLLDMGSGTTKTRAVNKKVNDGEWYHVDFQRDGRSGTISVNSIRTPYNAPGESEILDLDDKLYLGGLPEDRAGLIFPTEVWTALLNYGYVGCVRDLFMDGQSKDIRRIAEAQRAVGVKPSCSKEPPKQ--CLSNPCLNSGTCREGWNRYVCDCSGTGYLGRSCERDATILSYDGSKFMKIQLPVVMHTEAEDVSLRFRSQRAYGVLMATTSQNSADTLRLE--LDGGRVRLTVNLDCIRINCTTSKGPETIFSGQNLNDNEWHTVRVVRRGKSLKLMVDDLQPSEGQITGDHTQLEFHNVETGIVTEKRYMPAVPSNFIGHLQGLSFNGMSYIDLCKNGDIDYCELNAMIGYRSIVAD-PVTFKSRSSYVTLPTLQAYYSMHLFFQFKTTSPDGLILYNRGDGNDFIVVELVKGYLHYVSDLGNGAHLIKGNSNTPLNDNHWHNVMISRDTNNLHT--VKIDT-----KITTQTTMGAKNLDLKGDLYVGGVAKDMYK--DLPKLVHSKEGFQGCLASVDLN--------GRLPDLQSDALSTAGQVERGCEGPS--TTCQEDSCSNQGVCLQQWEGFSCDCSMTSYGGPLCNDPGTTYIFGRDGGLIVYTWPPNDRPSTRADRLAVGFSTQQKDAVLVRVDSSSG-LGDYLQLQIE----RGNIKVVFNVGTDDINIEETSKFVNDGKYHIVRFTRSGGNATLQVDDLPVIERYPSGNID---NERLAIARQRIPY---RLGRVVDDWLLDKGRQLTIFNSQTTIKIGGWEKGSRPFQGQLSGLYYN--------------GLKVLNMAAEGDPNVRVEGSARLVGDMPSSSITPQSS------------VSAAGNRSETSP----------------SITDITTTTASNRQGKQTTTPQDDLLVASAECPSDDEDIDPCDPSSGGLAHPPLPEAKGYPSPEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYHVDESRNYI 1449          

HSP 2 Score: 118.627 bits (296), Expect = 2.906e-26
Identity = 204/900 (22.67%), Postives = 348/900 (38.67%), Query Frame = 1
Query:  874 ISFT-TEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGILRQ-GFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMDGR-CIIGYNRFICDCSRTNYTGDTC-------GRVAPLV---------------KFNGFQQMIINM-PNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGN-----KIIRSDYNCFDGNWHTLKLKR--RQLS------VILIIDDM--EKKYNFSGSSKLLSNDIIAVGKYET------DKFSRYFTGYMMHFTFNG----INYFELAKEESPSNIEVTATIG-DAEPTKEF-PISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSG---------------DYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKS--SSFAFRIDSQPIGERAHIELK----AGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMN-QTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNL------GSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKG-KTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDN 3327
            + FT  E  +     W    + ++ F+ KT  ++ LL Y   E       DF    I    L    +          S T V+D   H V L     N  + +D + K     S  + +     L++GGIP  L S       S I  +  + G + ++ VNG          SE +     G + D+ +    A+  C++G  C I  +  ICDCS T + G  C       G +A L+                F G +    ++ PN  QS  +++TL F T + NG+ + T      ++D + + L+NG +++++N G G      + +   +N  D  WH +K+ R  RQ S      V + +D +     Y     + L S+D   VG   +         S  F G +    +      +    LAK   P  ++V+  +    E      P++F +  S+I L K        + F  +T    G +L  +GK                 D+  +E++ G+L LL + G+G  K      K++D  W+ V   R+      S  + R      GE   ++L      GGL  +    +F    E + +  N          G+ GC+   +M+ Q+K +   +  Q  +       GV   C ++   Q  C  N C + G C + W R  CDC+ T ++G  C++ +  L + D   ++  +L    +T  ++++   ++       +        Q+   + RL  D GR  L +  +        S     + S  N+ D  +H V   R G    L +DD         G  T + F+   T  V +     +R   +V ++     F G+L GL FN +   D+  N
Sbjct:   28 MEFTGAEGQWARFPMWNACCESEMSFNMKTKSAHGLLVYFDDE----GFCDFLELLIHNGRLSLRFSIFCAEPATVFSDTAVNDSRWHAVTLRRNFKNTTLVVDEEIKWVEVKSKRRDMTVFSHLFLGGIPPELRSVALRLTSSAIKDEVPYKGWITNLRVNG----------SEPVLIGSDGVNSDICE----ADHICLNGGVCSIVNDEPICDCSETGFQGKDCSEEEAYVGGLAHLMMGDQGKRKEREEYMATFKGSEYFCYDLSPNPIQSSSDEITLSFKTLQRNGLMLHTGK----SADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFN--DNAWHDVKVTRNLRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKLGDP-KMKVSGVVAFKCENVATLDPVTFETPESFITLDKWSAKKAGSISFDFRTTEPNGLLLFSHGKPKPQQQKDPKSPKTLKVDFFAIEMLDGHLYLLLDMGSGTTKTRAVNKKVNDGEWYHVDFQRDGRSGTISVNSIRTPYNAPGESEILDLDDKLYLGGLPEDRAGLIF--PTEVWTALLN---------YGYVGCVRDLFMDGQSKDIRRIAEAQRAV-------GVKPSCSKEPPKQ--CLSNPCLNSGTCREGWNRYVCDCSGTGYLGRSCERDATILSY-DGSKFMKIQLPVVMHTEAEDVSLRFRSQRAYGVLMATT----SQNSADTLRLELDGGRVRLTVNLDCIRINCTTSKGPETIFSGQNLNDNEWHTVRVVRRGKSLKLMVDDLQPSEGQITGDHTQLEFHNVETGIVTE-----KRYMPAVPSN-----FIGHLQGLSFNGMSYIDLCKN 867          
BLAST of neurexin-1 isoform X19 vs. Ensembl Zebrafish
Match: nrxn1a (neurexin 1a [Source:NCBI gene;Acc:565531])

HSP 1 Score: 364.385 bits (934), Expect = 3.897e-104
Identity = 323/1285 (25.14%), Postives = 562/1285 (43.74%), Query Frame = 1
Query:  226 VATFLQDAYI-YNSINIPTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQ----------FDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFL-PHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNF---------GRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEK-KYNFSGSSKLLSNDIIAVGKYETDKF----SRYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXXXXXXXXXXK-KVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMN------QTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPT--KNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQN-----------------------DKTFDSFSGYLSGLYFNRIPLSDMIDNISYAGIKLLNRS-----NVYVENKFIPNFQSKQSILSEQGXXXXXXXXXXXXIVVAKSNCSNIEPLHNLDCKVSDSAGIIRPIVSYKINTVTHSQ-KITTTPDNDIYTENTKSES-------------------STIYKSLEINNSGVINIWLIIGFSVGGSLLLVFITCFIYRCFRKDEGSYNVEDDHIFI 3828
            +ATF    Y  Y+    P  S  D I L FKT Q    + + G           Y+ + L +  + + I    L    F+     +     DN WH + V+R    + +  G  ++ + VDG +          T L S    + G  P T +D       S + N  NF GC+++++Y  ++  L++   AK+    +    +   KC ++  + P++F T  S+ITL  W+  + G + F F+T E N LL +   +     Q           DF+A E+ +  L+  ++ GSG  + +  +  V+DG  ++V    +  +  + +++ +   +     + LD    LY+GG+PE     + P  +W+ +L  G+VGC+ D+ ++G   D+   AE++   G+   CS +   +  C + PC++ G C  G+NR++CDCS T Y G +C R A ++ ++G + M I +P    +E EDV+LRF + R  G+ + T S+ S  + RLE  L+ G++ + +N           +G + I S  N  D  WHT+++ RR  S+ L++DD++  +   +G    L    +  G     ++       F G++   +FNG++Y +L K       E+ A IG      + P++F S +SY+ LP +  Y    L F  KT +  G +L   G   D++++E+V GYL+ + + GNG +  K      ++DN WH V++ R+ +   +   +ID+     +   +   G  N +   +L++G   K + K   +   V S +GF+GC++S  +N      Q+  +ST    +    +AL    +            +C+ + C + G C+QQW    CDC+MT++ G  C+    T  F      ++Y   P    +T  D LA G  T    +  + +    G   D++  ++     R  + + +N+G+    + E+S  + DG YH V F R+G  A+LQ+DD   I   P G      N++  I   + P+   R GR V +                       +K    F G LSGLY+N              G+K+LN +     NV VE           S ++ Q              V A  N S   P                 I      T ++ Q K TTTP +D+   + +  S                   +  Y S E+         +++G     +L ++ +   +Y+   +DEGSY+V++   +I
Sbjct:  243 MATFKGSEYFCYDLSPNPIQSSSDEITLSFKTLQRNGLMLHTGKS-------ADYVNLALKNGAVSLVIN---LGSGAFEALVEPVNGKFNDNAWHDVKVTRN-LRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPST-ADLP----GSPVSN--NFMGCLKEVVYKNNDVRLELSRLAKLGDPKMKVSGVVAFKCENVATLDPVTFETPESFITLDKWSAKKAGSISFDFRTTEPNGLLLFSHGKPKPQQQKDPKSPKTLKVDFFAIEMLDGHLYLLLDMGSGTTKTRAVNKKVNDGEWYHVDFQRDGRSGTISVNSIRTPYNAPGESEILDLDDKLYLGGLPEDRAGLIFPTEVWTALLNYGYVGCVRDLFMDGQSKDIRRIAEAQRAVGVKPSCSKEPPKQ--CLSNPCLNSGTCREGWNRYVCDCSGTGYLGRSCERDATILSYDGSKFMKIQLPVVMHTEAEDVSLRFRSQRAYGVLMATTSQNSADTLRLE--LDGGRVRLTVNLDCIRINCTTSKGPETIFSGQNLNDNEWHTVRVVRRGKSLKLMVDDLQPSEGQITGDHTQLEFHNVETGIVTEKRYMPAVPSNFIGHLQGLSFNGMSYIDLCKNGDIDYCELNAMIGYRSIVAD-PVTFKSRSSYVTLPTLQAYYSMHLFFQFKTTSPDGLILYNRGDGNDFIVVELVKGYLHYVSDLGNGAHLIKGNSNTPLNDNHWHNVMISRDTNNLHT--VKIDT-----KITTQTTMGAKNLDLKGDLYVGGVAKDMYK--DLPKLVHSKEGFQGCLASVDLNGRLPDLQSDALSTAGQVERGCEVALLKADL-------QGPSTTCQEDSCSNQGVCLQQWEGFSCDCSMTSYGGPLCNDPGTTYIFGRDGGLIVYTWPPNDRPSTRADRLAVGFSTQQKDAVLVRVDSSSG-LGDYLQLQIE----RGNIKVVFNVGTDDINIEETSKFVNDGKYHIVRFTRSGGNATLQVDDLPVIERYPSGNID---NERLAIARQRIPY---RLGRVVDDWLLDKGRQLTIFNSQTTIKIGGWEKGSRPFQGQLSGLYYN--------------GLKVLNMAAEGDPNVRVEGSARLVGDMPSSSITPQSS------------VSAAGNRSETSP----------------SITDITTTTASNRQGKQTTTPQDDLLVASAECPSDDEDIDPCDPSSAHPPLPEAKGYPSPEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYHVDESRNYI 1435          

HSP 2 Score: 126.331 bits (316), Expect = 1.373e-28
Identity = 202/880 (22.95%), Postives = 345/880 (39.20%), Query Frame = 1
Query:  874 ISFT-TEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGILRQ-GFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMDGR-CIIGYNRFICDCSRTNYTGDTCG--RVAPLVKFNGFQQMIINM-PNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGN-----KIIRSDYNCFDGNWHTLKLKR--RQLS------VILIIDDM--EKKYNFSGSSKLLSNDIIAVGKYET------DKFSRYFTGYMMHFTFNG----INYFELAKEESPSNIEVTATIG-DAEPTKEF-PISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSG---------------DYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKS--SSFAFRIDSQPIGERAHIELK----AGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMN-QTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNL------GSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKG-KTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDN 3327
            + FT  E  +     W    + ++ F+ KT  ++ LL Y   E       DF    I    L    +          S T V+D   H V L     N  + +D + K     S  + +     L++GGIP  L S       S I  +  + G + ++ VNG          SE +     G + D+ +    A+  C++G  C I  +  ICDCS T + G  C   R   +  F G +    ++ PN  QS  +++TL F T + NG+ + T      ++D + + L+NG +++++N G G      + +   +N  D  WH +K+ R  RQ S      V + +D +     Y     + L S+D   VG   +         S  F G +    +      +    LAK   P  ++V+  +    E      P++F +  S+I L K        + F  +T    G +L  +GK                 D+  +E++ G+L LL + G+G  K      K++D  W+ V   R+      S  + R      GE   ++L      GGL  +    +F    E + +  N          G+ GC+   +M+ Q+K +   +  Q  +       GV   C ++   Q  C  N C + G C + W R  CDC+ T ++G  C++ +  L + D   ++  +L    +T  ++++   ++       +        Q+   + RL  D GR  L +  +        S     + S  N+ D  +H V   R G    L +DD         G  T + F+   T  V +     +R   +V ++     F G+L GL FN +   D+  N
Sbjct:   28 MEFTGAEGQWARFPMWNACCESEMSFNMKTKSAHGLLVYFDDE----GFCDFLELLIHNGRLSLRFSIFCAEPATVFSDTAVNDSRWHAVTLRRNFKNTTLVVDEEIKWVEVKSKRRDMTVFSHLFLGGIPPELRSVALRLTSSAIKDEVPYKGWITNLRVNG----------SEPVLIGSDGVNSDICE----ADHICLNGGVCSIVNDEPICDCSETGFQGKDCSEEREEYMATFKGSEYFCYDLSPNPIQSSSDEITLSFKTLQRNGLMLHTGK----SADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFN--DNAWHDVKVTRNLRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKLGDP-KMKVSGVVAFKCENVATLDPVTFETPESFITLDKWSAKKAGSISFDFRTTEPNGLLLFSHGKPKPQQQKDPKSPKTLKVDFFAIEMLDGHLYLLLDMGSGTTKTRAVNKKVNDGEWYHVDFQRDGRSGTISVNSIRTPYNAPGESEILDLDDKLYLGGLPEDRAGLIF--PTEVWTALLN---------YGYVGCVRDLFMDGQSKDIRRIAEAQRAV-------GVKPSCSKEPPKQ--CLSNPCLNSGTCREGWNRYVCDCSGTGYLGRSCERDATILSY-DGSKFMKIQLPVVMHTEAEDVSLRFRSQRAYGVLMATT----SQNSADTLRLELDGGRVRLTVNLDCIRINCTTSKGPETIFSGQNLNDNEWHTVRVVRRGKSLKLMVDDLQPSEGQITGDHTQLEFHNVETGIVTE-----KRYMPAVPSN-----FIGHLQGLSFNGMSYIDLCKN 847          
BLAST of neurexin-1 isoform X19 vs. Ensembl Xenopus
Match: NRXN3 (neurexin 3 [Source:NCBI gene;Acc:100379902])

HSP 1 Score: 358.992 bits (920), Expect = 1.663e-101
Identity = 292/1049 (27.84%), Postives = 491/1049 (46.81%), Query Frame = 1
Query:  226 VATFLQDAYI-YNSINIPTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLTRGEIYFD---KCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAY-------QKSETSQLN-QFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSF-LPHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEKKYNFSGSSKLLSNDIIAVGKYETDKFSRY----FTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXX-XXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPED----HNYQ---VSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKL--SPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGL 3288
            VATF    Y+ Y+    P  S  D I L FKT+Q    I + G           Y+ + L    + + I    L    F+           DN WH + V+R    + +  G  ++ + VDG +          T L S    + G  P T +D       S + N  NF GC+++++Y  ++  L++   +++ R   T+ +IY D   KC ++  + PISF +  +YI+L  W   + G + F F+T E N L+ +       +K   SQ N + DF+A E+ +  L+  ++ GSG  + K ++   +DG   +V +  +  +  + ++  +     +   + LD   D+Y+GG+PE      LP  LW+ +L  G+VGC+ D+ ++G   ++   AE++N  G+ S CS  ++ K  C + PC +   C  G+NRF+CDC+ T + G TC R A ++ ++G   M I MP    +E EDV+LRF + R  G+ + T SR S  + RLE  L+ GK+ +++N G+G + + +     D  WHT+++ RR  ++ L +DD   +    G    L    I  G     +F+      F G++    FNG+ Y +L K       E+ A  G      + P++F +  SY+ L  +  Y    L F  KT +  G +L   G   D++ +E+V GY++ +          K   E  ++DN WH V++ R+NS + +   ++D+     +A  ++  G  N +    L++    + +  T  +   V S  GF+GC++S  +N            +L+  AL  +G +E   ED     N Q    +C+ + C + G C+QQW    CDC+MT++ G  C+    T  F      ++Y    +   +T  D LA G  T+V     + +    G   D++   +++ K    + + +N+GS    + E S  + DG YH V + RNG  A+LQ+D++      P G T +H          K PF   RT    Q DK   S SG   G+
Sbjct:  262 VATFRGSEYLCYDLSQNPIQSSSDEITLSFKTRQRNGLILHTGKS-------ADYVNLALKGGAVSLVIN---LGSGAFEAIVEPTNDKFNDNEWHEVKVTRN-LRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPST-ADLP----GSPVSN--NFMGCLKEVVYKNNDIRLEL---SRLARIGDTKMKIYGDVVFKCENVATLDPISFESPEAYISLPKWNTKRMGSISFDFRTTEPNGLILFTHGKPQDRKDIRSQKNTKVDFFAVELLDGHLYLLLDMGSGTIKVKATNKKANDGEWCHVDIQRDGRSGTISVNTKRTPFTASGESEILDLEGDMYLGGLPENRAGLILPTELWTAMLNYGYVGCIRDLFIDGRSKNIRQLAEAQNAAGVKSSCS-RLSGK-QCDSYPCKNNAACRDGWNRFVCDCTGTGHWGRTCEREASILSYDGGMYMKIIMPVVMHTEAEDVSLRFKSQRAYGLLVATTSRDSADTLRLE--LDGGKVKLMVNLGKGPETLYAGQKLNDNEWHTVRVVRRGKTLKLTVDDDVAEGTMVGDHTRLEFHNIETGFMTEKRFASAVPSSFIGHLQSLMFNGLLYIDLCKNGDIDYCELKARFGMRSIIAD-PVTFRTKASYLTLSTLQAYTSMHLFFQFKTISPDGFILFNSGDGNDFIAVELVKGYIHYVFDLGNGPNVIKGNSERPLNDNQWHNVVITRDNSNTHT--LKVDT-----KAVTQVINGAKNLDLKGELYIAGLVQSMYST--LPKLVASRDGFQGCLASVDLN--------GRLPDLIGDALHRSGQIERGCEDALTKANLQGPTTTCQEDSCANQGVCMQQWEGFTCDCSMTSYSGNHCNDPGATYIFGKSGGLILYTWPHNDRPSTRTDRLAVGFSTTVKEGILVRIDSAPGLM-DYLQLHIVQGK----IGVTFNIGSQDISIREESAPVNDGKYHVVKYTRNGGNATLQVDNWPVNEHYPGGNTELHQKP-------KLPFKISRTPEDGQQDKGL-SISGMEDGI 1254          

HSP 2 Score: 114.775 bits (286), Expect = 6.481e-25
Identity = 212/896 (23.66%), Postives = 342/896 (38.17%), Query Frame = 1
Query:  916 WAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESF--LHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGILR--QGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTD-KGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTC----------------------GRVAPLVKFNGFQQMIINMP-NGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRG--NKIIRSDYNCFDGN-WHTLKLKR--RQLS------VILIIDDM--EKKYNFSGSSKLLSNDIIAVGKYET------DKFSRYFTGYMMHFTF-NGINYFELAKEESPSNIEVTATIGDAEPTKEF--------------PISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSG-------------DYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPI---GERAHIELKA----GGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDN--ISYAGIK 3348
            W  + +  L F  +T  S  LL Y           DF    + +    L FSI+         VS   V+DG  H++ L        + LD + K        + ++   DL++GG+P  + S    +L  G +R    F G LLDI     +  L              G  G   D +GLC   PC + G C++      CDC+ T Y G  C                       R   +  F G + +  ++  N  QS  +++TL F T + NG+ + T      ++D + + L+ G +++++N G G    I+    + F+ N WH +K+ R  RQ S      V + +D +     Y     + L S+D   VG   +         S  F G +    + N     EL++          A IGD +  K +              PISF S  +YI LPK +      + F  +T    G +L  +GK               D+  +E++ G+L LL + G+G  K      K +D  W  V  I+ + +S + +      P    GE   ++L+     GGL  N    L L   E + +  N          G+ GCI   +++      +K++ Q  LA A    GV   C      Q    P  C +   C   W R  CDC  T   G  C++ +  L + D   Y+   +    +T  ++++   ++       +     D       + RL  D G+  L++  NLG G   L  +   + D  +H V   R G    L +DD           T + F+   T ++ +     +R   +V +     SF G+L  L FN +   D+  N  I Y  +K
Sbjct:   43 WDASTRSDLSFQLRTNVSAGLLLYFDDG----GICDFLCLSLADGHVQLRFSIDCAETAI---VSDKKVNDGGWHFLMLSRNRLRTTLVLDGEAKPGEVRPQRQHMNIVSDLFVGGVPSDIRS---GALTLGSVRDMSAFAGYLLDIKYGNTEPRLL-------------GSHGARLDLEGLCTENPCENGGACLLLDGEPTCDCTATGYVGKFCSEDVNDIPGLAHLMIDDQGRSKAREENVATFRGSEYLCYDLSQNPIQSSSDEITLSFKTRQRNGLILHTGK----SADYVNLALKGGAVSLVINLGSGAFEAIVEPTNDKFNDNEWHEVKVTRNLRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDIRLELSR---------LARIGDTK-MKIYGDVVFKCENVATLDPISFESPEAYISLPKWNTKRMGSISFDFRTTEPNGLILFTHGKPQDRKDIRSQKNTKVDFFAVELLDGHLYLLLDMGSGTIKVKATNKKANDGEWCHVD-IQRDGRSGTISVNTKRTPFTASGESEILDLEGDMYLGGLPENR-AGLIL-PTELWTAMLN---------YGYVGCIRDLFIDG----RSKNIRQ--LAEAQNAAGVKSSCSRLSGKQCDSYP--CKNNAACRDGWNRFVCDCTGTGHWGRTCEREASILSY-DGGMYMKIIMPVVMHTEAEDVSLRFKSQRAYGLLVATTSRDSAD----TLRLELDGGKVKLMV--NLGKGPETLY-AGQKLNDNEWHTVRVVRRGKTLKLTVDDDVAEGTMVGDHTRLEFHNIETGFMTE-----KRFASAVPS-----SFIGHLQSLMFNGLLYIDLCKNGDIDYCELK 863          
BLAST of neurexin-1 isoform X19 vs. Ensembl Xenopus
Match: NRXN3 (neurexin 3 [Source:NCBI gene;Acc:100379902])

HSP 1 Score: 352.443 bits (903), Expect = 2.314e-99
Identity = 297/1087 (27.32%), Postives = 501/1087 (46.09%), Query Frame = 1
Query:  226 VATFLQDAYI-YNSINIPTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLTRGEIYFD---KCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAY-------QKSETSQLN-QFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSF-LPHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNF---------GRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEKKYNFSGSSKLLSNDIIAVGKYETDKFSRY----FTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXX-XXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPED----HNYQ---VSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKL--SPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDK-----TFDS--------------FSGYLSGLYFNRIPLSDM 3318
            VATF    Y+ Y+    P  S  D I L FKT+Q    I + G           Y+ + L    + + I    L    F+           DN WH + V+R    + +  G  ++ + VDG +          T L S    + G  P T +D       S + N  NF GC+++++Y  ++  L++   +++ R   T+ +IY D   KC ++  + PISF +  +YI+L  W   + G + F F+T E N L+ +       +K   SQ N + DF+A E+ +  L+  ++ GSG  + K ++   +DG   +V +  +  +  + ++  +     +   + LD   D+Y+GG+PE      LP  LW+ +L  G+VGC+ D+ ++G   ++   AE++N  G+ S CS  ++ K  C + PC +   C  G+NRF+CDC+ T + G TC R A ++ ++G   M I MP    +E EDV+LRF + R  G+ + T SR S  + RLE  L+ GK+ +++N           +G + + +     D  WHT+++ RR  ++ L +DD   +    G    L    I  G     +F+      F G++    FNG+ Y +L K       E+ A  G      + P++F +  SY+ L  +  Y    L F  KT +  G +L   G   D++ +E+V GY++ +          K   E  ++DN WH V++ R+NS + +   ++D+     +A  ++  G  N +    L++    + +  T  +   V S  GF+GC++S  +N            +L+  AL  +G +E   ED     N Q    +C+ + C + G C+QQW    CDC+MT++ G  C+    T  F      ++Y    +   +T  D LA G  T+V     + +    G   D++   +++ K    + + +N+GS    + E S  + DG YH V + RNG  A+LQ+D++      P G T +H          K PF   RT    Q DK      F++              F G LSGLY+N + + +M
Sbjct:  242 VATFRGSEYLCYDLSQNPIQSSSDEITLSFKTRQRNGLILHTGKS-------ADYVNLALKGGAVSLVIN---LGSGAFEAIVEPTNDKFNDNEWHEVKVTRN-LRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPST-ADLP----GSPVSN--NFMGCLKEVVYKNNDIRLEL---SRLARIGDTKMKIYGDVVFKCENVATLDPISFESPEAYISLPKWNTKRMGSISFDFRTTEPNGLILFTHGKPQDRKDIRSQKNTKVDFFAVELLDGHLYLLLDMGSGTIKVKATNKKANDGEWCHVDIQRDGRSGTISVNTKRTPFTASGESEILDLEGDMYLGGLPENRAGLILPTELWTAMLNYGYVGCIRDLFIDGRSKNIRQLAEAQNAAGVKSSCS-RLSGK-QCDSYPCKNNAACRDGWNRFVCDCTGTGHWGRTCEREASILSYDGGMYMKIIMPVVMHTEAEDVSLRFKSQRAYGLLVATTSRDSADTLRLE--LDGGKVKLMVNLDCIRINCNSSKGPETLYAGQKLNDNEWHTVRVVRRGKTLKLTVDDDVAEGTMVGDHTRLEFHNIETGFMTEKRFASAVPSSFIGHLQSLMFNGLLYIDLCKNGDIDYCELKARFGMRSIIAD-PVTFRTKASYLTLSTLQAYTSMHLFFQFKTISPDGFILFNSGDGNDFIAVELVKGYIHYVFDLGNGPNVIKGNSERPLNDNQWHNVVITRDNSNTHT--LKVDT-----KAVTQVINGAKNLDLKGELYIAGLVQSMYST--LPKLVASRDGFQGCLASVDLN--------GRLPDLIGDALHRSGQIERGCEDALTKANLQGPTTTCQEDSCANQGVCMQQWEGFTCDCSMTSYSGNHCNDPGATYIFGKSGGLILYTWPHNDRPSTRTDRLAVGFSTTVKEGILVRIDSAPGLM-DYLQLHIVQGK----IGVTFNIGSQDISIREESAPVNDGKYHVVKYTRNGGNATLQVDNWPVNEHYPGGNTELHQKP-------KLPFKISRTPEDGQQDKGRPLTIFNTQAQIAIGGMDRGRPFQGQLSGLYYNGLKVLNM 1273          

HSP 2 Score: 115.546 bits (288), Expect = 3.672e-25
Identity = 208/882 (23.58%), Postives = 340/882 (38.55%), Query Frame = 1
Query:  916 WAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESF--LHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGILR--QGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTD-KGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTC--GRVAPLVKFNGFQQMIINMP-NGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRG--NKIIRSDYNCFDGN-WHTLKLKR--RQLS------VILIIDDM--EKKYNFSGSSKLLSNDIIAVGKYET------DKFSRYFTGYMMHFTF-NGINYFELAKEESPSNIEVTATIGDAEPTKEF--------------PISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSG-------------DYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPI---GERAHIELKA----GGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNL------GSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDN--ISYAGIK 3348
            W  + +  L F  +T  S  LL Y           DF    + +    L FSI+         VS   V+DG  H++ L        + LD + K        + ++   DL++GG+P  + S    +L  G +R    F G LLDI     +  L              G  G   D +GLC   PC + G C++      CDC+ T Y G  C   R   +  F G + +  ++  N  QS  +++TL F T + NG+ + T      ++D + + L+ G +++++N G G    I+    + F+ N WH +K+ R  RQ S      V + +D +     Y     + L S+D   VG   +         S  F G +    + N     EL++          A IGD +  K +              PISF S  +YI LPK +      + F  +T    G +L  +GK               D+  +E++ G+L LL + G+G  K      K +D  W  V  I+ + +S + +      P    GE   ++L+     GGL  N    L L   E + +  N          G+ GCI   +++      +K++ Q  LA A    GV   C      Q    P  C +   C   W R  CDC  T   G  C++ +  L + D   Y+   +    +T  ++++   ++       +     D       + RL  D G+  L++  +        S     + +   + D  +H V   R G    L +DD           T + F+   T ++ +     +R   +V +     SF G+L  L FN +   D+  N  I Y  +K
Sbjct:   43 WDASTRSDLSFQLRTNVSAGLLLYFDDG----GICDFLCLSLADGHVQLRFSIDCAETAI---VSDKKVNDGGWHFLMLSRNRLRTTLVLDGEAKPGEVRPQRQHMNIVSDLFVGGVPSDIRS---GALTLGSVRDMSAFAGYLLDIKYGNTEPRLL-------------GSHGARLDLEGLCTENPCENGGACLLLDGEPTCDCTATGYVGKFCSEAREENVATFRGSEYLCYDLSQNPIQSSSDEITLSFKTRQRNGLILHTGK----SADYVNLALKGGAVSLVINLGSGAFEAIVEPTNDKFNDNEWHEVKVTRNLRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDIRLELSR---------LARIGDTK-MKIYGDVVFKCENVATLDPISFESPEAYISLPKWNTKRMGSISFDFRTTEPNGLILFTHGKPQDRKDIRSQKNTKVDFFAVELLDGHLYLLLDMGSGTIKVKATNKKANDGEWCHVD-IQRDGRSGTISVNTKRTPFTASGESEILDLEGDMYLGGLPENR-AGLIL-PTELWTAMLN---------YGYVGCIRDLFIDG----RSKNIRQ--LAEAQNAAGVKSSCSRLSGKQCDSYP--CKNNAACRDGWNRFVCDCTGTGHWGRTCEREASILSY-DGGMYMKIIMPVVMHTEAEDVSLRFKSQRAYGLLVATTSRDSAD----TLRLELDGGKVKLMVNLDCIRINCNSSKGPETLYAGQKLNDNEWHTVRVVRRGKTLKLTVDDDVAEGTMVGDHTRLEFHNIETGFMTE-----KRFASAVPS-----SFIGHLQSLMFNGLLYIDLCKNGDIDYCELK 852          
BLAST of neurexin-1 isoform X19 vs. Ensembl Xenopus
Match: NRXN3 (neurexin 3 [Source:NCBI gene;Acc:100379902])

HSP 1 Score: 348.977 bits (894), Expect = 3.173e-98
Identity = 291/1083 (26.87%), Postives = 495/1083 (45.71%), Query Frame = 1
Query:  226 VATFLQDAYI-YNSINIPTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGG---MIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLTRGEIYFD---KCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAY-------QKSETSQLN-QFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSF-LPHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNF---------GRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEKKYNFSGSSKLLSNDIIAVGKYETDKFSRY----FTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXX-XXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKL--SPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDK-----TFDS--------------FSGYLSGLYFNRIPLSDM 3318
            VATF    Y+ Y+    P  S  D I L FKT+Q    I + G           Y+ + L    + + I    L    F+           DN WH + V+R     ++S     +   +   V +     LT T    +  T  G      +  S  +     S + N  NF GC+++++Y  ++  L++   +++ R   T+ +IY D   KC ++  + PISF +  +YI+L  W   + G + F F+T E N L+ +       +K   SQ N + DF+A E+ +  L+  ++ GSG  + K ++   +DG   +V +  +  +  + ++  +     +   + LD   D+Y+GG+PE      LP  LW+ +L  G+VGC+ D+ ++G   ++   AE++N  G+ S CS  ++ K  C + PC +   C  G+NRF+CDC+ T + G TC R A ++ ++G   M I MP    +E EDV+LRF + R  G+ + T SR S  + RLE  L+ GK+ +++N           +G + + +     D  WHT+++ RR  ++ L +DD   +    G    L    I  G     +F+      F G++    FNG+ Y +L K       E+ A  G      + P++F +  SY+ L  +  Y    L F  KT +  G +L   G   D++ +E+V GY++ +          K   E  ++DN WH V++ R+NS + +   ++D+     +A  ++  G  N +    L++    + +  T  +   V S  GF+GC++S  +N            +L+  AL  +G +E   E      +C+ + C + G C+QQW    CDC+MT++ G  C+    T  F      ++Y    +   +T  D LA G  T+V     + +    G   D++   +++ K    + + +N+GS    + E S  + DG YH V + RNG  A+LQ+D++      P G T +H          K PF   RT    Q DK      F++              F G LSGLY+N + + +M
Sbjct:  262 VATFRGSEYLCYDLSQNPIQSSSDEITLSFKTRQRNGLILHTGKS-------ADYVNLALKGGAVSLVIN---LGSGAFEAIVEPTNDKFNDNEWHEVKVTRNL--RQHSGIGHAMVNKLHCLVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSN--NFMGCLKEVVYKNNDIRLEL---SRLARIGDTKMKIYGDVVFKCENVATLDPISFESPEAYISLPKWNTKRMGSISFDFRTTEPNGLILFTHGKPQDRKDIRSQKNTKVDFFAVELLDGHLYLLLDMGSGTIKVKATNKKANDGEWCHVDIQRDGRSGTISVNTKRTPFTASGESEILDLEGDMYLGGLPENRAGLILPTELWTAMLNYGYVGCIRDLFIDGRSKNIRQLAEAQNAAGVKSSCS-RLSGK-QCDSYPCKNNAACRDGWNRFVCDCTGTGHWGRTCEREASILSYDGGMYMKIIMPVVMHTEAEDVSLRFKSQRAYGLLVATTSRDSADTLRLE--LDGGKVKLMVNLDCIRINCNSSKGPETLYAGQKLNDNEWHTVRVVRRGKTLKLTVDDDVAEGTMVGDHTRLEFHNIETGFMTEKRFASAVPSSFIGHLQSLMFNGLLYIDLCKNGDIDYCELKARFGMRSIIAD-PVTFRTKASYLTLSTLQAYTSMHLFFQFKTISPDGFILFNSGDGNDFIAVELVKGYIHYVFDLGNGPNVIKGNSERPLNDNQWHNVVITRDNSNTHT--LKVDT-----KAVTQVINGAKNLDLKGELYIAGLVQSMYST--LPKLVASRDGFQGCLASVDLN--------GRLPDLIGDALHRSGQIERGCE--GPTTTCQEDSCANQGVCMQQWEGFTCDCSMTSYSGNHCNDPGATYIFGKSGGLILYTWPHNDRPSTRTDRLAVGFSTTVKEGILVRIDSAPGLM-DYLQLHIVQGK----IGVTFNIGSQDISIREESAPVNDGKYHVVKYTRNGGNATLQVDNWPVNEHYPGGNTELHQKP-------KLPFKISRTPEDGQQDKGRPLTIFNTQAQIAIGGMDRGRPFQGQLSGLYYNGLKVLNM 1291          

HSP 2 Score: 109.768 bits (273), Expect = 2.611e-23
Identity = 211/909 (23.21%), Postives = 343/909 (37.73%), Query Frame = 1
Query:  916 WAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESF--LHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGILR--QGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTD-KGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTC-------GRVAPLVK---------------FNGFQQMIINMP-NGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRG--NKIIRSDYNCFDGN-WHTLKLKR--RQLS-------------VILIIDDM--EKKYNFSGSSKLLSNDIIAVGKYET------DKFSRYFTGYMMHFTF-NGINYFELAKEESPSNIEVTATIGDAEPTKEF--------------PISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSG-------------DYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPI---GERAHIELKA----GGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNL------GSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDN--ISYAGIK 3348
            W  + +  L F  +T  S  LL Y           DF    + +    L FSI+         VS   V+DG  H++ L        + LD + K        + ++   DL++GG+P  + S    +L  G +R    F G LLDI     +  L              G  G   D +GLC   PC + G C++      CDC+ T Y G  C       G V P+ K               F G + +  ++  N  QS  +++TL F T + NG+ + T      ++D + + L+ G +++++N G G    I+    + F+ N WH +K+ R  RQ S             V + +D +     Y     + L S+D   VG   +         S  F G +    + N     EL++          A IGD +  K +              PISF S  +YI LPK +      + F  +T    G +L  +GK               D+  +E++ G+L LL + G+G  K      K +D  W  V  I+ + +S + +      P    GE   ++L+     GGL  N    L L   E + +  N          G+ GCI   +++      +K++ Q  LA A    GV   C      Q    P  C +   C   W R  CDC  T   G  C++ +  L + D   Y+   +    +T  ++++   ++       +     D       + RL  D G+  L++  +        S     + +   + D  +H V   R G    L +DD           T + F+   T ++ +     +R   +V +     SF G+L  L FN +   D+  N  I Y  +K
Sbjct:   43 WDASTRSDLSFQLRTNVSAGLLLYFDDG----GICDFLCLSLADGHVQLRFSIDCAETAI---VSDKKVNDGGWHFLMLSRNRLRTTLVLDGEAKPGEVRPQRQHMNIVSDLFVGGVPSDIRS---GALTLGSVRDMSAFAGYLLDIKYGNTEPRLL-------------GSHGARLDLEGLCTENPCENGGACLLLDGEPTCDCTATGYVGKFCSEAHLQNGVVGPIFKTFCTSPAAREENVATFRGSEYLCYDLSQNPIQSSSDEITLSFKTRQRNGLILHTGK----SADYVNLALKGGAVSLVINLGSGAFEAIVEPTNDKFNDNEWHEVKVTRNLRQHSGIGHAMVNKLHCLVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDIRLELSR---------LARIGDTK-MKIYGDVVFKCENVATLDPISFESPEAYISLPKWNTKRMGSISFDFRTTEPNGLILFTHGKPQDRKDIRSQKNTKVDFFAVELLDGHLYLLLDMGSGTIKVKATNKKANDGEWCHVD-IQRDGRSGTISVNTKRTPFTASGESEILDLEGDMYLGGLPENR-AGLIL-PTELWTAMLN---------YGYVGCIRDLFIDG----RSKNIRQ--LAEAQNAAGVKSSCSRLSGKQCDSYP--CKNNAACRDGWNRFVCDCTGTGHWGRTCEREASILSY-DGGMYMKIIMPVVMHTEAEDVSLRFKSQRAYGLLVATTSRDSAD----TLRLELDGGKVKLMVNLDCIRINCNSSKGPETLYAGQKLNDNEWHTVRVVRRGKTLKLTVDDDVAEGTMVGDHTRLEFHNIETGFMTE-----KRFASAVPS-----SFIGHLQSLMFNGLLYIDLCKNGDIDYCELK 879          
BLAST of neurexin-1 isoform X19 vs. Ensembl Xenopus
Match: NRXN3 (neurexin 3 [Source:NCBI gene;Acc:100379902])

HSP 1 Score: 349.362 bits (895), Expect = 3.345e-98
Identity = 291/1058 (27.50%), Postives = 490/1058 (46.31%), Query Frame = 1
Query:  226 VATFLQDAYI-YNSINIPTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLTRGEIYFD---KCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAY-------QKSETSQLN-QFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSF-LPHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNF---------GRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEKKYNFSGSSKLLSNDIIAVGKYETDKFSRY----FTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXX-XXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPED----HNYQ---VSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKL--SPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGL 3288
            VATF    Y+ Y+    P  S  D I L FKT+Q    I + G           Y+ + L    + + I    L    F+           DN WH + V+R    + +  G  ++ + VDG +          T L S    + G  P T +D       S + N  NF GC+++++Y  ++  L++   +++ R   T+ +IY D   KC ++  + PISF +  +YI+L  W   + G + F F+T E N L+ +       +K   SQ N + DF+A E+ +  L+  ++ GSG  + K ++   +DG   +V +  +  +  + ++  +     +   + LD   D+Y+GG+PE      LP  LW+ +L  G+VGC+ D+ ++G   ++   AE++N  G+ S CS  ++ K  C + PC +   C  G+NRF+CDC+ T + G TC R A ++ ++G   M I MP    +E EDV+LRF + R  G+ + T SR S  + RLE  L+ GK+ +++N           +G + + +     D  WHT+++ RR  ++ L +DD   +    G    L    I  G     +F+      F G++    FNG+ Y +L K       E+ A  G      + P++F +  SY+ L  +  Y    L F  KT +  G +L   G   D++ +E+V GY++ +          K   E  ++DN WH V++ R+NS + +   ++D+     +A  ++  G  N +    L++    + +  T  +   V S  GF+GC++S  +N            +L+  AL  +G +E   ED     N Q    +C+ + C + G C+QQW    CDC+MT++ G  C+    T  F      ++Y    +   +T  D LA G  T+V     + +    G   D++   +++ K    + + +N+GS    + E S  + DG YH V + RNG  A+LQ+D++      P G T +H          K PF   RT    Q DK   S SG   G+
Sbjct:  262 VATFRGSEYLCYDLSQNPIQSSSDEITLSFKTRQRNGLILHTGKS-------ADYVNLALKGGAVSLVIN---LGSGAFEAIVEPTNDKFNDNEWHEVKVTRN-LRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPST-ADLP----GSPVSN--NFMGCLKEVVYKNNDIRLEL---SRLARIGDTKMKIYGDVVFKCENVATLDPISFESPEAYISLPKWNTKRMGSISFDFRTTEPNGLILFTHGKPQDRKDIRSQKNTKVDFFAVELLDGHLYLLLDMGSGTIKVKATNKKANDGEWCHVDIQRDGRSGTISVNTKRTPFTASGESEILDLEGDMYLGGLPENRAGLILPTELWTAMLNYGYVGCIRDLFIDGRSKNIRQLAEAQNAAGVKSSCS-RLSGK-QCDSYPCKNNAACRDGWNRFVCDCTGTGHWGRTCEREASILSYDGGMYMKIIMPVVMHTEAEDVSLRFKSQRAYGLLVATTSRDSADTLRLE--LDGGKVKLMVNLDCIRINCNSSKGPETLYAGQKLNDNEWHTVRVVRRGKTLKLTVDDDVAEGTMVGDHTRLEFHNIETGFMTEKRFASAVPSSFIGHLQSLMFNGLLYIDLCKNGDIDYCELKARFGMRSIIAD-PVTFRTKASYLTLSTLQAYTSMHLFFQFKTISPDGFILFNSGDGNDFIAVELVKGYIHYVFDLGNGPNVIKGNSERPLNDNQWHNVVITRDNSNTHT--LKVDT-----KAVTQVINGAKNLDLKGELYIAGLVQSMYST--LPKLVASRDGFQGCLASVDLN--------GRLPDLIGDALHRSGQIERGCEDALTKANLQGPTTTCQEDSCANQGVCMQQWEGFTCDCSMTSYSGNHCNDPGATYIFGKSGGLILYTWPHNDRPSTRTDRLAVGFSTTVKEGILVRIDSAPGLM-DYLQLHIVQGK----IGVTFNIGSQDISIREESAPVNDGKYHVVKYTRNGGNATLQVDNWPVNEHYPGGNTELHQKP-------KLPFKISRTPEDGQQDKGL-SISGMEDGI 1263          

HSP 2 Score: 107.842 bits (268), Expect = 9.629e-23
Identity = 208/902 (23.06%), Postives = 340/902 (37.69%), Query Frame = 1
Query:  916 WAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESF--LHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGILR--QGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTD-KGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTC----------------------GRVAPLVKFNGFQQMIINMP-NGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRG--NKIIRSDYNCFDGN-WHTLKLKR--RQLS------VILIIDDM--EKKYNFSGSSKLLSNDIIAVGKYET------DKFSRYFTGYMMHFTF-NGINYFELAKEESPSNIEVTATIGDAEPTKEF--------------PISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSG-------------DYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPI---GERAHIELKA----GGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNL------GSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDN--ISYAGIK 3348
            W  + +  L F  +T  S  LL Y           DF    + +    L FSI+         VS   V+DG  H++ L        + LD + K        + ++   DL++GG+P  + S    +L  G +R    F G LLDI     +  L              G  G   D +GLC   PC + G C++      CDC+ T Y G  C                       R   +  F G + +  ++  N  QS  +++TL F T + NG+ + T      ++D + + L+ G +++++N G G    I+    + F+ N WH +K+ R  RQ S      V + +D +     Y     + L S+D   VG   +         S  F G +    + N     EL++          A IGD +  K +              PISF S  +YI LPK +      + F  +T    G +L  +GK               D+  +E++ G+L LL + G+G  K      K +D  W  V  I+ + +S + +      P    GE   ++L+     GGL  N    L L   E + +  N          G+ GCI   +++      +K++ Q  LA A    GV   C      Q    P  C +   C   W R  CDC  T   G  C++ +  L + D   Y+   +    +T  ++++   ++       +     D       + RL  D G+  L++  +        S     + +   + D  +H V   R G    L +DD           T + F+   T ++ +     +R   +V +     SF G+L  L FN +   D+  N  I Y  +K
Sbjct:   43 WDASTRSDLSFQLRTNVSAGLLLYFDDG----GICDFLCLSLADGHVQLRFSIDCAETAI---VSDKKVNDGGWHFLMLSRNRLRTTLVLDGEAKPGEVRPQRQHMNIVSDLFVGGVPSDIRS---GALTLGSVRDMSAFAGYLLDIKYGNTEPRLL-------------GSHGARLDLEGLCTENPCENGGACLLLDGEPTCDCTATGYVGKFCSEDVNDIPGLAHLMIDDQGRSKAREENVATFRGSEYLCYDLSQNPIQSSSDEITLSFKTRQRNGLILHTGK----SADYVNLALKGGAVSLVINLGSGAFEAIVEPTNDKFNDNEWHEVKVTRNLRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDIRLELSR---------LARIGDTK-MKIYGDVVFKCENVATLDPISFESPEAYISLPKWNTKRMGSISFDFRTTEPNGLILFTHGKPQDRKDIRSQKNTKVDFFAVELLDGHLYLLLDMGSGTIKVKATNKKANDGEWCHVD-IQRDGRSGTISVNTKRTPFTASGESEILDLEGDMYLGGLPENR-AGLIL-PTELWTAMLN---------YGYVGCIRDLFIDG----RSKNIRQ--LAEAQNAAGVKSSCSRLSGKQCDSYP--CKNNAACRDGWNRFVCDCTGTGHWGRTCEREASILSY-DGGMYMKIIMPVVMHTEAEDVSLRFKSQRAYGLLVATTSRDSAD----TLRLELDGGKVKLMVNLDCIRINCNSSKGPETLYAGQKLNDNEWHTVRVVRRGKTLKLTVDDDVAEGTMVGDHTRLEFHNIETGFMTE-----KRFASAVPS-----SFIGHLQSLMFNGLLYIDLCKNGDIDYCELK 872          
BLAST of neurexin-1 isoform X19 vs. Ensembl Xenopus
Match: NRXN3 (neurexin 3 [Source:NCBI gene;Acc:100379902])

HSP 1 Score: 348.977 bits (894), Expect = 3.376e-98
Identity = 291/1058 (27.50%), Postives = 490/1058 (46.31%), Query Frame = 1
Query:  226 VATFLQDAYI-YNSINIPTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLTRGEIYFD---KCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAY-------QKSETSQLN-QFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSF-LPHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNF---------GRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEKKYNFSGSSKLLSNDIIAVGKYETDKFSRY----FTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXX-XXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPED----HNYQ---VSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKL--SPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGL 3288
            VATF    Y+ Y+    P  S  D I L FKT+Q    I + G           Y+ + L    + + I    L    F+           DN WH + V+R    + +  G  ++ + VDG +          T L S    + G  P T +D       S + N  NF GC+++++Y  ++  L++   +++ R   T+ +IY D   KC ++  + PISF +  +YI+L  W   + G + F F+T E N L+ +       +K   SQ N + DF+A E+ +  L+  ++ GSG  + K ++   +DG   +V +  +  +  + ++  +     +   + LD   D+Y+GG+PE      LP  LW+ +L  G+VGC+ D+ ++G   ++   AE++N  G+ S CS  ++ K  C + PC +   C  G+NRF+CDC+ T + G TC R A ++ ++G   M I MP    +E EDV+LRF + R  G+ + T SR S  + RLE  L+ GK+ +++N           +G + + +     D  WHT+++ RR  ++ L +DD   +    G    L    I  G     +F+      F G++    FNG+ Y +L K       E+ A  G      + P++F +  SY+ L  +  Y    L F  KT +  G +L   G   D++ +E+V GY++ +          K   E  ++DN WH V++ R+NS + +   ++D+     +A  ++  G  N +    L++    + +  T  +   V S  GF+GC++S  +N            +L+  AL  +G +E   ED     N Q    +C+ + C + G C+QQW    CDC+MT++ G  C+    T  F      ++Y    +   +T  D LA G  T+V     + +    G   D++   +++ K    + + +N+GS    + E S  + DG YH V + RNG  A+LQ+D++      P G T +H          K PF   RT    Q DK   S SG   G+
Sbjct:  242 VATFRGSEYLCYDLSQNPIQSSSDEITLSFKTRQRNGLILHTGKS-------ADYVNLALKGGAVSLVIN---LGSGAFEAIVEPTNDKFNDNEWHEVKVTRN-LRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPST-ADLP----GSPVSN--NFMGCLKEVVYKNNDIRLEL---SRLARIGDTKMKIYGDVVFKCENVATLDPISFESPEAYISLPKWNTKRMGSISFDFRTTEPNGLILFTHGKPQDRKDIRSQKNTKVDFFAVELLDGHLYLLLDMGSGTIKVKATNKKANDGEWCHVDIQRDGRSGTISVNTKRTPFTASGESEILDLEGDMYLGGLPENRAGLILPTELWTAMLNYGYVGCIRDLFIDGRSKNIRQLAEAQNAAGVKSSCS-RLSGK-QCDSYPCKNNAACRDGWNRFVCDCTGTGHWGRTCEREASILSYDGGMYMKIIMPVVMHTEAEDVSLRFKSQRAYGLLVATTSRDSADTLRLE--LDGGKVKLMVNLDCIRINCNSSKGPETLYAGQKLNDNEWHTVRVVRRGKTLKLTVDDDVAEGTMVGDHTRLEFHNIETGFMTEKRFASAVPSSFIGHLQSLMFNGLLYIDLCKNGDIDYCELKARFGMRSIIAD-PVTFRTKASYLTLSTLQAYTSMHLFFQFKTISPDGFILFNSGDGNDFIAVELVKGYIHYVFDLGNGPNVIKGNSERPLNDNQWHNVVITRDNSNTHT--LKVDT-----KAVTQVINGAKNLDLKGELYIAGLVQSMYST--LPKLVASRDGFQGCLASVDLN--------GRLPDLIGDALHRSGQIERGCEDALTKANLQGPTTTCQEDSCANQGVCMQQWEGFTCDCSMTSYSGNHCNDPGATYIFGKSGGLILYTWPHNDRPSTRTDRLAVGFSTTVKEGILVRIDSAPGLM-DYLQLHIVQGK----IGVTFNIGSQDISIREESAPVNDGKYHVVKYTRNGGNATLQVDNWPVNEHYPGGNTELHQKP-------KLPFKISRTPEDGQQDKGL-SISGMEDGI 1243          

HSP 2 Score: 115.546 bits (288), Expect = 4.342e-25
Identity = 208/882 (23.58%), Postives = 340/882 (38.55%), Query Frame = 1
Query:  916 WAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESF--LHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGILR--QGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTD-KGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTC--GRVAPLVKFNGFQQMIINMP-NGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRG--NKIIRSDYNCFDGN-WHTLKLKR--RQLS------VILIIDDM--EKKYNFSGSSKLLSNDIIAVGKYET------DKFSRYFTGYMMHFTF-NGINYFELAKEESPSNIEVTATIGDAEPTKEF--------------PISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSG-------------DYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPI---GERAHIELKA----GGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNL------GSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDN--ISYAGIK 3348
            W  + +  L F  +T  S  LL Y           DF    + +    L FSI+         VS   V+DG  H++ L        + LD + K        + ++   DL++GG+P  + S    +L  G +R    F G LLDI     +  L              G  G   D +GLC   PC + G C++      CDC+ T Y G  C   R   +  F G + +  ++  N  QS  +++TL F T + NG+ + T      ++D + + L+ G +++++N G G    I+    + F+ N WH +K+ R  RQ S      V + +D +     Y     + L S+D   VG   +         S  F G +    + N     EL++          A IGD +  K +              PISF S  +YI LPK +      + F  +T    G +L  +GK               D+  +E++ G+L LL + G+G  K      K +D  W  V  I+ + +S + +      P    GE   ++L+     GGL  N    L L   E + +  N          G+ GCI   +++      +K++ Q  LA A    GV   C      Q    P  C +   C   W R  CDC  T   G  C++ +  L + D   Y+   +    +T  ++++   ++       +     D       + RL  D G+  L++  +        S     + +   + D  +H V   R G    L +DD           T + F+   T ++ +     +R   +V +     SF G+L  L FN +   D+  N  I Y  +K
Sbjct:   43 WDASTRSDLSFQLRTNVSAGLLLYFDDG----GICDFLCLSLADGHVQLRFSIDCAETAI---VSDKKVNDGGWHFLMLSRNRLRTTLVLDGEAKPGEVRPQRQHMNIVSDLFVGGVPSDIRS---GALTLGSVRDMSAFAGYLLDIKYGNTEPRLL-------------GSHGARLDLEGLCTENPCENGGACLLLDGEPTCDCTATGYVGKFCSEAREENVATFRGSEYLCYDLSQNPIQSSSDEITLSFKTRQRNGLILHTGK----SADYVNLALKGGAVSLVINLGSGAFEAIVEPTNDKFNDNEWHEVKVTRNLRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDIRLELSR---------LARIGDTK-MKIYGDVVFKCENVATLDPISFESPEAYISLPKWNTKRMGSISFDFRTTEPNGLILFTHGKPQDRKDIRSQKNTKVDFFAVELLDGHLYLLLDMGSGTIKVKATNKKANDGEWCHVD-IQRDGRSGTISVNTKRTPFTASGESEILDLEGDMYLGGLPENR-AGLIL-PTELWTAMLN---------YGYVGCIRDLFIDG----RSKNIRQ--LAEAQNAAGVKSSCSRLSGKQCDSYP--CKNNAACRDGWNRFVCDCTGTGHWGRTCEREASILSY-DGGMYMKIIMPVVMHTEAEDVSLRFKSQRAYGLLVATTSRDSAD----TLRLELDGGKVKLMVNLDCIRINCNSSKGPETLYAGQKLNDNEWHTVRVVRRGKTLKLTVDDDVAEGTMVGDHTRLEFHNIETGFMTE-----KRFASAVPS-----SFIGHLQSLMFNGLLYIDLCKNGDIDYCELK 852          
BLAST of neurexin-1 isoform X19 vs. Ensembl Mouse
Match: Nrxn1 (neurexin I [Source:MGI Symbol;Acc:MGI:1096391])

HSP 1 Score: 366.696 bits (940), Expect = 9.037e-105
Identity = 288/1057 (27.25%), Postives = 489/1057 (46.26%), Query Frame = 1
Query:  226 VATFLQDAYI-YNSINIPTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAY--------QKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFL-PHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILL-------NFGRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEKKY-NFSGSSKLLSNDIIAVGKYETDKF----SRYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXX-XXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPT--KNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDM 3318
            +ATF    Y  Y+    P  S  D I L FKT Q    + + G           Y+ + L +  + + I    L    F+     +     DN WH + V+R    + +  G  ++ + VDG +          T L S    + G  P T +D       S + N  NF GC+++++Y  ++  L++   AK     +    +   KC ++  + PI+F T  S+I+L  W   + G + F F+T E N L+ +        + ++  Q+ + DF+A E+ +  L+  ++ GSG  + K     V+DG  ++V    +  +  + ++  +         + LD   +LY+GG+PE     + P  +W+ +L  G+VGC+ D+ ++G   D+   AE ++  G+   CS +      C + PC + G C  G+NR++CDCS T Y G +C R A ++ ++G   M I +P    +E EDV+LRF + R  GI + T SR S  + RLE+     KL + L       N  +G + + + YN  D  WHT+++ RR  S+ L +DD +      +G    L    I  G     ++       F G++   TFNG+ Y +L K       E+ A  G      + P++F + +SY+ L  +  Y    L F  KT +  G +L   G   D++++E+V GYL+ +          K      ++DN WH V++ R+ S   +   +ID+     +   ++ AG  N +   +L++G   K   K+  +   V + +GF+GC++S  +N            +L++ AL  NG +E   E  +   +C+ + C + G C+QQW    CDC+MT+F G  C+    T  F+     + YK  P    +T  D LA G  T    +  + +    G   D++   + + K    + +++N+G+    + ES+  I DG YH V F R+G  A+LQ+D +  I   P G+    FN Q TI +G      +  G+          F G LSGLY+N + + +M
Sbjct:  283 IATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKSA-------DYVNLALKNGAVSLVIN---LGSGAFEALVEPVNGKFNDNAWHDVKVTRN-LRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPST-ADLP----GSPVSN--NFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVVAFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDIRQMAEIQSTAGVKPSCSKETAKP--CLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLELDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFHNIETGIITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGFRNIIAD-PVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHT--VKIDT-----KITTQITAGARNLDLKSDLYIGGVAKETYKS--LPKLVHAKEGFQGCLASVDLN--------GRLPDLISDALFCNGQIERGCEGPS--TTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSG-LGDYLELHIHQGK----IGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIG-----GKEQGQ---------PFQGQLSGLYYNGLKVLNM 1280          

HSP 2 Score: 129.413 bits (324), Expect = 1.909e-29
Identity = 206/899 (22.91%), Postives = 349/899 (38.82%), Query Frame = 1
Query:  886 TEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEI-RESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLD-ADKKIEHTNSLYKTLDTTRDLYIGGIPETL-VSFLPHSLWSGILRQGFVGCLLDISVNGDQF------DLALKAESENITGIVSGCSGDVTDKGLCANRPCMDGRCIIGYNRFICDCSRTNYTGDTC----------------------GRVAPLVKFNGFQQMIINMP-NGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGN-----KIIRSDYNCFDGNWHTLKLKR--RQLS------VILIIDDM--EKKYNFSGSSKLLSNDIIAVGKYET------DKFSRYFTGYMMHFTFNG----INYFELAKEESPS-NIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSG-------------DYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKS--SSFAFRIDSQPIGERAHI----ELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLI-------IEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKG-KTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDN 3327
             E  +     W    + ++ F  KT  +  L+ Y   E       DF    + R   L  S +         ++ TPV+DG  H V++  +  N  + +D A+ K     S  + +     L++GG+P  L  + L  +L S   R+ F G + D+ VN  Q       ++ L  E  N  G     +G+  + G+C N     G C +  ++ +CDCSRT + G  C                      G+   +  F G +    ++  N  QS  +++TL F T + NG+ + T      ++D + + L+NG +++++N G G      + +   +N  D  WH +K+ R  RQ S      V + +D +     Y     + L S+D   VG   +         S  F G +    +      +    LAK+  P   I               PI+F +  S+I LPK +      + F  +T    G +L  +GK               D+  +E++ G+L LL + G+G  K    + K++D  W+ V   R+      S    R      GE   +    EL  GGL  N    +F    E + +  N          G+ GCI   +++      +K + Q  +A   +  GV   C ++      C  N C + G C   W R  CDC+ T ++G  C++ +  L + D   ++  +L    +T  ++++   ++       +     D       + RL  D GR  L        I  N   G   L  +  N+ D  +H V   R G    L +DD   +     G  T + F+   T  + +     +R   SV ++     F G+L  L FN +   D+  N
Sbjct:   36 AEGQWTRFPKWNACCESEMSFQLKTRSARGLVLYFDDE----GFCDFLELILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSVRIRRQFRNTTLYIDRAEAKWVEVKSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSSQALPVDGGEVKLDDEPPNSGGGSPCEAGEEGEGGVCLN----GGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAHLMMGDQGKSKGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGK----SADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFN--DNAWHDVKVTRNLRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVVAFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVF--PTEVWTALLN---------YGYVGCIRDLFIDG----QSKDIRQ--MAEIQSTAGVKPSCSKE--TAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSY-DGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSAD----TLRLELDAGRVKLTVNLDCIRINCNSSKGPETLF-AGYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFHNIETGIITE-----RRYLSSVPSN-----FIGHLQSLTFNGMAYIDLCKN 885          
BLAST of neurexin-1 isoform X19 vs. Ensembl Mouse
Match: Nrxn1 (neurexin I [Source:MGI Symbol;Acc:MGI:1096391])

HSP 1 Score: 357.066 bits (915), Expect = 1.976e-101
Identity = 292/1079 (27.06%), Postives = 494/1079 (45.78%), Query Frame = 1
Query:  226 VATFLQDAYI-YNSINIPTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAY--------QKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFL-PHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILL-------NFGRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEKKY-NFSGSSKLLSNDIIAVGKYETDKF----SRYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXX-XXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPT--KNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQN---DK-----TFDS--------------FSGYLSGLYFNRIPLSDM 3318
            +ATF    Y  Y+    P  S  D I L FKT Q    + + G           Y+ + L +  + + I    L    F+     +     DN WH + V+R    + +  G  ++ + VDG +          T L S    + G  P T +D       S + N  NF GC+++++Y  ++  L++   AK     +    +   KC ++  + PI+F T  S+I+L  W   + G + F F+T E N L+ +        + ++  Q+ + DF+A E+ +  L+  ++ GSG  + K     V+DG  ++V    +  +  + ++  +         + LD   +LY+GG+PE     + P  +W+ +L  G+VGC+ D+ ++G   D+   AE ++  G+   CS +      C + PC + G C  G+NR++CDCS T Y G +C R A ++ ++G   M I +P    +E EDV+LRF + R  GI + T SR S  + RLE+     KL + L       N  +G + + + YN  D  WHT+++ RR  S+ L +DD +      +G    L    I  G     ++       F G++   TFNG+ Y +L K       E+ A  G      + P++F + +SY+ L  +  Y    L F  KT +  G +L   G   D++++E+V GYL+ +          K      ++DN WH V++ R+ S   +   +ID+     +   ++ AG  N +   +L++G   K   K+  +   V + +GF+GC++S  +N            +L++ AL  NG +E   E  +   +C+ + C + G C+QQW    CDC+MT+F G  C+    T  F+     + YK  P    +T  D LA G  T    +  + +    G   D++   + + K    + +++N+G+    + ES+  I DG YH V F R+G  A+LQ+D +  I   P G      N++  I   + P+   R GR V     DK      F+S              F G LSGLY+N + + +M
Sbjct:  283 IATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKSA-------DYVNLALKNGAVSLVIN---LGSGAFEALVEPVNGKFNDNAWHDVKVTRN-LRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPST-ADLP----GSPVSN--NFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVVAFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDIRQMAEIQSTAGVKPSCSKETAKP--CLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLELDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFHNIETGIITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGFRNIIAD-PVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHT--VKIDT-----KITTQITAGARNLDLKSDLYIGGVAKETYKS--LPKLVHAKEGFQGCLASVDLN--------GRLPDLISDALFCNGQIERGCEGPS--TTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSG-LGDYLELHIHQGK----IGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGNND---NERLAIARQRIPY---RLGRVVDEWLLDKGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNM 1310          

HSP 2 Score: 129.413 bits (324), Expect = 1.577e-29
Identity = 206/899 (22.91%), Postives = 349/899 (38.82%), Query Frame = 1
Query:  886 TEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEI-RESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLD-ADKKIEHTNSLYKTLDTTRDLYIGGIPETL-VSFLPHSLWSGILRQGFVGCLLDISVNGDQF------DLALKAESENITGIVSGCSGDVTDKGLCANRPCMDGRCIIGYNRFICDCSRTNYTGDTC----------------------GRVAPLVKFNGFQQMIINMP-NGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGN-----KIIRSDYNCFDGNWHTLKLKR--RQLS------VILIIDDM--EKKYNFSGSSKLLSNDIIAVGKYET------DKFSRYFTGYMMHFTFNG----INYFELAKEESPS-NIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSG-------------DYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKS--SSFAFRIDSQPIGERAHI----ELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLI-------IEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKG-KTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDN 3327
             E  +     W    + ++ F  KT  +  L+ Y   E       DF    + R   L  S +         ++ TPV+DG  H V++  +  N  + +D A+ K     S  + +     L++GG+P  L  + L  +L S   R+ F G + D+ VN  Q       ++ L  E  N  G     +G+  + G+C N     G C +  ++ +CDCSRT + G  C                      G+   +  F G +    ++  N  QS  +++TL F T + NG+ + T      ++D + + L+NG +++++N G G      + +   +N  D  WH +K+ R  RQ S      V + +D +     Y     + L S+D   VG   +         S  F G +    +      +    LAK+  P   I               PI+F +  S+I LPK +      + F  +T    G +L  +GK               D+  +E++ G+L LL + G+G  K    + K++D  W+ V   R+      S    R      GE   +    EL  GGL  N    +F    E + +  N          G+ GCI   +++      +K + Q  +A   +  GV   C ++      C  N C + G C   W R  CDC+ T ++G  C++ +  L + D   ++  +L    +T  ++++   ++       +     D       + RL  D GR  L        I  N   G   L  +  N+ D  +H V   R G    L +DD   +     G  T + F+   T  + +     +R   SV ++     F G+L  L FN +   D+  N
Sbjct:   36 AEGQWTRFPKWNACCESEMSFQLKTRSARGLVLYFDDE----GFCDFLELILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSVRIRRQFRNTTLYIDRAEAKWVEVKSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSSQALPVDGGEVKLDDEPPNSGGGSPCEAGEEGEGGVCLN----GGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAHLMMGDQGKSKGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGK----SADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFN--DNAWHDVKVTRNLRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVVAFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVF--PTEVWTALLN---------YGYVGCIRDLFIDG----QSKDIRQ--MAEIQSTAGVKPSCSKE--TAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSY-DGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSAD----TLRLELDAGRVKLTVNLDCIRINCNSSKGPETLF-AGYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFHNIETGIITE-----RRYLSSVPSN-----FIGHLQSLTFNGMAYIDLCKN 885          
BLAST of neurexin-1 isoform X19 vs. Ensembl Mouse
Match: Nrxn1 (neurexin I [Source:MGI Symbol;Acc:MGI:1096391])

HSP 1 Score: 353.984 bits (907), Expect = 2.422e-100
Identity = 289/1082 (26.71%), Postives = 491/1082 (45.38%), Query Frame = 1
Query:  226 VATFLQDAYI-YNSINIPTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGG---MIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAY--------QKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFL-PHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILL-------NFGRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEKKY-NFSGSSKLLSNDIIAVGKYETDKF----SRYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXX-XXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPT--KNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQN---DK-----TFDS--------------FSGYLSGLYFNRIPLSDM 3318
            +ATF    Y  Y+    P  S  D I L FKT Q    + + G           Y+ + L +  + + I    L    F+     +     DN WH + V+R     ++S     +   +   V +     LT T    +  T  G      +  S  +     S + N  NF GC+++++Y  ++  L++   AK     +    +   KC ++  + PI+F T  S+I+L  W   + G + F F+T E N L+ +        + ++  Q+ + DF+A E+ +  L+  ++ GSG  + K     V+DG  ++V    +  +  + ++  +         + LD   +LY+GG+PE     + P  +W+ +L  G+VGC+ D+ ++G   D+   AE ++  G+   CS +      C + PC + G C  G+NR++CDCS T Y G +C R A ++ ++G   M I +P    +E EDV+LRF + R  GI + T SR S  + RLE+     KL + L       N  +G + + + YN  D  WHT+++ RR  S+ L +DD +      +G    L    I  G     ++       F G++   TFNG+ Y +L K       E+ A  G      + P++F + +SY+ L  +  Y    L F  KT +  G +L   G   D++++E+V GYL+ +          K      ++DN WH V++ R+ S   +   +ID+     +   ++ AG  N +   +L++G   K   K+  +   V + +GF+GC++S  +N            +L++ AL  NG +E   E  +   +C+ + C + G C+QQW    CDC+MT+F G  C+    T  F+     + YK  P    +T  D LA G  T    +  + +    G   D++   + + K    + +++N+G+    + ES+  I DG YH V F R+G  A+LQ+D +  I   P G      N++  I   + P+   R GR V     DK      F+S              F G LSGLY+N + + +M
Sbjct:  283 IATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKSA-------DYVNLALKNGAVSLVIN---LGSGAFEALVEPVNGKFNDNAWHDVKVTRNL--RQHSGIGHAMVNKLHCSVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSN--NFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVVAFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDIRQMAEIQSTAGVKPSCSKETAKP--CLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLELDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFHNIETGIITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGFRNIIAD-PVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHT--VKIDT-----KITTQITAGARNLDLKSDLYIGGVAKETYKS--LPKLVHAKEGFQGCLASVDLN--------GRLPDLISDALFCNGQIERGCEGPS--TTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSG-LGDYLELHIHQGK----IGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGNND---NERLAIARQRIPY---RLGRVVDEWLLDKGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNM 1317          

HSP 2 Score: 127.487 bits (319), Expect = 7.338e-29
Identity = 206/907 (22.71%), Postives = 353/907 (38.92%), Query Frame = 1
Query:  886 TEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEI-RESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLD-ADKKIEHTNSLYKTLDTTRDLYIGGIPETL-VSFLPHSLWSGILRQGFVGCLLDISVNGDQF------DLALKAESENITGIVSGCSGDVTDKGLCANRPCMDGRCIIGYNRFICDCSRTNYTGDTC----------------------GRVAPLVKFNGFQQMIINMP-NGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGN-----KIIRSDYNCFDGNWHTLKLKR--RQ-------------LSVILIIDDM--EKKYNFSGSSKLLSNDIIAVGKYET------DKFSRYFTGYMMHFTFNG----INYFELAKEESPSNIEVTATIG-DAEPTKEF-PISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSG-------------DYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKS--SSFAFRIDSQPIGERAHI----ELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLI-------IEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKG-KTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDN 3327
             E  +     W    + ++ F  KT  +  L+ Y   E       DF    + R   L  S +         ++ TPV+DG  H V++  +  N  + +D A+ K     S  + +     L++GG+P  L  + L  +L S   R+ F G + D+ VN  Q       ++ L  E  N  G     +G+  + G+C N     G C +  ++ +CDCSRT + G  C                      G+   +  F G +    ++  N  QS  +++TL F T + NG+ + T      ++D + + L+NG +++++N G G      + +   +N  D  WH +K+ R  RQ              SV + +D +     Y     + L S+D   VG   +         S  F G +    +      +    LAK+  P  +++   +    E      PI+F +  S+I LPK +      + F  +T    G +L  +GK               D+  +E++ G+L LL + G+G  K    + K++D  W+ V   R+      S    R      GE   +    EL  GGL  N    +F    E + +  N          G+ GCI   +++      +K + Q  +A   +  GV   C ++      C  N C + G C   W R  CDC+ T ++G  C++ +  L + D   ++  +L    +T  ++++   ++       +     D       + RL  D GR  L        I  N   G   L  +  N+ D  +H V   R G    L +DD   +     G  T + F+   T  + +     +R   SV ++     F G+L  L FN +   D+  N
Sbjct:   36 AEGQWTRFPKWNACCESEMSFQLKTRSARGLVLYFDDE----GFCDFLELILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSVRIRRQFRNTTLYIDRAEAKWVEVKSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSSQALPVDGGEVKLDDEPPNSGGGSPCEAGEEGEGGVCLN----GGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAHLMMGDQGKSKGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGK----SADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFN--DNAWHDVKVTRNLRQHSGIGHAMVNKLHCSVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDP-KMKIHGVVAFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVF--PTEVWTALLN---------YGYVGCIRDLFIDG----QSKDIRQ--MAEIQSTAGVKPSCSKE--TAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSY-DGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSAD----TLRLELDAGRVKLTVNLDCIRINCNSSKGPETLF-AGYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFHNIETGIITE-----RRYLSSVPSN-----FIGHLQSLTFNGMAYIDLCKN 892          
BLAST of neurexin-1 isoform X19 vs. Ensembl Mouse
Match: Nrxn1 (neurexin I [Source:MGI Symbol;Acc:MGI:1096391])

HSP 1 Score: 352.829 bits (904), Expect = 4.354e-100
Identity = 289/1079 (26.78%), Postives = 488/1079 (45.23%), Query Frame = 1
Query:  226 VATFLQDAYI-YNSINIPTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAY--------QKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFL-PHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILL-------NFGRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEKKY-NFSGSSKLLSNDIIAVGKYETDKF----SRYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXX-XXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPT--KNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQN---DK-----TFDS--------------FSGYLSGLYFNRIPLSDM 3318
            +ATF    Y  Y+    P  S  D I L FKT Q    + + G           Y+ + L +  + + I    L    F+     +     DN WH + V+R       S   ++       +           T L S    + G  P T +D       S + N  NF GC+++++Y  ++  L++   AK     +    +   KC ++  + PI+F T  S+I+L  W   + G + F F+T E N L+ +        + ++  Q+ + DF+A E+ +  L+  ++ GSG  + K     V+DG  ++V    +  +  + ++  +         + LD   +LY+GG+PE     + P  +W+ +L  G+VGC+ D+ ++G   D+   AE ++  G+   CS +      C + PC + G C  G+NR++CDCS T Y G +C R A ++ ++G   M I +P    +E EDV+LRF + R  GI + T SR S  + RLE+     KL + L       N  +G + + + YN  D  WHT+++ RR  S+ L +DD +      +G    L    I  G     ++       F G++   TFNG+ Y +L K       E+ A  G      + P++F + +SY+ L  +  Y    L F  KT +  G +L   G   D++++E+V GYL+ +          K      ++DN WH V++ R+ S   +   +ID+     +   ++ AG  N +   +L++G   K   K+  +   V + +GF+GC++S  +N            +L++ AL  NG +E   E  +   +C+ + C + G C+QQW    CDC+MT+F G  C+    T  F+     + YK  P    +T  D LA G  T    +  + +    G   D++   + + K    + +++N+G+    + ES+  I DG YH V F R+G  A+LQ+D +  I   P G      N++  I   + P+   R GR V     DK      F+S              F G LSGLY+N + + +M
Sbjct:  283 IATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKSA-------DYVNLALKNGAVSLVIN---LGSGAFEALVEPVNGKFNDNAWHDVKVTRNLRQVTISVDGILTTTGYTQED---------YTMLGSDDFFYVGGSPST-ADLP----GSPVSN--NFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVVAFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDIRQMAEIQSTAGVKPSCSKETAKP--CLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLELDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFHNIETGIITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGFRNIIAD-PVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHT--VKIDT-----KITTQITAGARNLDLKSDLYIGGVAKETYKS--LPKLVHAKEGFQGCLASVDLN--------GRLPDLISDALFCNGQIERGCEGPS--TTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSG-LGDYLELHIHQGK----IGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGNND---NERLAIARQRIPY---RLGRVVDEWLLDKGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNM 1302          

HSP 2 Score: 134.035 bits (336), Expect = 6.043e-31
Identity = 203/891 (22.78%), Postives = 346/891 (38.83%), Query Frame = 1
Query:  886 TEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEI-RESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLD-ADKKIEHTNSLYKTLDTTRDLYIGGIPETL-VSFLPHSLWSGILRQGFVGCLLDISVNGDQF------DLALKAESENITGIVSGCSGDVTDKGLCANRPCMDGRCIIGYNRFICDCSRTNYTGDTC----------------------GRVAPLVKFNGFQQMIINMP-NGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGN-----KIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDM--EKKYNFSGSSKLLSNDIIAVGKYET------DKFSRYFTGYMMHFTFNG----INYFELAKEESPS-NIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSG-------------DYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKS--SSFAFRIDSQPIGERAHI----ELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLI-------IEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKG-KTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDN 3327
             E  +     W    + ++ F  KT  +  L+ Y   E       DF    + R   L  S +         ++ TPV+DG  H V++  +  N  + +D A+ K     S  + +     L++GG+P  L  + L  +L S   R+ F G + D+ VN  Q       ++ L  E  N  G     +G+  + G+C N     G C +  ++ +CDCSRT + G  C                      G+   +  F G +    ++  N  QS  +++TL F T + NG+ + T      ++D + + L+NG +++++N G G      + +   +N  D  WH +K+ R    V + +D +     Y     + L S+D   VG   +         S  F G +    +      +    LAK+  P   I               PI+F +  S+I LPK +      + F  +T    G +L  +GK               D+  +E++ G+L LL + G+G  K    + K++D  W+ V   R+      S    R      GE   +    EL  GGL  N    +F    E + +  N          G+ GCI   +++      +K + Q  +A   +  GV   C ++      C  N C + G C   W R  CDC+ T ++G  C++ +  L + D   ++  +L    +T  ++++   ++       +     D       + RL  D GR  L        I  N   G   L  +  N+ D  +H V   R G    L +DD   +     G  T + F+   T  + +     +R   SV ++     F G+L  L FN +   D+  N
Sbjct:   36 AEGQWTRFPKWNACCESEMSFQLKTRSARGLVLYFDDE----GFCDFLELILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSVRIRRQFRNTTLYIDRAEAKWVEVKSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSSQALPVDGGEVKLDDEPPNSGGGSPCEAGEEGEGGVCLN----GGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAHLMMGDQGKSKGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGK----SADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFN--DNAWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVVAFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVF--PTEVWTALLN---------YGYVGCIRDLFIDG----QSKDIRQ--MAEIQSTAGVKPSCSKE--TAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSY-DGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSAD----TLRLELDAGRVKLTVNLDCIRINCNSSKGPETLF-AGYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFHNIETGIITE-----RRYLSSVPSN-----FIGHLQSLTFNGMAYIDLCKN 877          
BLAST of neurexin-1 isoform X19 vs. Ensembl Mouse
Match: Nrxn1 (neurexin I [Source:MGI Symbol;Acc:MGI:1096391])

HSP 1 Score: 352.829 bits (904), Expect = 4.790e-100
Identity = 289/1079 (26.78%), Postives = 488/1079 (45.23%), Query Frame = 1
Query:  226 VATFLQDAYI-YNSINIPTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAY--------QKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFL-PHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILL-------NFGRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEKKY-NFSGSSKLLSNDIIAVGKYETDKF----SRYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXX-XXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPT--KNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQN---DK-----TFDS--------------FSGYLSGLYFNRIPLSDM 3318
            +ATF    Y  Y+    P  S  D I L FKT Q    + + G           Y+ + L +  + + I    L    F+     +     DN WH + V+R       S   ++       +           T L S    + G  P T +D       S + N  NF GC+++++Y  ++  L++   AK     +    +   KC ++  + PI+F T  S+I+L  W   + G + F F+T E N L+ +        + ++  Q+ + DF+A E+ +  L+  ++ GSG  + K     V+DG  ++V    +  +  + ++  +         + LD   +LY+GG+PE     + P  +W+ +L  G+VGC+ D+ ++G   D+   AE ++  G+   CS +      C + PC + G C  G+NR++CDCS T Y G +C R A ++ ++G   M I +P    +E EDV+LRF + R  GI + T SR S  + RLE+     KL + L       N  +G + + + YN  D  WHT+++ RR  S+ L +DD +      +G    L    I  G     ++       F G++   TFNG+ Y +L K       E+ A  G      + P++F + +SY+ L  +  Y    L F  KT +  G +L   G   D++++E+V GYL+ +          K      ++DN WH V++ R+ S   +   +ID+     +   ++ AG  N +   +L++G   K   K+  +   V + +GF+GC++S  +N            +L++ AL  NG +E   E  +   +C+ + C + G C+QQW    CDC+MT+F G  C+    T  F+     + YK  P    +T  D LA G  T    +  + +    G   D++   + + K    + +++N+G+    + ES+  I DG YH V F R+G  A+LQ+D +  I   P G      N++  I   + P+   R GR V     DK      F+S              F G LSGLY+N + + +M
Sbjct:  279 IATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKSA-------DYVNLALKNGAVSLVIN---LGSGAFEALVEPVNGKFNDNAWHDVKVTRNLRQVTISVDGILTTTGYTQED---------YTMLGSDDFFYVGGSPST-ADLP----GSPVSN--NFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVVAFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDIRQMAEIQSTAGVKPSCSKETAKP--CLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLELDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFHNIETGIITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGFRNIIAD-PVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHT--VKIDT-----KITTQITAGARNLDLKSDLYIGGVAKETYKS--LPKLVHAKEGFQGCLASVDLN--------GRLPDLISDALFCNGQIERGCEGPS--TTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSG-LGDYLELHIHQGK----IGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGNND---NERLAIARQRIPY---RLGRVVDEWLLDKGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNM 1298          

HSP 2 Score: 135.576 bits (340), Expect = 1.954e-31
Identity = 203/887 (22.89%), Postives = 346/887 (39.01%), Query Frame = 1
Query:  886 TEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEI-RESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLD-ADKKIEHTNSLYKTLDTTRDLYIGGIPETL-VSFLPHSLWSGILRQGFVGCLLDISVNGDQF------DLALKAESENITGIVSGCSGDVTDKGLCANRPCMDGRCIIGYNRFICDCSRTNYTGDTC------------------GRVAPLVKFNGFQQMIINMP-NGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGN-----KIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDM--EKKYNFSGSSKLLSNDIIAVGKYET------DKFSRYFTGYMMHFTFNG----INYFELAKEESPS-NIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSG-------------DYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKS--SSFAFRIDSQPIGERAHI----ELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLI-------IEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKG-KTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDN 3327
             E  +     W    + ++ F  KT  +  L+ Y   E       DF    + R   L  S +         ++ TPV+DG  H V++  +  N  + +D A+ K     S  + +     L++GG+P  L  + L  +L S   R+ F G + D+ VN  Q       ++ L  E  N  G     +G+  + G+C N     G C +  ++ +CDCSRT + G  C                  G+   +  F G +    ++  N  QS  +++TL F T + NG+ + T      ++D + + L+NG +++++N G G      + +   +N  D  WH +K+ R    V + +D +     Y     + L S+D   VG   +         S  F G +    +      +    LAK+  P   I               PI+F +  S+I LPK +      + F  +T    G +L  +GK               D+  +E++ G+L LL + G+G  K    + K++D  W+ V   R+      S    R      GE   +    EL  GGL  N    +F    E + +  N          G+ GCI   +++      +K + Q  +A   +  GV   C ++      C  N C + G C   W R  CDC+ T ++G  C++ +  L + D   ++  +L    +T  ++++   ++       +     D       + RL  D GR  L        I  N   G   L  +  N+ D  +H V   R G    L +DD   +     G  T + F+   T  + +     +R   SV ++     F G+L  L FN +   D+  N
Sbjct:   36 AEGQWTRFPKWNACCESEMSFQLKTRSARGLVLYFDDE----GFCDFLELILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSVRIRRQFRNTTLYIDRAEAKWVEVKSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSSQALPVDGGEVKLDDEPPNSGGGSPCEAGEEGEGGVCLN----GGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAHLMMGDQGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGK----SADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFN--DNAWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVVAFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVF--PTEVWTALLN---------YGYVGCIRDLFIDG----QSKDIRQ--MAEIQSTAGVKPSCSKE--TAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSY-DGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSAD----TLRLELDAGRVKLTVNLDCIRINCNSSKGPETLF-AGYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFHNIETGIITE-----RRYLSSVPSN-----FIGHLQSLTFNGMAYIDLCKN 873          
BLAST of neurexin-1 isoform X19 vs. UniProt/SwissProt
Match: sp|Q9ULB1|NRX1A_HUMAN (Neurexin-1 OS=Homo sapiens OX=9606 GN=NRXN1 PE=1 SV=1)

HSP 1 Score: 366.311 bits (939), Expect = 6.949e-104
Identity = 317/1236 (25.65%), Postives = 552/1236 (44.66%), Query Frame = 1
Query:  226 VATFLQDAYI-YNSINIPTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAY--------QKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFL-PHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILL-------NFGRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEKKYN-FSGSSKLLSNDIIAVGKYETDKF----SRYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXX-XXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPT--KNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDNISYAGIKLLNRSNVYVENKFIPNFQSKQS----ILSEQGXXXXXXXXXXXXIVVAKSNCSNIEPLHNLDCKVSDSAGIIRPIVSYKINTVTHSQKI-TTTPDNDIYTENTKSESSTIYK-SLEINNSGVINIWLIIGFSVGGSLLLVFITCFIYRCFRKDEGSYNVEDDHIFIDPS 3837
            +ATF    Y  Y+    P  S  D I L FKT Q    + + G           Y+ + L +  + + I    L    F+     +     DN WH + V+R    + +  G  ++ + VDG +          T L S    + G  P T +D       S + N  NF GC+++++Y  ++  L++   AK     +    +   KC ++  + PI+F T  S+I+L  W   + G + F F+T E N L+ +        + ++  Q+ + DF+A E+ +  L+  ++ GSG  + K     V+DG  ++V    +  +  + ++  +         + LD   +LY+GG+PE     + P  +W+ +L  G+VGC+ D+ ++G   D+   AE ++  G+   CS +      C + PC + G C  G+NR++CDCS T Y G +C R A ++ ++G   M I +P    +E EDV+LRF + R  GI + T SR S  + RLE+     KL + L       N  +G + + + YN  D  WHT+++ RR  S+ L +DD +      +G    L    I  G     ++       F G++   TFNG+ Y +L K       E+ A  G      + P++F + +SY+ L  +  Y    L F  KT +  G +L   G   D++++E+V GYL+ +          K      ++DN WH V++ R+ S   +   +ID+     +   ++ AG  N +   +L++G   K   K+  +   V + +GF+GC++S  +N            +L++ AL  NG +E   E  +   +C+ + C + G C+QQW    CDC+MT+F G  C+    T  F+     + YK  P    +T  D LA G  T    +  + +    G   D++   + + K    + +++N+G+    + ES+  I DG YH V F R+G  A+LQ+D +  I   P G+    FN Q TI +G      +  G+          F G LSGLY+N + + +M    + A I ++    +  E   +P+  + +S    + SE        T         +      EP+     + +D       I+       +  + I    P +      T++     Y  S E+         +++G     +L ++ +   +Y+   +DEGSY+V++   +I  S
Sbjct:  283 IATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKSA-------DYVNLALKNGAVSLVIN---LGSGAFEALVEPVNGKFNDNAWHDVKVTRN-LRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPST-ADLP----GSPVSN--NFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVVAFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALLKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDIRQMAEVQSTAGVKPSCSKETAKP--CLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLELDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFHNIETGIITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGFRNIIAD-PVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHT--VKIDT-----KITTQITAGARNLDLKSDLYIGGVAKETYKS--LPKLVHAKEGFQGCLASVDLN--------GRLPDLISDALFCNGQIERGCEGPS--TTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSG-LGDYLELHIHQGK----IGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIG-----GKEQGQ---------PFQGQLSGLYYNGLKVLNMAAE-NDANIAIVGNVRLVGE---VPSSMTTESTATAMQSEMSTSIMETTTTLATSTARRGKPPTKEPIS----QTTDD------ILVASAECPSDDEDIDPCEPSSGGLANPTRAGGREPYPGSAEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYHVDESRNYISNS 1445          

HSP 2 Score: 125.561 bits (314), Expect = 1.715e-27
Identity = 205/899 (22.80%), Postives = 347/899 (38.60%), Query Frame = 1
Query:  886 TEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEI-RESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLD-ADKKIEHTNSLYKTLDTTRDLYIGGIPETL-VSFLPHSLWSGILRQGFVGCLLDISVNGDQF------DLALKAESENITGIVSGCSGDVTDKGLCANRPCMDGRCIIGYNRFICDCSRTNYTGDTC----------------------GRVAPLVKFNGFQQMIINMP-NGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGN-----KIIRSDYNCFDGNWHTLKLKR--RQLS------VILIIDDM--EKKYNFSGSSKLLSNDIIAVGKYET------DKFSRYFTGYMMHFTFNG----INYFELAKEESPS-NIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSG-------------DYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKS--SSFAFRIDSQPIGERAHI----ELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLI-------IEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKG-KTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDN 3327
             E  +     W    + ++ F  KT  +  L+ Y   E       DF    + R   L  S +         ++ TPV+DG  H V++  +  N  + +D  + K     S  + +     L++GG+P  L  + L  +L S   R+ F G + D+ VN  Q       ++ L  E  N  G     +G+  + G+C N     G C +  ++ +CDCSRT + G  C                      G+   +  F G +    ++  N  QS  +++TL F T + NG+ + T      ++D + + L+NG +++++N G G      + +   +N  D  WH +K+ R  RQ S      V + +D +     Y     + L S+D   VG   +         S  F G +    +      +    LAK+  P   I               PI+F +  S+I LPK +      + F  +T    G +L  +GK               D+  +E++ G+L LL + G+G  K      K++D  W+ V   R+      S    R      GE   +    EL  GGL  N    +F    E + +  N          G+ GCI   +++      +K + Q  +A   +  GV   C ++      C  N C + G C   W R  CDC+ T ++G  C++ +  L + D   ++  +L    +T  ++++   ++       +     D       + RL  D GR  L        I  N   G   L  +  N+ D  +H V   R G    L +DD   +     G  T + F+   T  + +     +R   SV ++     F G+L  L FN +   D+  N
Sbjct:   36 AEGQWTRFPKWNACCESEMSFQLKTRSARGLVLYFDDE----GFCDFLELILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSVRIRRQFRNTTLFIDQVEAKWVEVKSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSSQVLPVDSGEVKLDDEPPNSGGGSPCEAGEEGEGGVCLN----GGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAHLMMGDQGKSKGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGK----SADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFN--DNAWHDVKVTRNLRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVVAFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALLKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVF--PTEVWTALLN---------YGYVGCIRDLFIDG----QSKDIRQ--MAEVQSTAGVKPSCSKE--TAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSY-DGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSAD----TLRLELDAGRVKLTVNLDCIRINCNSSKGPETLF-AGYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFHNIETGIITE-----RRYLSSVPSN-----FIGHLQSLTFNGMAYIDLCKN 885          
BLAST of neurexin-1 isoform X19 vs. UniProt/SwissProt
Match: sp|A1XQX0|NR1AA_DANRE (Neurexin-1a OS=Danio rerio OX=7955 GN=nrxn1a PE=2 SV=1)

HSP 1 Score: 361.688 bits (927), Expect = 3.017e-102
Identity = 322/1285 (25.06%), Postives = 560/1285 (43.58%), Query Frame = 1
Query:  226 VATFLQDAYI-YNSINIPTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGG---MIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQ----------FDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFL-PHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNF---------GRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEK-KYNFSGSSKLLSNDIIAVGKYETDKF----SRYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXXXXXXXXXXK-KVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPT--KNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQN-----------------------DKTFDSFSGYLSGLYFNRIPLSDMIDNISYAGIKLLNRS-----NVYVENKFIPNFQSKQSILSEQGXXXXXXXXXXXXIVVAKSNCSNIEPLHNLDCKVSDSAGIIRPIVSYKINTVTHSQ-KITTTPDNDIYTENTKSES----------------------STIYKSLEINNSGVINIWLIIGFSVGGSLLLVFITCFIYRCFRKDEGSYNVEDDHIFI 3828
            +ATF    Y  Y+    P  S  D I L FKT Q    + + G           Y+ + L +  + + I    L    F+     +     DN WH + V+R     ++S     +   +   V +     LT T    +  T  G      +  S  +     S + N  NF GC+++++Y  ++  L++   AK+    +    +   KC ++  + P++F T  S+ITL  W+  + G + F F+T E N LL +   +     Q           DF+A E+ +  L+  ++ GSG  + +  +  V+DG  ++V    +  +  + +++ +   +     + LD    LY+GG+PE     + P  +W+ +L  G+VGC+ D+ ++G   D+   AE++   G+   CS +   +  C + PC++ G C  G+NR++CDCS T Y G +C R A ++ ++G + M I +P    +E EDV+LRF + R  G+ + T S+ S  + RLE  L+ G++ + +N           +G + I S  N  D  WHT+++ RR  S+ L++DD++  +   +G    L    +  G     ++       F G++   +FNG++Y +L K       E+ A IG      + P++F S +SY+ LP +  Y    L F  KT +  G +L   G   D++++E+V GYL+ + + GNG +  K      ++DN WH V++ R+ +   +   +ID+     +   +   G  N +   +L++G   K + K   +   V S +GF+GC++S  +N            +L + AL+  G VE   E  +   +C+ + C + G C+QQW    CDC+MT++ G  C+    T  F      ++Y   P    +T  D LA G  T    +  + +    G   D++  ++     R  + + +N+G+    + E+S  + DG YH V F R+G  A+LQ+DD   I   P G      N++  I   + P+   R GR V +                       +K    F G LSGLY+N              G+K+LN +     NV VE           S ++ Q              V A  N S   P                 I      T ++ Q K TTTP +D+   + +  S                      +  Y S E+         +++G     +L ++ +   +Y+   +DEGSY+V++   +I
Sbjct:  263 MATFKGSEYFCYDLSPNPIQSSSDEITLSFKTLQRNGLMLHTGKS-------ADYVNLALKNGAVSLVIN---LGSGAFEALVEPVNGKFNDNAWHDVKVTRNL--RQHSGIGHAMVNKLHCSVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSN--NFMGCLKEVVYKNNDVRLELSRLAKLGDPKMKVSGVVAFKCENVATLDPVTFETPESFITLDKWSAKKAGSISFDFRTTEPNGLLLFSHGKPKPQQQKDPKSPKTLKVDFFAIEMLDGHLYLLLDMGSGTTKTRAVNKKVNDGEWYHVDFQRDGRSGTISVNSIRTPYNAPGESEILDLDDKLYLGGLPEDRAGLIFPTEVWTALLNYGYVGCVRDLFMDGQSKDIRRIAEAQRAVGVKPSCSKEPPKQ--CLSNPCLNSGTCREGWNRYVCDCSGTGYLGRSCERDATILSYDGSKFMKIQLPVVMHTEAEDVSLRFRSQRAYGVLMATTSQNSADTLRLE--LDGGRVRLTVNLDCIRINCTTSKGPETIFSGQNLNDNEWHTVRVVRRGKSLKLMVDDLQPSEGQITGDHTQLEFHNVETGIVTEKRYMPAVPSNFIGHLQGLSFNGMSYIDLCKNGDIDYCELNAMIGYRSIVAD-PVTFKSRSSYVTLPTLQAYYSMHLFFQFKTTSPDGLILYNRGDGNDFIVVELVKGYLHYVSDLGNGAHLIKGNSNTPLNDNHWHNVMISRDTNNLHT--VKIDT-----KITTQTTMGAKNLDLKGDLYVGGVAKDMYK--DLPKLVHSKEGFQGCLASVDLN--------GRLPDLQSDALSTAGQVERGCEGPS--TTCQEDSCSNQGVCLQQWEGFSCDCSMTSYGGPLCNDPGTTYIFGRDGGLIVYTWPPNDRPSTRADRLAVGFSTQQKDAVLVRVDSSSG-LGDYLQLQIE----RGNIKVVFNVGTDDINIEETSKFVNDGKYHIVRFTRSGGNATLQVDDLPVIERYPSGNID---NERLAIARQRIPY---RLGRVVDDWLLDKGRQLTIFNSQTTIKIGGWEKGSRPFQGQLSGLYYN--------------GLKVLNMAAEGDPNVRVEGSARLVGDMPSSSITPQSS------------VSAAGNRSETSP----------------SITDITTTTASNRQGKQTTTPQDDLLVASAECPSDDEDIDPCDPSSGGLAHPPLPEAKGYPSPEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYHVDESRNYI 1456          

HSP 2 Score: 116.701 bits (291), Expect = 9.687e-25
Identity = 204/907 (22.49%), Postives = 348/907 (38.37%), Query Frame = 1
Query:  874 ISFT-TEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGILRQ-GFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMDGR-CIIGYNRFICDCSRTNYTGDTC-------GRVAPLV---------------KFNGFQQMIINM-PNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGN-----KIIRSDYNCFDGNWHTLKLKR--RQ-------------LSVILIIDDM--EKKYNFSGSSKLLSNDIIAVGKYET------DKFSRYFTGYMMHFTFNG----INYFELAKEESPSNIEVTATIG-DAEPTKEF-PISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSG---------------DYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKS--SSFAFRIDSQPIGERAHIELK----AGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMN-QTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNL------GSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKG-KTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDN 3327
            + FT  E  +     W    + ++ F+ KT  ++ LL Y   E       DF    I    L    +          S T V+D   H V L     N  + +D + K     S  + +     L++GGIP  L S       S I  +  + G + ++ VNG          SE +     G + D+ +    A+  C++G  C I  +  ICDCS T + G  C       G +A L+                F G +    ++ PN  QS  +++TL F T + NG+ + T      ++D + + L+NG +++++N G G      + +   +N  D  WH +K+ R  RQ              SV + +D +     Y     + L S+D   VG   +         S  F G +    +      +    LAK   P  ++V+  +    E      P++F +  S+I L K        + F  +T    G +L  +GK                 D+  +E++ G+L LL + G+G  K      K++D  W+ V   R+      S  + R      GE   ++L      GGL  +    +F    E + +  N          G+ GC+   +M+ Q+K +   +  Q  +       GV   C ++   Q  C  N C + G C + W R  CDC+ T ++G  C++ +  L + D   ++  +L    +T  ++++   ++       +        Q+   + RL  D GR  L +  +        S     + S  N+ D  +H V   R G    L +DD         G  T + F+   T  V +     +R   +V ++     F G+L GL FN +   D+  N
Sbjct:   28 MEFTGAEGQWARFPMWNACCESEMSFNMKTKSAHGLLVYFDDE----GFCDFLELLIHNGRLSLRFSIFCAEPATVFSDTAVNDSRWHAVTLRRNFKNTTLVVDEEIKWVEVKSKRRDMTVFSHLFLGGIPPELRSVALRLTSSAIKDEVPYKGWITNLRVNG----------SEPVLIGSDGVNSDICE----ADHICLNGGVCSIVNDEPICDCSETGFQGKDCSEEEAYVGGLAHLMMGDQGKRKEREEYMATFKGSEYFCYDLSPNPIQSSSDEITLSFKTLQRNGLMLHTGK----SADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFN--DNAWHDVKVTRNLRQHSGIGHAMVNKLHCSVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKLGDP-KMKVSGVVAFKCENVATLDPVTFETPESFITLDKWSAKKAGSISFDFRTTEPNGLLLFSHGKPKPQQQKDPKSPKTLKVDFFAIEMLDGHLYLLLDMGSGTTKTRAVNKKVNDGEWYHVDFQRDGRSGTISVNSIRTPYNAPGESEILDLDDKLYLGGLPEDRAGLIF--PTEVWTALLN---------YGYVGCVRDLFMDGQSKDIRRIAEAQRAV-------GVKPSCSKEPPKQ--CLSNPCLNSGTCREGWNRYVCDCSGTGYLGRSCERDATILSY-DGSKFMKIQLPVVMHTEAEDVSLRFRSQRAYGVLMATT----SQNSADTLRLELDGGRVRLTVNLDCIRINCTTSKGPETIFSGQNLNDNEWHTVRVVRRGKSLKLMVDDLQPSEGQITGDHTQLEFHNVETGIVTE-----KRYMPAVPSN-----FIGHLQGLSFNGMSYIDLCKN 874          
BLAST of neurexin-1 isoform X19 vs. UniProt/SwissProt
Match: sp|Q28146|NRX1A_BOVIN (Neurexin-1 OS=Bos taurus OX=9913 GN=NRXN1 PE=1 SV=1)

HSP 1 Score: 356.681 bits (914), Expect = 1.836e-100
Identity = 316/1258 (25.12%), Postives = 556/1258 (44.20%), Query Frame = 1
Query:  226 VATFLQDAYI-YNSINIPTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSG-QLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGG---MIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAY--------QKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFL-PHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILL-------NFGRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEKKY-NFSGSSKLLSNDIIAVGKYETDKF----SRYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXX-XXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPT--KNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQN---DK-----TFDS--------------FSGYLSGLYFNRIPLSDMIDNISYAGIKLLNRSNVYVENKFIPNFQSKQSILSEQGXXXXXXXXXXXXIVVAKSNCSNIEPLHNLDCKVSDSAGIIRPIVSYKINTVTHSQKI-TTTPDNDIYTENTKSESSTIYK-SLEINNSGVINIWLIIGFSVGGSLLLVFITCFIYRCFRKDEGSYNVEDDHIFIDPS 3837
            +ATF    Y  Y+    P  S  D I L FKT Q    + + G           Y+ + L +  + + I    L    F+     +     DN WH + V+R   + + +SG    +   +   V +     LT T    +  T  G      +  S  +     S + N  NF GC+++++Y  ++  L++   AK     +    +   KC ++  + PI+F T  S+I+L  W   + G + F F+T E N L+ +        + ++  Q+ + DF+A E+ +  L+  ++ GSG  + K     V+DG  ++V    +  +  + ++  +         + LD   +LY+GG+PE     + P  +W+ +L  G+VGC+ D+ ++G   D+   AE ++  G+   CS +      C + PC + G C  G+NR++CDCS T Y G +C R A ++ ++G   M I +P    +E EDV+LRF + R  GI + T SR S  + RLE+     KL + L       N  +G + + + YN  D  WHT+++ RR  S+ L +DD +      +G    L    I  G     ++       F G++   TFNG+ Y +L K       E+ A  G      + P++F + +SY+ L  +  Y    L F  KT +  G +L   G   D++++E+V GYL+ +          K      ++DN WH V++ R+ S   +   +ID+     +   ++ AG  N +   +L++G   K   K+  +   V + +GF+GC++S  +N            +L++ AL  NG +E   E  +   +C+ + C + G C+QQW  I CDC+MT+F G  C+    T  F+     + YK  P    +T  D LA G  T    +  + +    G   D++   + + K    + +++N+G+    + ES+  I DG YH V F R+G  A+LQ+D +  I   P G      N++  I   + P+   R GR V     DK      F+S              F G LSGLY+N + + +M    + A I ++    +  E   +P+  + +S  +    + +    +    +   +      P      + +D       I+       +  + I    P +      T++     Y  S E+         +++G     +L ++ +   +Y+   +DEGSY+V++   +I  S
Sbjct:  299 IATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKSA-------DYVNLALKNGAVSLVIN---LGSGAFEALVEPVNGKFNDNAWHDVKVTR---NLRQTSGIGHAMVNKLHCSVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSN--NFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVVAFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESQILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDIRQMAEVQSTAGVKPSCSRETAKP--CLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLELDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFHNIETGIITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGFRNIIAD-PVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHT--VKIDT-----KITTQITAGARNLDLKSDLYIGGVAKETYKS--LPKLVHAKEGFQGCLASVDLN--------GRLPDLISDALFCNGQIERGCEGPS--TTCQEDSCSNQGVCLQQWDGISCDCSMTSFSGPLCNDPGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSG-LGDYLELHIHQGK----IGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGNND---NERLAIARQRIPY---RLGRVVDEWLLDKGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAE-NDANIAIVGNVRLVGE---VPSSMTTESTATAMQSEMSTSIMETTTTLATSTARRGKPPTKEPVSQTTDD------ILVASAECPSDDEDIDPCEPSSGGLANPTRAGGREPYPGSAEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYHVDESRNYISNS 1498          

HSP 2 Score: 119.013 bits (297), Expect = 1.850e-25
Identity = 205/922 (22.23%), Postives = 347/922 (37.64%), Query Frame = 1
Query:  886 TEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEI-RESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLD-ADKKIEHTNSLYKTLDTTRDLYIGGIPETL-VSFLPHSLWSGILRQGFVGCLLDISVNG------DQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMDGRCIIGYNRFICDCSRTNYTGDTC--------------------------------------GRVAPLVKFNGFQQMIINMP-NGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGN-----KIIRSDYNCFDGNWHTLKLKR--RQ-------------LSVILIIDDM--EKKYNFSGSSKLLSNDIIAVGKYET------DKFSRYFTGYMMHFTFNG----INYFELAKEESPS-NIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSG-------------DYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKS--SSFAFRIDSQPIGERAHI----ELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLI-------IEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKG-KTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDN 3327
             E  +     W    + ++ F  KT  +  L+ Y   E       DF    + R   L  S +         ++ TPV+DG  H V++  +  N  + +D  + K     S  + +     L++GG+P  L  + L  +L S   R+ F G + D+ VN       D  ++ L  E  N  G     +G+  + G+C N     G C +  ++ +CDCSRT + G  C                                      G+   +  F G +    ++  N  QS  +++TL F T + NG+ + T      ++D + + L+NG +++++N G G      + +   +N  D  WH +K+ R  RQ              SV + +D +     Y     + L S+D   VG   +         S  F G +    +      +    LAK+  P   I               PI+F +  S+I LPK +      + F  +T    G +L  +GK               D+  +E++ G+L LL + G+G  K    + K++D  W+ V   R+      S    R      GE   +    EL  GGL  N    +F    E + +  N          G+ GCI   +++      +K + Q  +A   +  GV   C  +      C  N C + G C   W R  CDC+ T ++G  C++ +  L + D   ++  +L    +T  ++++   ++       +     D       + RL  D GR  L        I  N   G   L  +  N+ D  +H V   R G    L +DD   +     G  T + F+   T  + +     +R   SV ++     F G+L  L FN +   D+  N
Sbjct:   36 AEGQWTRFPKWNACCESEMSFQLKTRSARGLVLYFDDE----GFCDFLELILTRGGRLQLSFSIFCAEPATLLTDTPVNDGAWHNVRIRRQFRNTTLFIDQVEAKWVEVKSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSSLALPVDSGEVKLDDEPPNSGGGSPCEAGEEGEGGVCLN----GGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAHLMMGDQGKSKEDNNVEGLAHLMMGDQGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGK----SADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFN--DNAWHDVKVTRNLRQTSGIGHAMVNKLHCSVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVVAFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESQILDLDDELYLGGLPENKAGLVF--PTEVWTALLN---------YGYVGCIRDLFIDG----QSKDIRQ--MAEVQSTAGVKPSCSRE--TAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSY-DGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSAD----TLRLELDAGRVKLTVNLDCIRINCNSSKGPETLF-AGYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFHNIETGIITE-----RRYLSSVPSN-----FIGHLQSLTFNGMAYIDLCKN 908          
BLAST of neurexin-1 isoform X19 vs. UniProt/SwissProt
Match: sp|Q9CS84|NRX1A_MOUSE (Neurexin-1 OS=Mus musculus OX=10090 GN=Nrxn1 PE=1 SV=3)

HSP 1 Score: 353.984 bits (907), Expect = 1.694e-99
Identity = 289/1082 (26.71%), Postives = 491/1082 (45.38%), Query Frame = 1
Query:  226 VATFLQDAYI-YNSINIPTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGG---MIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAY--------QKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFL-PHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILL-------NFGRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEKKY-NFSGSSKLLSNDIIAVGKYETDKF----SRYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXX-XXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPT--KNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQN---DK-----TFDS--------------FSGYLSGLYFNRIPLSDM 3318
            +ATF    Y  Y+    P  S  D I L FKT Q    + + G           Y+ + L +  + + I    L    F+     +     DN WH + V+R     ++S     +   +   V +     LT T    +  T  G      +  S  +     S + N  NF GC+++++Y  ++  L++   AK     +    +   KC ++  + PI+F T  S+I+L  W   + G + F F+T E N L+ +        + ++  Q+ + DF+A E+ +  L+  ++ GSG  + K     V+DG  ++V    +  +  + ++  +         + LD   +LY+GG+PE     + P  +W+ +L  G+VGC+ D+ ++G   D+   AE ++  G+   CS +      C + PC + G C  G+NR++CDCS T Y G +C R A ++ ++G   M I +P    +E EDV+LRF + R  GI + T SR S  + RLE+     KL + L       N  +G + + + YN  D  WHT+++ RR  S+ L +DD +      +G    L    I  G     ++       F G++   TFNG+ Y +L K       E+ A  G      + P++F + +SY+ L  +  Y    L F  KT +  G +L   G   D++++E+V GYL+ +          K      ++DN WH V++ R+ S   +   +ID+     +   ++ AG  N +   +L++G   K   K+  +   V + +GF+GC++S  +N            +L++ AL  NG +E   E  +   +C+ + C + G C+QQW    CDC+MT+F G  C+    T  F+     + YK  P    +T  D LA G  T    +  + +    G   D++   + + K    + +++N+G+    + ES+  I DG YH V F R+G  A+LQ+D +  I   P G      N++  I   + P+   R GR V     DK      F+S              F G LSGLY+N + + +M
Sbjct:  283 IATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKSA-------DYVNLALKNGAVSLVIN---LGSGAFEALVEPVNGKFNDNAWHDVKVTRNL--RQHSGIGHAMVNKLHCSVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSN--NFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVVAFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDIRQMAEIQSTAGVKPSCSKETAKP--CLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLELDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFHNIETGIITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGFRNIIAD-PVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHT--VKIDT-----KITTQITAGARNLDLKSDLYIGGVAKETYKS--LPKLVHAKEGFQGCLASVDLN--------GRLPDLISDALFCNGQIERGCEGPS--TTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSG-LGDYLELHIHQGK----IGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGNND---NERLAIARQRIPY---RLGRVVDEWLLDKGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNM 1317          

HSP 2 Score: 127.487 bits (319), Expect = 5.133e-28
Identity = 206/907 (22.71%), Postives = 353/907 (38.92%), Query Frame = 1
Query:  886 TEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEI-RESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLD-ADKKIEHTNSLYKTLDTTRDLYIGGIPETL-VSFLPHSLWSGILRQGFVGCLLDISVNGDQF------DLALKAESENITGIVSGCSGDVTDKGLCANRPCMDGRCIIGYNRFICDCSRTNYTGDTC----------------------GRVAPLVKFNGFQQMIINMP-NGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGN-----KIIRSDYNCFDGNWHTLKLKR--RQ-------------LSVILIIDDM--EKKYNFSGSSKLLSNDIIAVGKYET------DKFSRYFTGYMMHFTFNG----INYFELAKEESPSNIEVTATIG-DAEPTKEF-PISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSG-------------DYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKS--SSFAFRIDSQPIGERAHI----ELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLI-------IEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKG-KTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDN 3327
             E  +     W    + ++ F  KT  +  L+ Y   E       DF    + R   L  S +         ++ TPV+DG  H V++  +  N  + +D A+ K     S  + +     L++GG+P  L  + L  +L S   R+ F G + D+ VN  Q       ++ L  E  N  G     +G+  + G+C N     G C +  ++ +CDCSRT + G  C                      G+   +  F G +    ++  N  QS  +++TL F T + NG+ + T      ++D + + L+NG +++++N G G      + +   +N  D  WH +K+ R  RQ              SV + +D +     Y     + L S+D   VG   +         S  F G +    +      +    LAK+  P  +++   +    E      PI+F +  S+I LPK +      + F  +T    G +L  +GK               D+  +E++ G+L LL + G+G  K    + K++D  W+ V   R+      S    R      GE   +    EL  GGL  N    +F    E + +  N          G+ GCI   +++      +K + Q  +A   +  GV   C ++      C  N C + G C   W R  CDC+ T ++G  C++ +  L + D   ++  +L    +T  ++++   ++       +     D       + RL  D GR  L        I  N   G   L  +  N+ D  +H V   R G    L +DD   +     G  T + F+   T  + +     +R   SV ++     F G+L  L FN +   D+  N
Sbjct:   36 AEGQWTRFPKWNACCESEMSFQLKTRSARGLVLYFDDE----GFCDFLELILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSVRIRRQFRNTTLYIDRAEAKWVEVKSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSSQALPVDGGEVKLDDEPPNSGGGSPCEAGEEGEGGVCLN----GGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAHLMMGDQGKSKGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGK----SADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFN--DNAWHDVKVTRNLRQHSGIGHAMVNKLHCSVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDP-KMKIHGVVAFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVF--PTEVWTALLN---------YGYVGCIRDLFIDG----QSKDIRQ--MAEIQSTAGVKPSCSKE--TAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSY-DGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSAD----TLRLELDAGRVKLTVNLDCIRINCNSSKGPETLF-AGYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFHNIETGIITE-----RRYLSSVPSN-----FIGHLQSLTFNGMAYIDLCKN 892          
BLAST of neurexin-1 isoform X19 vs. UniProt/SwissProt
Match: sp|A1XQY1|NR3BA_DANRE (Neurexin-3b OS=Danio rerio OX=7955 GN=nrxn3b PE=2 SV=1)

HSP 1 Score: 353.984 bits (907), Expect = 3.590e-99
Identity = 287/1087 (26.40%), Postives = 501/1087 (46.09%), Query Frame = 1
Query:  193 IIHTGTTEEIPVATFLQDAYI-YNSINIPTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGG---MIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLT-RGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAY--------QKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSF-LPHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMDGRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEKKYNFSGSSKLLSNDIIAVGKYETDKFSRY----FTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXX-XXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRID----SQPIGERAHIELKA----GGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTK--NTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIH-FNQQRTIYVGKYPFP---------------NQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDM 3318
            ++ +    E  VATF    Y  Y+    P  S  D I L FKT Q    I + G           Y+ + L D  + + I    L    F+     +     DN WH I V+R     ++S     +   +   V +     LT T    +  T  G      +  S  +     S + N  NF GC+++++Y  ++  L++   A+I    +  +G+I F KC ++  + PISF T  S++ L  W   + G + F F+T E N L+ +        + S + + N+ DF+A E+ +  L+  ++ GSG  + K +   V+DG+ H+V +  +  +  + +++ +     +   + LD   +LY+GG+P+      LP  LW+ +L  G+VGC+ D+ ++G   D+   AE++N+ GI S CS  VT K   +N    +G C  G+NRFICDC+ T Y   TC R A ++ ++G   M + MP    +E EDV+LRF++ R  G+ +   SR S  + RLE  L++G++ +++N G+G + + +     D +WH++++ RR  ++ L++DD   +   +G    L    +  G     +F+      F G++    FNG+ Y ++ K       E+ A  G      + P++F +  SY+ L  +  Y    L F  KT +  G +L   G   D++ +E+V GY++ +          K   +  ++DN WH V++ R+   S++   ++D    SQ +    +++LK      GL  N ++NL                  V   +GF+GC++S  +N            +L+  AL  +G +E   E  +   +C+ + C + G CIQQW    CDC+MT++ G +C+    T  F      ++Y     +  +T  D LA G  T++     + +     +  D+I   + + K    + + +N+G+    + E +  + DG YH V F RNG  A+LQ+D++      P G + I  F         KY  P               N +   S+  +     + G LSGLY+N + + +M
Sbjct:  243 MVKSPQAREENVATFRGSEYFCYDLSQNPIQSSSDEITLSFKTWQRNGLILHTGKS-------ADYVNLALKDGAVSLVIN---LGSGAFEAIVEPVNGKFNDNAWHDIKVTRNL--RQHSGIGHAMVNKLHCLVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSN--NFMGCLKEVVYKNNDIRLELSRLARIADPKMKLQGDIVF-KCENVPTLDPISFETAESFLGLPKWNTKRVGSISFDFRTSEPNGLILFTQGKPQDKKDSRSQRSNKVDFFAVELLDGHLYLLLDMGSGTIKVKATQNKVNDGVWHHVDIQRDGRSGIISVNSRRTPFTASGENEILDLEGNLYLGGLPDNRADLILPTELWTAMLNYGYVGCIRDLFIDGRSKDIRQIAEAQNVGGIKSSCS-KVTAKQCDSNSCKNNGICKEGWNRFICDCTGTGYWDRTCEREASILSYDGSMYMKVVMPTIIHTEAEDVSLRFMSQRAFGLLMAATSRESADTLRLE--LDSGRVKLIVNLGKGPETLYAGQKVNDNDWHSVRVTRRGKNIKLMVDDDVAEGQMNGDHTRLEFSNVETGILTERRFASTAPSNFIGHLQGLKFNGLLYIDMCKNGDIEFCELNARFGMRSIVAD-PVTFKTKGSYLGLATLQAYSTMHLFFQFKTTSGDGFILFNSGDGNDFIAVELVKGYIHYVFNLGNGPSLLKGNSDSPLNDNQWHNVVITRD--ASNTHTLKVDAKSVSQVVNGAKNLDLKGDLFVAGLGPNMYQNL---------------PKLVVPREGFQGCLASMDLN--------GRLPDLINDALFRSGQIERGCEGPS--TTCQEDSCANMGVCIQQWENFTCDCSMTSYSGTQCNDPGATYIFGKGGGLIMYTWPNNERPSTRTDRLAVGFSTTIKDGILVRIDSAP-RLGDYIMLHIEEGK----VCVTFNIGTVDISVKEMTTEVNDGKYHVVRFTRNGGNATLQVDNWPINEHFPSGNSDIERFQMANKKIPFKYTRPVEDWLHEKDRQLTIFNTQATISIGGNDRKRPYQGQLSGLYYNGLKVLNM 1278          

HSP 2 Score: 126.331 bits (316), Expect = 1.259e-27
Identity = 208/902 (23.06%), Postives = 351/902 (38.91%), Query Frame = 1
Query:  874 ISFT-TEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETL-VSFLPHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIIN---------------------MPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRG--NKIIRSDYNCFDGN-WHTLKLKR--RQLS-------------VILIIDDM--EKKYNFSGSSKLLSNDIIAVGKYET------DKFSRYFTGYMMHFTFNG----INYFELAKEESPSNIEVTATIGDAE--PTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSG-------------DYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRE--------NSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANN--GVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDS-----FSGYLSGLYFNRIPLSDMIDN 3327
            + FT +E  +     W  + +  L F FKT  S+AL+ Y   +      F   + E  +  L FS++          S   V+D   H+  +   +    + LD D K++      + +    DLY+GG+P+ +  S L  +L +      F G + D+   G++    L ++   +             +G C   PC + G C +      CDCS+T YTG  C     + K  GF  M+ +                       N  QS  +++TL F T + NG+ + T      ++D + + L++G +++++N G G    I+      F+ N WH +K+ R  RQ S             V + +D +     Y     + L S+D   VG   +         S  F G +    +      +    LA+   P        +   E  PT + PISF +  S++ LPK +      + F  +T    G +L   GK               D+  +E++ G+L LL + G+G  K    + K++D +WH V + R+        NS+ + F    +++ +    ++ L  GGL  N  + +     E + +  N          G+ GCI   +++      +K + Q    IA A N  G+   C +    Q  C  N C + G C + W R  CDC  T +    C++ +  L + D   Y+   +    +T  ++++    +       +     +       + RL  D GR  LI+  NLG G   L  +   + D  +H V   R G    L +DD                N   T    +  F N  TG  +  ++ F S     F G+L GL FN +   DM  N
Sbjct:   24 LEFTGSEGQWARYLRWDASTRSDLSFQFKTAISDALVLY--FDDGGYCDFLLLSIEDAKLKLRFSVDCAETTI---TSDKMVNDSHWHFATISRHNLRTVLALDGDSKVDEVRPQRQFMKIVSDLYLGGVPQDIRTSAL--TLPAAKEMPPFKGIITDLGY-GNKVPTRLGSQKVRLEM-----------EGFCTENPCENGGSCSMADGEAYCDCSKTGYTGRYCNEA--VNKTPGFAHMVKSPQAREENVATFRGSEYFCYDLSQNPIQSSSDEITLSFKTWQRNGLILHTGK----SADYVNLALKDGAVSLVINLGSGAFEAIVEPVNGKFNDNAWHDIKVTRNLRQHSGIGHAMVNKLHCLVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDIRLELSRLARIADPKMKLQGDIVFKCENVPTLD-PISFETAESFLGLPKWNTKRVGSISFDFRTSEPNGLILFTQGKPQDKKDSRSQRSNKVDFFAVELLDGHLYLLLDMGSGTIKVKATQNKVNDGVWHHVDIQRDGRSGIISVNSRRTPFTASGENEILDLEGNLYL--GGLPDNRADLIL--PTELWTAMLN---------YGYVGCIRDLFIDG----RSKDIRQ----IAEAQNVGGIKSSCSKVTAKQ--CDSNSCKNNGICKEGWNRFICDCTGTGYWDRTCEREASILSY-DGSMYMKVVMPTIIHTEAEDVSLRFMSQRAFGLLMAATSRESAD----TLRLELDSGRVKLIV--NLGKGPETLY-AGQKVNDNDWHSVRVTRRGKNIKLMVDD---------DVAEGQMNGDHT----RLEFSNVETG--ILTERRFASTAPSNFIGHLQGLKFNGLLYIDMCKN 853          
BLAST of neurexin-1 isoform X19 vs. TrEMBL
Match: A0A210PI37 (Neurexin-1a OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT10079 PE=4 SV=1)

HSP 1 Score: 400.208 bits (1027), Expect = 5.447e-114
Identity = 319/1062 (30.04%), Postives = 503/1062 (47.36%), Query Frame = 1
Query:  250 YIYNSINIPTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMI-PMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFL-TRGEIYFDKCSDLFIIKPISFTTEASYITLAGW-AWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSF-LPHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGNKIIRSDYNCFDGN-WHTLKLKRRQLSVILIIDD----------------------MEKKYNFSGSSKLLSNDIIAVGKYETD--KFSRY--FTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXXXXXXXXXXKKVRKEI-KIDDNIWHRVILIRENSKSSSFAFRIDSQ-PIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGV--VEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFN-DYPAYLIYKLSPTK--NTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDM 3318
            Y + +   PT S+ D ++L F+T+Q    +FY G        G  ++++ L +  + + +    L   T+            DN WH + V RK       +G   I ++VDG            T L S+ +  GG   P T     +Q         TNFKGCM+K+IY +D+  LD+   A  +   L   G++ F+KC D+   +P++FTT  SYI L  W   +  G L F+F T E N ++ Y     +     DF+AFEI++ F++  I+ GSG  + +VS  PVSD   H V L        +  D  +           LD    LY+GG+ +    + LP  +W+G+L  GFVGC+ D+ +NG++ DL   A  ++ T IV+ C      +  C  RPC++ G+C  G+NR++CDC  T Y GD C   A  + F+  Q M I +     +E ED++LRF T  PNG+  +T S  S   D + ++LENG + + +  G G+KI+       D + WHT+ +KRR   V L +D+                      +    +   +++ L+   + VG+   D  +  +Y  F G M  F FNG ++FE+AK +   NIE TA     EP    P++F S  +Y +L K+  Y +F + F  KT    G ++   G+  D+L  E+  GYL+ ++N G G  + V   I ++ DN WH V L+R      +   R+D Q P  E  H    +  L+FN    L++G   K +   N +   ++S  GF+GC++S  +N  +        +   +IA    G+  + D P ++ +Q +C      + GRC+QQW    CDC MT++ G  C   S +  F    P  LIY    +K  NT  D++A G +T    +  + +        D+I  +L+       + + YN+G+    L +      +G YH + F R+G  A+LQI++   +  +P G+    FN+Q  IY+G Y      TG   Q       F G L GL FN I + +M
Sbjct:  262 YEWPAKGAPT-SNTDEVSLYFRTRQPSGLLFYTGQ-------GSDFLIVSLKNGGVSVTVN---LGSGTYDSEIRPHAYRFDDNHWHHVHVKRKTRELTRQNGYTGIDIMVDGGFKKSGTTAGDFTMLSSRLLYVGGSPNPSTLYGARVQ---------TNFKGCMKKVIYKSDSVTLDLTTLAIEQSDILKVVGDVVFNKCHDIVESQPVTFTTPESYIILPSWEVGSAGGSLSFAFMTNEPNGVVMYNSGTQNS----DFFAFEIQDRFMYLIIDLGSGAMRIQVSMQPVSDAKLHEVSLEHIGRRGWILFDGQRVNYTVRGENSNLDMVGVLYVGGVNDYKEKYQLPKEMWAGMLGYGFVGCMQDVVINGNKMDLLNAARKQSKTDIVNFCR---PSEPQCMTRPCINNGQCSEGWNRYVCDCKATRYVGDFCQTEAATLAFDSAQFMKITLDKESHTEAEDISLRFRTQHPNGLLFMTSSYRS--FDSMALYLENGLVKLEIRVGSGSKILTIGRRRLDDDQWHTVIIKRRGSQVELSLDNDNPIGDYIPVSYTMVLYVKNLVLGYADSLPRNARELNLRRMEVGRMVQDDNRLRQYSGFVGSMQQFIFNGHHFFEMAKSQDIQNIETTARFLTDEPMLMNPVTFKSKEAYAQLEKLSAYLEFSVYFKFKTTEPDGLIMYNGGRGQDFLAFELQGGYLHYVYNTGAGAKRVVVNTINRLSDNEWHDVRLLRPVMDKQT--IRVDDQHPTVENMH---GSDTLHFNLEGMLYVGGVSKTM--YNSLPKLISSRHGFQGCLASLDLNGPRPDILNDSIKVFSSIARGCQGLKALIDRPSNNCHQYACL-----NEGRCVQQWNSYTCDCDMTSYTGPMCTDASVSYTFGLGTPGILIYNYPESKRTNTKYDQMALGFRTMQRNALLVRVES--ITNEDYIEVQLVDGN----VFVVYNMGTDNHPLGQLLRKHNNGNYHVIRFTRSGANATLQINEGPIVHKNPTGEQLSVFNEQARIYIGGY---KNSTGIHRQ-------FVGTLQGLVFNGISVLEM 1266          

HSP 2 Score: 115.931 bits (289), Expect = 4.891e-22
Identity = 184/853 (21.57%), Postives = 329/853 (38.57%), Query Frame = 1
Query:  895 SYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDAD---KKIEHTNSLYKTLDTTRDLYIGGIP---ETLVSFLPHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMDGR-CIIGYNRFICDCSRTNYTGDTCG--RVAPLVKFNGFQQMIINMP--NGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRG---NKIIRSDYNCFDGNWHTLKLKRRQLSV----------ILIIDDMEKKYNFSGSSKLLSNDIIAVGKYETD------KFSRYFTGYMMHFTFNG----INYFELAKEESPSNIEVTATIGDA------EPTKEFPISFPSVNSYIRLPKIDM-YGDFKLEFLIKTRNNKGSVLQLYG-KSGDYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTS--SQGFEGCISSFYMNQTKYVSTKSVYQNLLAIAL--ANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIAS-PKGKTSIHFNQQRTI-YVGKYP-------FPNQRTGRSVQNDKTFDSFSGYLSGL 3288
            S+     W   Q G +   FKT + + L+ Y           D++  ++    LH     GS   +  V    ++D   H + +     N+ + +D+    +    T+  +    T   +++GGI    E   S L  +L +  L   F G + +I +  +     ++ E  +  GIVS       +     + PC  G  C+       C+CS T++ G+ C   R    V F G Q  +   P      S  ++V+L F T +P+G+   T       SD L + L+NG +++ +N G G   ++I    Y   D +WH + +KR+   +          I++    +K    +G   +LS+ ++ VG           +    F G M    +      ++   LA E+S    ++   +GD       +  +  P++F +  SYI LP  ++      L F   T    G V+   G ++ D+   EI   ++ L+ + G+G  +       + D   H V L     +     F       G+R +  ++    N +    L++G    Y  K    ++        GF GC+    +N  K         +LL  A   +   +V  C      +  C    C + G+C + W R  CDC  T ++G+ C   + TL F D   ++   L    +T  ++++   +T        +          F S  L  + G  L+ +E  +GSG   L      + D  +H V  +R G+   L +D+ N I    P   T + + +   + Y    P             GR VQ+D     +SG++  +
Sbjct:   35 SFAKYQKWNPCQNGSIHLEFKTKDMSVLILYMDDG----GHSDYFELKLLTGSLHLRFTLGSAPMRINVGQR-LNDNRWHKISIKRNRKNITLVVDSQSYTRTYHSTDQDFGYYATNSPVFVGGISNEYEDKTSSL--TLPAIYLEPRFTGSIRNI-LYSNCGGPPMRPELLDYRGIVS------ENDQCVVSDPCQHGGICVTHDEGVACNCSYTDFEGEFCSQKRAPSEVTFFGSQYFMYEWPAKGAPTSNTDEVSLYFRTRQPSGLLFYTGQ----GSDFLIVSLKNGGVSVTVNLGSGTYDSEIRPHAYRFDDNHWHHVHVKRKTRELTRQNGYTGIDIMVDGGFKKSGTTAGDFTMLSSRLLYVGGSPNPSTLYGARVQTNFKGCMKKVIYKSDSVTLDLTTLAIEQS----DILKVVGDVVFNKCHDIVESQPVTFTTPESYIILPSWEVGSAGGSLSFAFMTNEPNGVVMYNSGTQNSDFFAFEIQDRFMYLIIDLGSGAMRIQVSMQPVSDAKLHEVSL-EHIGRRGWILFD------GQRVNYTVRGENSNLDMVGVLYVGGVNDYKEKYQLPKEMWAGMLGYGFVGCMQDVVINGNK--------MDLLNAARKQSKTDIVNFCRPS---EPQCMTRPCINNGQCSEGWNRYVCDCKATRYVGDFCQTEAATLAF-DSAQFMKITLDKESHTEAEDISLRFRTQHPNGLLFMTSS----YRSFDSMALYLENG--LVKLEIRVGSGSKILTIGRRRLDDDQWHTVIIKRRGSQVELSLDNDNPIGDYIPVSYTMVLYVKNLVLGYADSLPRNARELNLRRMEVGRMVQDDNRLRQYSGFVGSM 840          
BLAST of neurexin-1 isoform X19 vs. TrEMBL
Match: A0A4E0S3K8 (Neurexin OS=Fasciola hepatica OX=6192 GN=D915_000090 PE=4 SV=1)

HSP 1 Score: 399.053 bits (1024), Expect = 2.401e-112
Identity = 337/1237 (27.24%), Postives = 558/1237 (45.11%), Query Frame = 1
Query:  286 DMDAINLEFKTKQDFSHIFY---VGTQPSHSKTGLQ--YILMYLDDRQLGIRIK--------HDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMIPMTDS-DFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLT-RGEIYFDKCSD----------LFIIKP-------ISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETS---------QLNQ----------FDFYAFEIRESFLHFSINTGSG--------VYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHT--NSLYKTLDTTRDLYIGGIPETL---VSFLPHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMDG-RCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINM-PNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEKKYNFSGSSKLLSNDIIAVGK-------YETDKFS-------------RYFTGYMMHFTFNGINYFELAKEESPSN--------IEVTATIGDAEPTK--EFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQL-YGKSGDYLILEIVHG-YXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYM----------------NQTKY--VSTKSVYQNLLAIALANNGVVEDCPE-----DHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFN-DYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQID-DYNRIIASPKGKTSIHFNQQRTIYVGKYPF---PNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDNISYAGIKLLNRSNVYVENKFIPNFQSKQSILSEQGXXXXXXXXXXXX--------------IVVAKSNCSNIEPLHNLD-CKVSDSAGIIRPIVSYK 3573
            + D I  +F+++  F  I Y   + + P  S T +   ++++YL +  +   ++        H ++     ++ C+S Y TCTD +WH +  S  K S   S         VD +  +  ++  T      Q++  G    ++DS DF     +S       F GC++++ +  D   + +L+  K     +        D+CS           L    P       ISF     Y+ + GW     G++ F F+T E N LL Y  S             LN           FD +A E+R   L   +NTGSG        V +   S T ++D   H VK+ F  G++ V++D    + HT    +YK L+     YIGG+PE +    SF+   +WS  LR  ++GCL D  V+G  +DL L+  +      V         +G+C    C +G  C  G+NRFICDC  +N+ G+ C     + +FNG Q + I   P   QS  ED+ +RF T   NG+ + T+S     SD LE+ +E G + +  +FG  +K  R      D +WHT+++ RR+  + L +D   + Y+     + LS+  I +G+          D F                F G +M F FNG++  ++AK              +E+TA+     P K  EFP+S  + +SYI +     + + +LEF +K   N G +L + YG S D ++LE+V+G    + +   N  N + ++   I D+ WH + ++R     +  +  +D + I     I+L     + +    + LG   +   +  Q +    S  GF GC++S  +                NQT    V   +++ +     +  N V   C +      H+   +C P +C  GG C+QQW   RCDC++T+  G  C +VS  + F+ +  + L ++++PT+NTT D+LAFGIQ     S  + LI+G G   D++   ++K + R +L++ YN+G+G   L E +V+I DG YH V F R+G    L++D +Y R    PK K   HFN ++ I +G  PF   P   T  S     T   F G++SG YFN + L  ++  +   GI L    N+ VE +F P  +  + + +    +      K+                +++AK +C +   +++   C   D +GII+P V ++
Sbjct:   71 EADEIAFQFRSR-GFDQILYSSVLASSPDMSDTLIMQIHLVIYLTNGSVHFMVENYSKNNFPHMQVVGQRRRIDCLSDYETCTDAQWHQVRQSVLKNSLAIS---------VDNQPPLTYLLSYTTNRWSIQAVYLGHRPDISDSKDFG----SSLSVPRQQFHGCIRRLFFKIDGKKIPVLSLEKQDLIVVQLESSQILDECSRNTLSPSHAHRLPYTWPYRSAPEYISFVRPGGYVRIPGWHVVLSGEITFRFRTNEINGLLIYGSSVHQYEVIDYADLGLNAIPIPGGGKAGFDIFAMELRNGHLFCVLNTGSGSLQLGRTGVNRHMQSVTFLADSKEHKVKIQFNQGSIAVEVDGRHYMAHTADEKMYKYLNLNGVFYIGGVPEPIRRVSSFISPEVWSTRLRWDYIGCLSDFRVDGRLWDLELELRACWARSYVEPLCRIQNVEGVCTRNSCANGGLCENGWNRFICDCHDSNFIGEKCSEAPVVAEFNGHQWISITFSPFPVQSAVEDLIIRFQTKHKNGLLLTTRSPSMAESDCLELRVEAGYIKLTYDFGEESKQYRGLTYVSDNSWHTVRVHRRERHLNLTVDHAAQVYDIPKYGRFLSHKQIILGRNTKISEPKSLDAFPDRPMILSPERTKLTVFIGNIMAFWFNGLDILKMAKHLLAQTAYTVWRERLEITASESSPRPGKMLEFPLSLETHDSYIEMKLDGSFNELQLEFWLKADKNFGILLLMDYGVS-DIIVLELVNGDLNIVCWQRNNTKNVQSKRNGAIIDSKWHWIKVVRNWGSYNLLSVHVDQEII----KIDLPPSETSRSQL--ILLGGVPRDADQVEQYKQHFHSMYGFAGCVASIQIKQFNQSITALGNAELSNQTNAGDVRVTTLFSDQYGSKIRWNNVEPGCRQKPNGLQHSLNGNCTPRVCQFGGSCVQQWGATRCDCSLTSLTGTHCTEVSSAIHFSVNQNSVLSFEMNPTQNTTRDQLAFGIQVVQPGSVVLFLIQGQGDSPDYLEVSIVKVEARYVLLVRYNMGAGQHTLYEPNVDITDGQYHIVQFIRDGPNGLLRVDLEYER-SNLPKDKHGSHFNGEKLIRLG-VPFKSSPVFATNASRTMGAT--EFEGFISGAYFNDVNLLSVLQGLVIPGIFLSESQNIRVEKQFQPKMEHLKHVRTRNDHQVAANDMKHQTNDASFGNHEVHSGPLIIAKRDCVDPGGMYDTKTCSPYDRSGIIQPHVDFR 1282          
BLAST of neurexin-1 isoform X19 vs. TrEMBL
Match: A0A430QHY5 (Neurexin OS=Schistosoma bovis OX=6184 GN=DC041_0012455 PE=4 SV=1)

HSP 1 Score: 398.667 bits (1023), Expect = 4.979e-112
Identity = 348/1270 (27.40%), Postives = 576/1270 (45.35%), Query Frame = 1
Query:  292 DAINLEFKTKQDFSHIF---YVGTQPSHSKTGLQ-YILMYLDDRQLGIRI------KHDRL--PESTFKVTCVSIYSTCTDNRWHTISVSRKKTS---EKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIK---------------RYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKS---------------------ETSQLNQFDFYAFEIRESFLHFSINTGSGVYQ--------QKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSL--YKTLDTTRDLYIGGIPETLV---SFLPHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINM-PNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEKKYNFSGSSKLLSNDIIAVGKYE-------TDKFSRY--------------FTGYMMHFTFNGINYFELAK--EESPS------NIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXXXXXXXXXXKK-VRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPED------HNYQVSCR-------------PNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPA-YLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDS---FSGYLSGLYFNRIPLSDMIDNISYAGIKLLNRSNVYVENKFIPNF------------------QSKQSILSEQGXXXXXXXXXXXXIVVAKSNCSNIEPLHNL-DCKVSDSAGIIRPIVSYKINTVTHSQKIT---TTPDNDIYTENTKSESSTIYKSLE 3678
            + I  EF+T+++   +F          H+K  +  Y+L YL +  L + +      K   L  P +   ++C+S Y TC D +WH I ++ KK       +S  Q+ +       ++  R++ L  T L +   TF   IP              + NLTNF+GC Q IIY +    + +L     K                Y L +  I  D      +   +SFT   SY+ + GW     G++ F  +T   N L+ Y  S                     E  Q   +D +A E+R   LHF +NTGSG+ Q        +  S   +SDG  H +++ F++G++ + +D +  + H   +  YK L+     YIGG+PE++    SF+   +WS  LRQ FVGCL +  VN   +D+ L+         V       +    C ++PC + G+CI  +N + CDCS TN++G TC     +V F+GFQ + I   P   QS  E++TLRF T   +G  + T+S +  A D LE+ + +G L+++ N G  + I  +     D  WHT+K+ RRQ  +   +D++ + ++     + LS+  + +G  E        D  +++              F GY+M F FNG+++   A+  +  PS       +++TAT  + EP  E P++F + +S I +       +F L   IK +   G+VL L       LILE + G L L+    +   K  + +  ++    W+ + +I++ S +     R+++Q    + +I       N+ + + + +GS     S  +   + +  + GF+GC++SF  N +      S+   L     +   V      D      HN Q+ C               N C   G C+QQW  I CDC++T F G+ CDK   +++ +++P  Y +++L+  +NTTLD+LAFGIQ     + SII I+G G+  DFI   ++ +K +  L + +N+G G   L + +VN  DG +H V F R    + L +D  + I    + + + HFN  + IY G+ P    +   SV N+  F S   F G+++GL  N I L D++      GI L  R N+ +   F PN                   ++    L+     +     K  PIVV K+ C   +  +N  +C+ +D  GII+P++++  N +T    I    T P     TE  K +SS  YK  +
Sbjct:   32 EKIFFEFRTRKENQIMFSFELTSILTQHTKMKVDSYLLGYLLNGALVVNLFNHFSEKRSYLNHPNTQKIISCISDYDTCADTQWHQILLTIKKNDILLVLDSQPQVKLNPFGHDGLITIRVMHLGGTFLNNSKETFTRFIPS-------------IGNLTNFRGCFQSIIYKSGELFIPLLITKNTKYIQSQLPIQSNLRNCDYKLLQRNINIDHSK---VNSYVSFTKPGSYLRITGWKVVLHGEITFILRTTTLNGLIIYSNSINEYELFPKNINEPNLLENIHEVKQTG-YDIFALELRLGRLHFLLNTGSGIVQPEFDRKYFESESKGFISDGKEHSIQIVFDEGDLIINVDGENFVTHGTGIKTYKYLNLNEYFYIGGLPESVRQINSFISPEVWSAQLRQDFVGCLGEFIVNKRLWDIDLERRPCWSKPFVENGCKLSSSIDFCTDKPCRNKGQCISSWNIYECDCSNTNFSGKTCTENPIIVSFDGFQWLWIKFSPLPIQSSVEELTLRFRTKYEDGFLLTTRSSILSAPDCLELKITSGYLSLIYNLGAIDNIYHNPVYIADDQWHTVKIYRRQNVLNFSVDNLFQTFDIPKDGRYLSHRHLILGNSEDSLTNQLIDTPTQFNHNIKQINNLNVHVFIGYIMVFLFNGVDFLRTAQNLKHDPSLYIWKDKLDITATQSNYEPNHELPLTFSNKDSTIEIELEHSTSEFILGMWIKWKK-YGTVLSLQDGFRQNLILESIDGRLQLIHMNKDQAEKYFIGENQRVVVREWYHIEVIKQES-TKLIHIRVNNQSTIVKMNIS------NYFALKTINIGSLSTRNSNYDTYSNYMQRTTGFQGCVASFSFNYSIDYDQSSLNIKLNNTTPSRYHVNYLYSNDTQKVSLHNIQMGCHFSDSKHLDLNQCSENPCRFNGICMQQWNSITCDCSLTGFTGKFCDKAGTSVRLSEFPRRYAVFELNSPQNTTLDKLAFGIQIINPGTMSIIHIQGQGQSPDFIQLSVLHNKDQLNLHVRFNMGGGTQTLFQPNVNFNDGHFHIVQFIRQEAKSILLVDFQHEITKLTEDQNNKHFNLLKRIYFGEAP--KMKEKLSVNNNSEFTSRKGFEGFITGLNLNNINLIDLLYGNMVPGIYLKTRENIELNPNFKPNMKKLHAHNKRTEPETRSQNEANDMQLTATDFHDRINDYKTQPIVVPKTECLKYDSSYNYKECQPADLDGIIQPLITFSDNPLTMRAIINDYKTQPIVVPKTECLKYDSSYNYKECQ 1274          
BLAST of neurexin-1 isoform X19 vs. TrEMBL
Match: A0A4Z2DG09 (Neurexin-1 (Fragment) OS=Schistosoma japonicum OX=6182 GN=EWB00_001292 PE=4 SV=1)

HSP 1 Score: 394.43 bits (1012), Expect = 1.617e-111
Identity = 309/1096 (28.19%), Postives = 515/1096 (46.99%), Query Frame = 1
Query:  688 SIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLTRGEIYFD---KCSDLFIIKP------------ISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETS------QLNQ--------------FDFYAFEIRESFLHFSINTGSGVYQ--------QKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSL--YKTLDTTRDLYIGGIPETLV---SFLPHSLWSGILRQGFVGCLLDISVNGDQFDLAL-KAESENITGIVSGCSGDVTDKGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINM-PNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEKKYNFSGSSKLLSNDIIAVGKYE---TDKF-----------------SRYFTGYMMHFTFNGINYFELAK--EESPS------NIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXXXXXXXXXXKK-VRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQT----------KYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCR-------------PNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYP-AYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLM--KDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDK----TFDSFSGYLSGLYFNRIPLSDMIDNISYAGIKLLNRSNVYVENKFIPNFQS----KQSI--------------LSEQGXXXXXXXXXXXXIVVAKSNCSNIEPLHNL-DCKVSDSAGIIRPIVSYKINTVT 3588
            S +ET +   N TNF+GC + +IY      + +L     K     R E+      +  D  +++P            +SFT   +Y+ + GW     G++ F+ +T   N L+ Y  S +       ++N+              FD +A E+R   LHF +NTGSG+ Q        +  S   +SDG  H +++ F++G++ + +D +  + H   +  YK L+     YIGG+PE++    SF+   +WS  LRQ FVGCL +  VN   +D+ L +    +   + SGC   ++   LC ++PC + G+C   +N F CDCS TN++G TC     +V  NGFQ + +   P   QS  E++TLRF T   NG  + T+S +  A D LE+ + +G L ++ N G  + +  +     +  WHT+K+ RRQ  +   +D++ + ++     + LS+  +  G  E   TD+                     F GY+M F FNG+++   A+  +  PS       +++TAT  D EP  E P++F   +S I L       +F LE  IK +   G++L L    G   ILE+  G L  +        K  +    K+ +  W+ + +I++     S   +++ Q         +K     + + + + +GS  K  S      + +  + GF+GC++SF +N +          ++ + KS+ +  L    +N     D    HN Q+ C               N CH  G C QQW  + CDC++T F G+ CD    ++  ++ P  Y I++L+  +NTTLD LAFGIQ     S S++ I+G G+ SD+I   ++  K K +  L++ YN+G G   L + +VN  DG +H V F R+ +   L ID  + I    + + + HFN  + IY G+   P +   + +QN+     T + F G+++GL FN I L D+++     GI L  R N+ +   F PN +     K+ I              L+     + +   K   IVV K +C   +  +N  +C+  D  GIIRP++++  NT+T
Sbjct:   36 SSKETITNSMNQTNFRGCFRSVIYKNGEIFVPMLMTKSTK---YVRSELPIQSNLRNCDYKLLQPRLNINSAKINSFVSFTKPGNYLRITGWKVVLHGEITFTLRTTTLNGLIIYSNSVSENEMFPRKVNEPNLLENIQDMKQTGFDIFALELRLGRLHFLLNTGSGIVQPEFDKKYFESESKGFISDGKEHTIQIVFDEGDLTINVDGENFVTHGIEIKTYKYLNLNEHFYIGGLPESMRQINSFISPEVWSAQLRQDFVGCLGNFIVNNRLWDVDLERRPCWSKPFVESGCEFSLS-TDLCTDKPCKNNGQCFSNWNIFECDCSYTNFSGKTCTENPTIVSLNGFQWLWVKFSPLPIQSSVEELTLRFRTKHKNGFLLTTRSSILSAPDCLELKIISGYLVLIYNLGESDNMYHNPVYVSNDQWHTVKVYRRQNFLNFSVDNLLQTFDIPNDGRFLSHRHMIFGASEDLLTDQLIDSSTHFRHIKQINNLNLHVFIGYLMVFLFNGVDFLRTAQNLKHDPSLYIWKDKLDITATQSDYEPILELPVTFIDKDSSIELQLKHPTSEFILEMWIKWK-KYGTILFLQDGYGQNFILELTDGRLQFIHENNEQAEKHFINANQKLIEREWYHLKVIKK-ELIQSILIQVNDQS------TYVKLNNSKYFTLKTITIGSQSKRKSNYITYDNYMQGTTGFQGCLASFLLNYSIDYGHLPLNIEFNNNKSLPKYRLNYLYSNETQTVDW---HNIQMGCHHLDSKHQELNHCLENPCHFNGMCKQQWNSVTCDCSLTGFTGKFCDNPGTSVLLSELPRRYAIFELNSPQNTTLDRLAFGIQIINPGSMSLLHIQGQGQSSDYIQLSVLHNKSKNQLNLLVRYNMGGGTQTLFQPNVNFDDGHFHIVQFIRHESKGILWIDFQHEITKPIEDQNNKHFNLLKRIYFGE---PLKTNEKLIQNNVSELITKEGFEGFITGLNFNSINLIDLLNGNMIPGIYLKTRVNIKLNPNFKPNMEKLHAHKKRIEPETTNQNEANDMQLTATDIHDKSIDYKTQSIVVPKKDCLKYDNNYNYKECQPVDMDGIIRPLITFNDNTLT 1113          
BLAST of neurexin-1 isoform X19 vs. TrEMBL
Match: A0A3P8G6Q0 (Uncharacterized protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS19036 PE=4 SV=1)

HSP 1 Score: 388.267 bits (996), Expect = 1.060e-110
Identity = 319/1154 (27.64%), Postives = 539/1154 (46.71%), Query Frame = 1
Query:  292 DAINLEFKTKQDFSHIF---YVGTQPSHSKTGL-QYILMYLDDRQLGIRI------KHDRLPESTFK--VTCVSIYSTCTDNRWHTISVSRKKTS---EKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLTRGEIYFD-KCSDLFIIKP------------ISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKS---------------------ETSQLNQFDFYAFEIRESFLHFSINTGSGVYQ--------QKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSL--YKTLDTTRDLYIGGIPETLV---SFLPHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINM-PNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEKKYNFSGSSKLLSNDIIAVGKYE-------TDKFSRY--------------FTGYMMHFTFNGINYFELAK--EESPS------NIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXXXXXXXXXXK-KVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPED------HNYQVSCR-------------PNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPA-YLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDS---FSGYLSGLYFNRIPLSDMIDNISYAGIKLLNRSNVYVENKFIPNFQ 3402
            + I  EF+T+++   IF     G    H+K  +  Y+L YL +  L + +      K   L  +  +  ++C+S Y TC D +WH I +  KK       +S  Q+ +       ++  R++ L  + L +   TF   IP              + NLTNF+GC Q IIY +    + +L+  K  +Y  ++  I  + +  D  +++P            +SFT   SY+ + GW     G++ F  +T   N L+ Y  S                     E  Q   +D +A E+R   +HF +NTGSG+ Q        +  S   +SDG  H +++ F++G++ + +D +  + H   +  YK L+     YIGG+PE++    SF+   +WS  LRQ FVGCL +  VN   +D+ L+         V       +    C  +PC + G+CI  +N + CDCS TN++G TC     +V F+GFQ + I   P   Q+  E++TLRF T   NG  + T+S +  A D LE+ + +G L+++ N G  + I  +     D  WHT+K+ RRQ  +   +D++ + ++     + LS+  + +G  E        D  +++              F GY+M F FNG+++   A+  +  PS       +++TAT  + EP  E P++F + +S I +       +F L   IK +   G+VL L       LILE + G L L+    +   K  + +  ++    W+ + +I++ S +     R+++Q    + +I       N+ + + + +GS     S  +   + +  + GF+GC++SF  N +      S+   L     +   V      D      HN Q+ C               N C   G C+QQW  I CDC++T F G+ CDK   +++ +++P  Y +++L+  +NTTLD+LAFGIQ +   + S+I I+G G+  DFI   ++ +K +  L + +N+G G   L + +VN  DG +H V F R    + L +D  + I    + + + HFN  + IY G+   P  +   SV N+  F S   F G+++GL  N I L D++      GI L  R N+ +   F PN +
Sbjct:   20 EKIFFEFRTRKESQIIFSFELTGILTQHTKMKVDSYLLGYLLNGALVVNLFNHFSEKRSYLNHANTQKIISCISDYDTCADTQWHQILLMIKKNDILIVLDSQPQVKVNPFGQDGLITIRVMHLGGSFLNTSKETFTRFIPS-------------IGNLTNFRGCFQSIIYKSVELFIPLLS-TKNTKYIQSQIPIQSNLRNCDYKLLQPERNINHLKLNSYVSFTKPGSYLRITGWKIVLHGEITFILRTTTLNGLIIYSNSINEYELFPKVINEPNLLENIHEVKQTG-YDIFALELRLGRIHFLLNTGSGIVQPEFDKKYFESESKGFISDGKEHSIQIVFDEGDLTINVDGENFVTHGTGIKTYKYLNLNEYFYIGGLPESVRQINSFISPEVWSAQLRQDFVGCLGEFIVNERLWDIDLERRPCWSKPFVENGCKLSSSIDFCTEKPCRNKGQCISSWNIYECDCSNTNFSGKTCTENPIVVSFDGFQWLWIKFSPLPIQTSVEELTLRFRTKYENGFLLTTRSSILSAPDCLELKIISGYLSLIYNLGAVDNIYHNPVYIADDQWHTVKIYRRQNVLNFSVDNLFQTFDIPKDGRYLSHRHLILGNSEDSLTNQLIDTPTQFNHNIKQISNLNVHVFIGYIMVFLFNGVDFLRTAQNLKHDPSLYIWKDKLDITATQSNYEPNHELPLTFNNKDSTIEIQLEHSTSEFILGMWIKWKK-YGTVLILQDGFRQNLILESIDGRLQLIHMNNDQAEKYSIGENQRVVVREWYHIEVIKQES-TKLILIRVNNQSTIVKMNIS------NYFALKTINIGSLSTRNSNYDTYSNYMQRTTGFQGCVASFSFNYSIDYDQSSLNIKLNDTTPSRYHVNYLYSNDTQKVSLHNIQMGCHFSNTKHLDLNQCSENPCRFNGICMQQWNSITCDCSLTGFTGKFCDKAGTSVRLSEFPRRYAVFELNSPQNTTLDKLAFGIQITNPGTMSLIHIQGQGQSPDFIQLSVLYNKDQLNLHVRFNMGGGTQTLFQPNVNFNDGHFHIVQFIRQEAKSILLVDFQHEITKLTEDQNNKHFNLLKRIYFGEA--PKMKEKLSVNNNSEFTSRKGFEGFITGLNLNNINLIDLLYGNMIPGIYLKTRENIELNPNFKPNMK 1148          
BLAST of neurexin-1 isoform X19 vs. Ensembl Cavefish
Match: ENSAMXT00000011949.2 (pep primary_assembly:Astyanax_mexicanus-2.0:6:20986441:21378525:-1 gene:ENSAMXG00000011628.2 transcript:ENSAMXT00000011949.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 355.14 bits (910), Expect = 3.213e-101
Identity = 326/1265 (25.77%), Postives = 547/1265 (43.24%), Query Frame = 1
Query:  178 LISFVIIHTGTTEEIPVATFLQDAYI-YNSINIPTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQ----------FDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFL-PHSLWSGILRQGFVGCLLDIS----VNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNF---------GRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDME-KKYNFSGSSKLLSNDIIAVG----KYETDKFSRYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXXXXXXXXXXK-KVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPT--KNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDNISYAGIKLLNRS-----NVYVEN--KFIPNFQSK----QSILSEQGXXXXXXXXXXXXIVVAKSNCSNIEPLHNLDCKVSDSAGIIRPIVSYKINTVTHSQKITTTPDNDIYTENTKSESSTIYKSLEINNSGVINIWLIIGFSVGGSLLLVFITCFIYRCFRKDEGSYNVEDDHIFIDPS 3837
            L   ++   G   E  VATF    Y  Y+    P  S  D I L FKT Q    + + G           Y+ + L +  + + I    L    F+     +     DN WH + V+R    + +  G  ++ + VDG +          T L S    + G  P T +D       S + N  NF GC+++++Y  ++  L++   AK     +    I   KC ++  + P++F T  S++TL+ W   + G + F F+T E N LL +   +  Q  Q           DF+A E+ +  L+  ++ GSG  + K  +  V+DG  ++V    +  +  + +++ +   +     + LD    LY+GG+PE     + P  +W+ +L  G+VG +  I+      G  F +AL  +S                       PC++ G C  G+NR++CDCS T Y G +C R A ++ ++G + M I +P    +E EDV+LRF + R  G+ + T SR S  + RLE  L+ G++ + +N           +G + I +  N  D  WHT+++ RR  S+ L++DD++  +   +G    L    I  G    K         F G++    FNG++Y +L K       E+ A IG      + P++F S +SY+ LP +  Y    L    KT +  G +L   G   D++++E+V GY++ + + GNG +  K      ++DN WH V++ R+ +        + +  I  +   +   G  N +   +LF+G   K + K   +   V S +GF+GC++S  +N            +LL+ AL   G VE   E  +   +C+ + C + G C+QQW    CDC+MT+F G  C+    T  F      ++Y   P    +T  D LA G  T    +  + +    G   D++  ++ K   R +    +N+G+    + E+S  + DG YH V F R+G  A+LQ+DD   I   P G+    FN Q TI +G +    +R  R          F G LSGLY+N              G+K+LN +     NV VE   + + +  S     QS  S  G +        +      SN    +   + D  +  SA              +  + I          E          KS E+         +++G     +L ++ +   +Y+   +DEGSY+V++   +I  S
Sbjct:  239 LAHLMMADQGMVREEYVATFKGSEYFCYDLSPNPIQSSSDEITLSFKTLQRNGLMLHTGKSA-------DYVNLALKNGAVSLVIN---LGSGAFEALVEPVNGKFNDNAWHDVKVTRN-LRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPST-ADLP----GSPVSN--NFMGCLKEVVYKNNDVRLELSRLAKQGDAKMKVSGIVAFKCENVATLDPVTFETPESFVTLSKWTAKKAGSISFDFRTTEPNGLLLFSHGKPKQQQQKDPKGPKTMKVDFFAIEMLDGHLYLLLDMGSGTTKTKAVNKKVNDGEWYHVDFQRDGRSGTISVNSVRTPYNAPGESEILDLDDVLYLGGLPEDRAGLVFPTEVWTALLNYGYVGYIRRIAEAQRAVGSSFLVALGKKSN----------------------PCLNSGTCREGWNRYVCDCSGTGYLGRSCERDATILSYDGSKFMKIKLPVVMHTEAEDVSLRFRSQRAYGVLMATTSRNSADTLRLE--LDGGRVRLTVNLDCIRINCTTSKGPETIFAGQNLNDNEWHTVRVVRRGKSLKLMVDDLQPSEGQITGDHTQLEFHNIETGIITEKLYMPAVPSNFIGHLQGLGFNGMSYIDLCKNGDIDYCELNAMIGYKSIVAD-PVTFKSRSSYVTLPTLQAYYSMHLFLQFKTTSPDGLILYNRGDGNDFIVVELVKGYMHYVSDLGNGAHLIKGNSNTPLNDNHWHNVMISRDTNN-------LHTVKIDTKITTQTTMGAKNLDLKGDLFVGGVSKEMYK--DLPKLVHSKEGFQGCLASVDLN--------GRLPDLLSDALTTMGQVERGCEGPS--TTCQEDSCSNQGVCLQQWEGFTCDCSMTSFGGPLCNDAGTTYIFGRDGGLIVYTWPPNDRPSTRADRLAVGFSTQQKDAVLVRVDSSSG-LGDYLQLQIEKGNIRVV----FNVGTDDINIEETSKFVNDGKYHIVRFTRSGGNATLQVDDLPVIERYPTGRQLTIFNSQTTIKIGGW----ERGSR---------PFQGQLSGLYYN--------------GLKVLNMAAEGDPNVRVEGSARLVGDLPSSSITPQSSASATGNRSETSPSLTDITTTTASNRQGKQTTTSQDDLLVASA-----------ECPSDDEDIDPCDPTSGGLEQCGRGGKKPKKSPEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYHVDESRNYISNS 1398          

HSP 2 Score: 97.8265 bits (242), Expect = 5.773e-20
Identity = 191/897 (21.29%), Postives = 341/897 (38.02%), Query Frame = 1
Query:  847 CSDLFIIKPISFT-TEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGILRQ-GFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMDGRCIIGYNRFICDCSRTNYTGDTCG--------------RVAPLVKFNGFQQMIINM-PNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGN-----KIIRSDYNCFDGNWHTLKLKR--RQLS------VILIIDDM--EKKYNFSGSSKLLSNDIIAVGKYET------DKFSRYFTGYMMHFTF-NGINYFELAK--EESPSNIEVTATIG-DAEPTKEF-PISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSG---------------DYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKS--SSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYV--STKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNL------GSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKG-KTSIHF-NQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDN 3327
            C  + I   + FT  E  +     W    + ++ F+ KT  S+ LL Y   E       DF    I    +    +         +S T V+D   H V +     N  + +D + K     S  + +     +++GGIP  L S       + I  Q  + G + ++ VN  +  +     S+ IT  V  C  D     +C N     G C I  ++ ICDCS T + G  C               R   +  F G +    ++ PN  QS  +++TL F T + NG+ + T      ++D + + L+NG +++++N G G      + +   +N  D  WH +K+ R  RQ S      V + +D +     Y     + L S+D   VG   +         S  F G +    + N     EL++  ++  + ++V+  +    E      P++F +  S++ L K        + F  +T    G +L  +GK                 D+  +E++ G+L LL + G+G  K      K++D  W+ V   R+      S  + R      GE   ++L          + L+LG   +  +        V  ++ +   ++  Y+   + +  + ++V  + L +AL                   + N C + G C + W R  CDC+ T ++G  C++ +  L + D   ++  KL    +T  ++++   ++       +     +       + RL  D GR  L +  +        S     + +  N+ D  +H V   R G    L +DD         G  T + F N +  I   K   P               +F G+L GL FN +   D+  N
Sbjct:   19 CCLVDIGASMEFTGAEGQWARFPMWNACCESEMSFNMKTKSSHGLLVYFDDE----GFCDFLELLIHNGRISLRFSIFCAEPATVLSDTAVNDSRWHAVTVRRNFKNTTLVVDDEIKWVEVKSKRRDMTVFSPMFLGGIPPELRSVALRLTSASIKDQVPYKGWITNLKVNDSEPAIV---SSDGITSNV--CEAD----HVCLN----GGVCSIVNDQPICDCSETGFQGKDCSEGLAHLMMADQGMVREEYVATFKGSEYFCYDLSPNPIQSSSDEITLSFKTLQRNGLMLHTGK----SADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFN--DNAWHDVKVTRNLRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDAKMKVSGIVAFKCENVATLDPVTFETPESFVTLSKWTAKKAGSISFDFRTTEPNGLLLFSHGKPKQQQQKDPKGPKTMKVDFFAIEMLDGHLYLLLDMGSGTTKTKAVNKKVNDGEWYHVDFQRDGRSGTISVNSVRTPYNAPGESEILDLD---------DVLYLGGLPEDRAGL------VFPTEVWTALLNYGYVGYIRRIAEAQRAVGSSFL-VALGK-----------------KSNPCLNSGTCREGWNRYVCDCSGTGYLGRSCERDATILSY-DGSKFMKIKLPVVMHTEAEDVSLRFRSQRAYGVLMATTSRNSAD----TLRLELDGGRVRLTVNLDCIRINCTTSKGPETIFAGQNLNDNEWHTVRVVRRGKSLKLMVDDLQPSEGQITGDHTQLEFHNIETGIITEKLYMP-----------AVPSNFIGHLQGLGFNGMSYIDLCKN 843          
BLAST of neurexin-1 isoform X19 vs. Ensembl Cavefish
Match: ENSAMXT00000000309.2 (pep primary_assembly:Astyanax_mexicanus-2.0:21:10525143:11115194:1 gene:ENSAMXG00000000283.2 transcript:ENSAMXT00000000309.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 350.517 bits (898), Expect = 1.760e-99
Identity = 321/1280 (25.08%), Postives = 555/1280 (43.36%), Query Frame = 1
Query:  226 VATFLQDAYI-YNSINIPTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQA-----KIKRYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQ---------FDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFL-PHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNF---------GRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEKKYNFSGSSKLLSNDIIAVGKYETDKF----SRYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXXXXXXXXXXK-KVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPT--KNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASP------------------------------KGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMI----DNISYAG-IKLLNRSNVYVENKFIPNFQSKQS--------ILSEQGXXXXXXXXXXXXIVVAKSNCSNIEPLHNLDCKVSDSAGIIRPIVSYKINTVTHSQKITTTPDNDIYTENTKSESSTIYKSLEINNSGVINIWLIIGFSVGGSLLLVFITCFIYRCFRKDEGSYNVEDDHIFIDPS 3837
            VATF    Y  Y+    P  S  D I L FKT Q    + + G           Y+ + L +  + + I    L    F+     +     DN WH + V+R       S   ++       +           T L S    + G  P T +D       S + N  NF GC+++++Y  ++  L++   A     K+K +    G + F KC ++  + PI+F T  ++ITL  W   + G + F F+T E N LL +      Q  +          DF+A E+ +  L+  ++ GSG  + +  +  V+DG  ++V    +     + ++  +         + LD   +LY+GG+PE     + P  +W+ +L  GFVGC+ D+ ++G   D+   AES+  TG+ S CS +   +  C + PC++ G C  G+NR++C+CS T + G +C R A ++ ++G + M I +P    +E EDVTLRF + R  G+ + T SR S  + RLE  LE G++ + +N           +G + + +  N  D  WHT+++ RR  ++ L +DD++     +G    L    I  G     ++       F G++    FNG+ Y +L K       E+ A IG      + P++F S +SYI L  +  Y    L F  KT ++ G +L   G   D++++E+V GYL+ + + GNG +  K      ++DN WH V++ R+ +        + +  I  +   +   G  N +   +L++G   K + K  ++   V + +GF+GC++S  +N            +L++ A+   G +E   E  +   +C+ + C + G C+QQW    CDC+MT+F G  C     T  F      + Y   P    +T  D LA G  T +  +  I +    G   D++  +L  +KG   +I  +N+G+    + E +  + DG YH V F R+G  A+LQ+DD   I   P                              KG+    FN Q TI +G +     R            SF G +SGLY+N + + +M      NI   G ++L+  +          +  + +S          +        P K  + ++VA + C + +   ++D     S G+  P                T P   +Y +            +E+         +++G     +L ++ +   +Y+   +DEGSY+V++   +I  S
Sbjct:  253 VATFKGSEYFCYDLSQNPIQSSSDEITLSFKTMQRNGLMLHTGKSA-------DYVNLALKNGAVSLVIN---LGSGAFEALVEPVNGKFNDNDWHDVKVTRNLRQVTISVDGILTTTGYTQED---------YTMLGSDDFFYVGGSPST-ADLP----GSPVSN--NFMGCLKEVVYKNNDVRLELSRVALQGDPKMKIH----GVVAF-KCENVATLDPITFETPEAFITLHKWNAKKTGSISFDFRTTEPNGLLLFSHGRPKQQTKEAKSPLTLKVDFFAIEMLDGHLYLLLDMGSGTTKTRAINKKVNDGEWNHVDFQRDGRAGTISVNTIRTPYQAPGESEILDLDDNLYLGGLPENKAGLVFPTEVWTALLNYGFVGCVRDLFIDGQSKDVRRMAESQKATGVKSSCSKEAPKQ--CISNPCLNNGVCREGWNRYVCECSGTGFLGRSCERDATILSYDGSKFMKIQLPVAMHTEAEDVTLRFRSQRAYGVLMATTSRDSADTLRLE--LETGRVRLTINLDCIRINCTTSKGPETLFAGQNLNDNEWHTVRVMRRGKNLQLSVDDLQ---TITGDHTQLEFHNIETGIVTEKRYLSTVPSNFIGHLQSLVFNGMAYIDLCKNGDIDYCELNAMIGFKSIIAD-PVTFKSRSSYISLTTLQAYYSMHLFFQFKTTSSDGLILYNSGDGNDFIVVELVKGYLHYVADLGNGAHLIKGNSNKPLNDNQWHNVMISRDTNN-------LHTVKIDTKVTTQTTMGAKNLDLKGDLYIGGVAKEMYK--ELPKLVHAKEGFQGCLASMDLN--------GRLPDLISDAITCVGQIERGCEGPS--TTCQEDSCANQGVCLQQWEGFSCDCSMTSFGGPLCSDAGTTYIFGRDGGRITYTWPPNDRPSTRADRLALGFSTQLKDALLIRVDSSSG-LGDYL--KLHIEKGNVAVI--FNVGTDDINIEEKAKFVNDGKYHVVKFTRSGGNATLQVDDLPVIERYPTGNIDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQTTIQIGGWDRDRSR------------SFQGQMSGLYYNGLKVFNMAVEGDPNIRIEGSVRLVGEAPSSSSITPQSSATANRSDTSTSIIETTTTTTATGRPPAKTTDDLLVASAECPSDD--EDIDPCEPSSGGLASP----------------TGPGLKVYPD-----------PVEVVRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYHVDESRNYISNS 1428          

HSP 2 Score: 114.775 bits (286), Expect = 4.316e-25
Identity = 187/872 (21.44%), Postives = 336/872 (38.53%), Query Frame = 1
Query:  886 TEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGILRQ-GFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMDGR-CIIGYNRFICDCSRTNYTGDTC------------GRVAPLVKFNGFQQMIINMP-NGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGN-----KIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDM--EKKYNFSGSSKLLSNDIIAVGKYET------DKFSRYFTGYMMHFTF-NGINYFELAKE--ESPSNIEVTATIG-DAEPTKEF-PISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSG--------------DYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKS--SSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTS--SQGFEGCISSFYMN-QTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNL------GSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDN 3327
             E  +     W    + ++ F+ KT  S  LL Y   E       DF    +    L+   +          S   V+D   H V +     N  + +D + K     S  + +     L++GGIP  L +            Q  F G + D+ VN             ++  I++  SG V +    +   C++G  C +  ++  CDCS T Y G  C            G+   +  F G +    ++  N  QS  +++TL F T + NG+ + T      ++D + + L+NG +++++N G G      + +   +N  D +WH +K+ R    V + +D +     Y     + L S+D   VG   +         S  F G +    + N     EL++   +    +++   +    E      PI+F +  ++I L K +      + F  +T    G +L  +G+                D+  +E++ G+L LL + G+G  K      K++D  W+ V   R+      S    R   Q  GE   ++L          +NL+LG   +  +      +  T+  + GF GC+   +++ Q+K V         +A +    GV   C ++   Q  C  N C + G C + W R  C+C+ T F+G  C++ +  L + D   ++  +L    +T  +++    ++       +     D       + RL  + GR  L I  +        S     + +  N+ D  +H V   R G    L +DD   I       T + F+   T  V +     +R   +V ++     F G+L  L FN +   D+  N
Sbjct:   33 AEGQWAAFPMWNACCESEMSFNMKTKASQGLLVYFDDE----GFCDFLELLMNNGKLNLRFSIFCAEPVTVFSDVVVNDSQWHGVTIKRNFKNTTLVVDREVKWAEVKSKRRDMTVFSRLFLGGIPPELRTVALRLTSDAAKEQVPFNGWITDLKVN------------NSVPAILT--SGGVDNNACGSETMCLNGGVCSVVNDKPTCDCSETGYQGKDCSEGLAHMMMGDQGKEEYVATFKGSEYFCYDLSQNPIQSSSDEITLSFKTMQRNGLMLHTGK----SADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFN--DNDWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRVALQGDPKMKIHGVVAFKCENVATLDPITFETPEAFITLHKWNAKKTGSISFDFRTTEPNGLLLFSHGRPKQQTKEAKSPLTLKVDFFAIEMLDGHLYLLLDMGSGTTKTRAINKKVNDGEWNHVDFQRDGRAGTISVNTIRTPYQAPGESEILDLD---------DNLYLGGLPENKAGLVFPTEVWTALLNYGFVGCVRDLFIDGQSKDVRR-------MAESQKATGVKSSCSKEAPKQ--CISNPCLNNGVCREGWNRYVCECSGTGFLGRSCERDATILSY-DGSKFMKIQLPVAMHTEAEDVTLRFRSQRAYGVLMATTSRDSAD----TLRLELETGRVRLTINLDCIRINCTTSKGPETLFAGQNLNDNEWHTVRVMRRGKNLQLSVDDLQTITGD---HTQLEFHNIETGIVTE-----KRYLSTVPSN-----FIGHLQSLVFNGMAYIDLCKN 844          
BLAST of neurexin-1 isoform X19 vs. Ensembl Cavefish
Match: nrxn3a (neurexin 3 [Source:NCBI gene;Acc:103035103])

HSP 1 Score: 348.206 bits (892), Expect = 3.171e-98
Identity = 289/1064 (27.16%), Postives = 487/1064 (45.77%), Query Frame = 1
Query:  226 VATFLQDAYI-YNSINIPTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKI-KRYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAY-------QKSETSQLN-QFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSF-LPHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILL-------NFGRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEKKYNFSGSSKLLSNDIIAVGKYETDKFSRY----FTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXX-XXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPED-------HNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTK--NTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDM 3318
            VATF    Y  Y+    P  S  D I L FKT Q    I + G           Y+ + L D  + + I    L    F+     +     DN WH + V+R       S   ++       +           T L S    + G  P T +D       S + N  NF GC+++++Y  ++  L++   A+I       +G++ F KC ++  + PISF T  +YI+L  W   + G + F F+T E N L+ +       +K+  SQ N + DF+A E+ +  L+  ++ GSG  + K +   V+DG  ++V +  +  +  + +++ +     +   + LD   D+Y+GG+P+      LP  LW+ +L  G+VGC+ D+ ++G   D+   AE++N  GI   C+  V+ K  C + PC + G C  G+NRF+CDC+ T Y   TC R A ++ ++G   M + MP    +E EDV+LRF++ R  G+ + T SR S  + RLE+     KL + L       N  +G + + +     D  WHT+++ RR  S  L +DD   +    G    L    I  G     +F  +    F G++    FNG+ Y +L K       E+ A  G      + P++F + +SY+ L  +  Y    L F  KT +  G +L   G   D++ +E+V GY++ +          K   +  ++DN WH V++ R+NS   +   +ID++ + +  +     G  N +   +L++      +   N +   V S +GF+GC++S  +N            +L+  AL  +G +E   E             +C+ + C + G CIQQW    CDC+MT++ G +C+    T  F      + +     +  +T  D L  G  TS+     + +    G   D++   + + K    + + +N+G+    + E+S+ + DG YH V F RNG  A+LQ+D++      P G+    FN Q TI +G              ND+    F G LSGLY+N + + +M
Sbjct:  258 VATFRGSEYFCYDLSQNPIQSSSDEITLSFKTWQRNGLILHTGKS-------ADYVNLALKDGAVSLVIN---LGSGAFEAIVEPVNGKFNDNVWHDVKVTRNLRQVTISVDGILTTTGYTQED---------YTMLGSDDFFYVGGSPST-ADLP----GSPVSN--NFMGCLKEVVYKNNDIRLELSRLARIVDPKMKIQGDVVF-KCENVATLDPISFETPEAYISLPKWNTKRMGSISFDFRTSEPNGLILFTHGKPQDRKATGSQKNTKVDFFAVELLDGSLYLLLDMGSGTIKVKATQNKVNDGAWYHVDIQRDGRSGTISVNSRRTPFTASGESEILDLEGDMYLGGLPDNRAGLILPTELWTAMLNYGYVGCIRDLFIDGRSKDIRQIAEAQNGAGIKPSCN-KVSGK-QCESYPCKNKGVCKEGWNRFVCDCTGTGYWSRTCEREASILSYDGSMYMKVVMPTVMHTEAEDVSLRFMSQRAYGLLMATTSRDSADTLRLELDGSRVKLTVNLDCIRINCNSSKGPETLYAGQKLNDNEWHTVRVIRRGKSYKLTVDDDVAEGQMVGDHTRLEFHNIETGVMTERRFVSHIPSSFIGHLQSLKFNGLLYIDLCKNGDIDYCELNARFGMRSIIAD-PVTFKAKSSYLSLATLQAYTSMHLFFQFKTTSADGIILFNSGDGNDFIAVELVKGYIHYVFDLGNGPNLIKGNSDRPLNDNQWHNVVITRDNSNLHT--LKIDAKAVSQVVN-----GAKNLDLKGDLYIAGLGPNM--YNSLPKLVASREGFKGCLASVDLN--------GRLPDLINDALFRSGQIERGCEVGFIKADLQGPSTTCQEDSCANMGICIQQWENYTCDCSMTSYTGTQCNDPGTTYIFGKGGGTITFNWPANERPSTRTDRLTVGFSTSLKDGILVRIDSAPG-LGDYLMLHIEQGK----ISVTFNIGTVDIIVQENSIPVNDGKYHVVRFTRNGGNATLQVDNWAINEHFPAGRQLTIFNTQATITIGG-------------NDRK-RPFQGQLSGLYYNGLKVLNM 1255          

HSP 2 Score: 104.76 bits (260), Expect = 5.174e-22
Identity = 156/696 (22.41%), Postives = 270/696 (38.79%), Query Frame = 1
Query:  916 WAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLH--FSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMDGR-CIIGYNRFICDCSRTNYTGDTC----------------------GRVAPLVKFNGFQQMIINMP-NGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRG--NKIIRSDYNCFDGN-WHTLKLKRRQLSVILIIDDM--EKKYNFSGSSKLLSNDIIAVGKYET------DKFSRYFTGYMMHFTFNG----INYFELAKEESPSNIEVTATIGDAEPTKEF-PISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSG-------------DYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRE--------NSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFN 2814
            W  + +  L F FKT  S AL+ Y           DF    + E  L   FSI+         VS   V+D   H+V L   +    + +D   K +      + +    DL++GG+P+ + + +  +L +      F G + D+                 +  ++S     +  +G+C   PC +G  C +     +CDCS+T Y G  C                       R   +  F G +    ++  N  QS  +++TL F T + NG+ + T      ++D + + L++G +++++N G G    I+      F+ N WH +K+ R    V + +D +     Y     + L S+D   VG   +         S  F G +    +      +    LA+   P        +   E      PISF +  +YI LPK +      + F  +T    G +L  +GK               D+  +E++ G L LL + G+G  K    + K++D  W+ V + R+        NS+ + F    +S+ +     + L  GGL  N    L L   E + +  N          G+ GCI   +++      +K + Q  +A A    G+   C +    Q    P  C + G C + W R  CDC  T +    C++ +  L ++
Sbjct:   39 WDASTRSDLSFQFKTDASTALVLYFDDG----GYCDFLQLMVVEGKLQLQFSIDCAETTV---VSDKRVNDSSWHFVSLGRYNLRTVLGVDGANKADEVRPQRQYMKIVSDLFLGGLPQDIRTSV-LTLPTAKDLPPFKGIIRDLKY------------GRKVPTLLSSQKVRMDMEGICTENPCENGGICSLVDGEPLCDCSKTEYIGRFCSEEANSIPGLAHMMMADQAKSKAREENVATFRGSEYFCYDLSQNPIQSSSDEITLSFKTWQRNGLILHTGK----SADYVNLALKDGAVSLVINLGSGAFEAIVEPVNGKFNDNVWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDIRLELSRLARIVDPKMKIQGDVVFKCENVATLDPISFETPEAYISLPKWNTKRMGSISFDFRTSEPNGLILFTHGKPQDRKATGSQKNTKVDFFAVELLDGSLYLLLDMGSGTIKVKATQNKVNDGAWYHVDIQRDGRSGTISVNSRRTPFTASGESEILDLEGDMYL--GGLPDNR-AGLIL-PTELWTAMLN---------YGYVGCIRDLFIDG----RSKDIRQ--IAEAQNGAGIKPSCNKVSGKQCESYP--CKNKGVCKEGWNRFVCDCTGTGYWSRTCEREASILSYD 689          
BLAST of neurexin-1 isoform X19 vs. Ensembl Cavefish
Match: nrxn3a (neurexin 3 [Source:NCBI gene;Acc:103035103])

HSP 1 Score: 345.51 bits (885), Expect = 3.010e-97
Identity = 292/1087 (26.86%), Postives = 494/1087 (45.45%), Query Frame = 1
Query:  226 VATFLQDAYI-YNSINIPTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKI-KRYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAY-------QKSETSQLN-QFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSF-LPHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEKKYNFSGSSKLLSNDIIAVGKYETDKFSRY----FTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXX-XXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPED-------HNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTK--NTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDY-------------------NRII----ASP-------KGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDM 3318
            VATF    Y  Y+    P  S  D I L FKT Q    I + G           Y+ + L D  + + I    L    F+     +     DN WH + V+R       S   ++       +           T L S    + G  P T +D       S + N  NF GC+++++Y  ++  L++   A+I       +G++ F KC ++  + PISF T  +YI+L  W   + G + F F+T E N L+ +       +K+  SQ N + DF+A E+ +  L+  ++ GSG  + K +   V+DG  ++V +  +  +  + +++ +     +   + LD   D+Y+GG+P+      LP  LW+ +L  G+VGC+ D+ ++G   D+   AE++N  GI   C+  V+ K  C + PC + G C  G+NRF+CDC+ T Y   TC R A ++ ++G   M + MP    +E EDV+LRF++ R  G+ + T SR S  + RLE  L+  ++ + +N G+G + + +     D  WHT+++ RR  S  L +DD   +    G    L    I  G     +F  +    F G++    FNG+ Y +L K       E+ A  G      + P++F + +SY+ L  +  Y    L F  KT +  G +L   G   D++ +E+V GY++ +          K   +  ++DN WH V++ R+NS   +   +ID++ + +  +     G  N +   +L++      +   N +   V S +GF+GC++S  +N            +L+  AL  +G +E   E             +C+ + C + G CIQQW    CDC+MT++ G +C+    T  F      + +     +  +T  D L  G  TS+     + +    G   D++   + + K    + + +N+G+    + E+S+ + DG YH V F RNG  A+LQ+D++                   N+ I    A P       KG+    FN Q TI +G              ND+    F G LSGLY+N + + +M
Sbjct:  258 VATFRGSEYFCYDLSQNPIQSSSDEITLSFKTWQRNGLILHTGKS-------ADYVNLALKDGAVSLVIN---LGSGAFEAIVEPVNGKFNDNVWHDVKVTRNLRQVTISVDGILTTTGYTQED---------YTMLGSDDFFYVGGSPST-ADLP----GSPVSN--NFMGCLKEVVYKNNDIRLELSRLARIVDPKMKIQGDVVF-KCENVATLDPISFETPEAYISLPKWNTKRMGSISFDFRTSEPNGLILFTHGKPQDRKATGSQKNTKVDFFAVELLDGSLYLLLDMGSGTIKVKATQNKVNDGAWYHVDIQRDGRSGTISVNSRRTPFTASGESEILDLEGDMYLGGLPDNRAGLILPTELWTAMLNYGYVGCIRDLFIDGRSKDIRQIAEAQNGAGIKPSCN-KVSGK-QCESYPCKNKGVCKEGWNRFVCDCTGTGYWSRTCEREASILSYDGSMYMKVVMPTVMHTEAEDVSLRFMSQRAYGLLMATTSRDSADTLRLE--LDGSRVKLTVNLGKGPETLYAGQKLNDNEWHTVRVIRRGKSYKLTVDDDVAEGQMVGDHTRLEFHNIETGVMTERRFVSHIPSSFIGHLQSLKFNGLLYIDLCKNGDIDYCELNARFGMRSIIAD-PVTFKAKSSYLSLATLQAYTSMHLFFQFKTTSADGIILFNSGDGNDFIAVELVKGYIHYVFDLGNGPNLIKGNSDRPLNDNQWHNVVITRDNSNLHT--LKIDAKAVSQVVN-----GAKNLDLKGDLYIAGLGPNM--YNSLPKLVASREGFKGCLASVDLN--------GRLPDLINDALFRSGQIERGCEVGFIKADLQGPSTTCQEDSCANMGICIQQWENYTCDCSMTSYTGTQCNDPGTTYIFGKGGGTITFNWPANERPSTRTDRLTVGFSTSLKDGILVRIDSAPG-LGDYLMLHIEQGK----ISVTFNIGTVDIIVQENSIPVNDGKYHVVRFTRNGGNATLQVDNWAINEHFPAGNNDNERLQMANKKIPFKYARPVEEWLQEKGRQLTIFNTQATITIGG-------------NDRK-RPFQGQLSGLYYNGLKVLNM 1276          

HSP 2 Score: 110.923 bits (276), Expect = 6.726e-24
Identity = 178/800 (22.25%), Postives = 306/800 (38.25%), Query Frame = 1
Query:  916 WAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLH--FSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMDGR-CIIGYNRFICDCSRTNYTGDTC----------------------GRVAPLVKFNGFQQMIINMP-NGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRG--NKIIRSDYNCFDGN-WHTLKLKRRQLSVILIIDDM--EKKYNFSGSSKLLSNDIIAVGKYET------DKFSRYFTGYMMHFTFNG----INYFELAKEESPSNIEVTATIGDAEPTKEF-PISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSG-------------DYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRE--------NSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDD 3126
            W  + +  L F FKT  S AL+ Y           DF    + E  L   FSI+         VS   V+D   H+V L   +    + +D   K +      + +    DL++GG+P+ + + +  +L +      F G + D+                 +  ++S     +  +G+C   PC +G  C +     +CDCS+T Y G  C                       R   +  F G +    ++  N  QS  +++TL F T + NG+ + T      ++D + + L++G +++++N G G    I+      F+ N WH +K+ R    V + +D +     Y     + L S+D   VG   +         S  F G +    +      +    LA+   P        +   E      PISF +  +YI LPK +      + F  +T    G +L  +GK               D+  +E++ G L LL + G+G  K    + K++D  W+ V + R+        NS+ + F    +S+ +     + L  GGL  N    L L   E + +  N          G+ GCI   +++      +K + Q  +A A    G+   C +    Q    P  C + G C + W R  CDC  T +    C++ +  L + D   Y+   +    +T  ++++    +       +     D       + RL  D  R  L +  NLG G   L  +   + D  +H V   R G    L +DD
Sbjct:   39 WDASTRSDLSFQFKTDASTALVLYFDDG----GYCDFLQLMVVEGKLQLQFSIDCAETTV---VSDKRVNDSSWHFVSLGRYNLRTVLGVDGANKADEVRPQRQYMKIVSDLFLGGLPQDIRTSV-LTLPTAKDLPPFKGIIRDLKY------------GRKVPTLLSSQKVRMDMEGICTENPCENGGICSLVDGEPLCDCSKTEYIGRFCSEEANSIPGLAHMMMADQAKSKAREENVATFRGSEYFCYDLSQNPIQSSSDEITLSFKTWQRNGLILHTGK----SADYVNLALKDGAVSLVINLGSGAFEAIVEPVNGKFNDNVWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDIRLELSRLARIVDPKMKIQGDVVFKCENVATLDPISFETPEAYISLPKWNTKRMGSISFDFRTSEPNGLILFTHGKPQDRKATGSQKNTKVDFFAVELLDGSLYLLLDMGSGTIKVKATQNKVNDGAWYHVDIQRDGRSGTISVNSRRTPFTASGESEILDLEGDMYL--GGLPDNR-AGLIL-PTELWTAMLN---------YGYVGCIRDLFIDG----RSKDIRQ--IAEAQNGAGIKPSCNKVSGKQCESYP--CKNKGVCKEGWNRFVCDCTGTGYWSRTCEREASILSY-DGSMYMKVVMPTVMHTEAEDVSLRFMSQRAYGLLMATTSRDSAD----TLRLELDGSRVKLTV--NLGKGPETLY-AGQKLNDNEWHTVRVIRRGKSYKLTVDD 785          
BLAST of neurexin-1 isoform X19 vs. Ensembl Cavefish
Match: ENSAMXT00000043111.1 (pep primary_assembly:Astyanax_mexicanus-2.0:14:7993674:8103549:1 gene:ENSAMXG00000020839.2 transcript:ENSAMXT00000043111.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 330.872 bits (847), Expect = 2.268e-96
Identity = 243/867 (28.03%), Postives = 404/867 (46.60%), Query Frame = 1
Query:  226 VATFLQDAYI-YNSINIPTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLT-RGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQ----KSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFL-PHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCM-DGRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEKKYNFSGSSKLLSNDIIAVGKYETDKF----SRYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXX-XXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVE-DCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERC 2784
            VATF  + +  Y+    P  S  D I L F+T Q    + + G           Y+ + L    + + I    L    F+           DN WH + VSR       S   L+       +           T L S    + G  P T +D      ++      NF GC++ ++Y+ +   L++   A+++   ++ +G++ F +C D+  + P+SF T A+Y+TL  W   + G + F F+T E N LL +     +    +  + DF+A E+ E FL+  ++ GSG  + K S+  V+DG   +V    E     V ++       TN   + LD   D+Y+GG+PE     L P  +W+  LR GFVGC+ D+ V+G   DL   AE ++  G+ S C+ +   +  C+  PC   G C  G+NR ICDCS T + G  C   + ++ ++G   + + MP    +E EDV+LRF++ R  G+ + T S  S ++D L + L+ G++ + +N G+G + + +     D  WH++K+ RR  S+ L +D++  +   SG+   L    I  G     +F       F G++    FNG+ Y +  K    S  E+ A  G      + P+SF S  SY+ L  +  Y    L F  KT +  G +L   G   D++++E+V GY++ +          K   +  ++DN WH V++ R++S   +   +IDS+ + + ++     G  N +    L++G   K  S  N +   + S  G++GC++S  +N            +L+A AL   G VE  C  D     +C  + C + G C+QQW    CDC MTT+ G  C
Sbjct:   14 VATFKGNEFFSYDLSQTPIQSSTDEITLSFRTLQRNGLLLHTGKSA-------DYVNLSLKSGAVCLVIN---LGSGAFEALVEPSDGKFNDNAWHAVRVSRNLRQVTISVDGLLTTTGYTQED---------YTMLGSDDFFYVGGSPNT-ADLPGSPVSN------NFMGCLKDVVYTNNEFKLELSHLAELRDPKVSLQGDLTF-RCEDVAALDPVSFDTPAAYVTLPRWNGKKTGSVSFDFRTTEPNGLLIFSHGRVQGPRERRPRVDFFAMELLEGFLYLLMDMGSGSIKMKASTKKVNDGEWCHVDFQREGRKGSVSVNGRSMPFSTNEGSEVLDLDGDMYLGGLPEESEGLLLPPEVWTAPLRLGFVGCVRDLFVDGRSRDLRRLAELQSAVGVSSFCTRETHRR--CSAEPCAHGGHCREGWNRHICDCSGTGFLGPNCETESTVLSYDGSMFLKVLMPRAQHTEAEDVSLRFMSQRAYGLLMATTS--SESADTLRLELDGGRVKLTVNLGKGPETLYAGQKLNDNEWHSVKVVRRGKSLQLSVDNVTVEGQMSGAHTQLEFHHIETGIMTERRFISVMPSNFIGHLQGLNFNGLPYLDQCKNGDISYCELNARFGMRRIVAD-PVSFRSRPSYLALSTLQAYASMHLFFQFKTTSPDGLLLFNSGDGSDFIVVELVKGYIHYVFDLGNGPSLMKGNSDKPLNDNQWHNVVVSRDDSNVHT--LKIDSRTVTQHSN-----GARNLDLKGELYVGGVGK--SMYNSLPKLIASRDGYQGCLASVDLN--------GRLPDLIADALHKVGQVERGC--DAGPGTTCTEDSCSNQGVCLQQWEGFTCDCTMTTYGGPLC 829          

HSP 2 Score: 94.3597 bits (233), Expect = 5.115e-19
Identity = 138/610 (22.62%), Postives = 242/610 (39.67%), Query Frame = 1
Query: 1612 QSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGN---KIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDM--EKKYNFSGSSKLLSNDIIAVG------KYETDKFSRYFTGYMMHFTFNG----INYFELAKEESPS-NIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSG---------DYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQ---GFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDS-----FSGYLSGLYFNRIPLSDMIDN--ISY 3336
            QS  +++TL F T + NG+ + T      ++D + + L++G + +++N G G     +  SD    D  WH +++ R    V + +D +     Y     + L S+D   VG             S  F G +    +      +    LA+   P  +++   T    +     P+SF +  +Y+ LP+ +      + F  +T    G ++  +G+           D+  +E++ G+L LL + G+G  K      K++D  W  V   RE  K S  +    S P       E+    L+ +   +++LG   +  S+   +  +V ++    GF GC+   +      V  +S     LA   +  GV   C  + + + S  P  C  GG C + W R  CDC+ T F+G  C+  S  L + D   +L   +   ++T  ++++    +       +     +       + RL  D GR  L +  NLG G   L  +   + D  +H V   R G    L +D+           T + F+   T                +  ++ F S     F G+L GL FN +P  D   N  ISY
Sbjct:   33 QSSTDEITLSFRTLQRNGLLLHTGK----SADYVNLSLKSGAVCLVINLGSGAFEALVEPSDGKFNDNAWHAVRVSRNLRQVTISVDGLLTTTGYTQEDYTMLGSDDFFYVGGSPNTADLPGSPVSNNFMGCLKDVVYTNNEFKLELSHLAELRDPKVSLQGDLTFRCEDVAALDPVSFDTPAAYVTLPRWNGKKTGSVSFDFRTTEPNGLLIFSHGRVQGPRERRPRVDFFAMELLEGFLYLLMDMGSGSIKMKASTKKVNDGEWCHVDFQREGRKGS-VSVNGRSMPFSTNEGSEV----LDLDG--DMYLGGLPEE-SEGLLLPPEVWTAPLRLGFVGCVRDLF------VDGRSRDLRRLAELQSAVGVSSFCTRETHRRCSAEP--CAHGGHCREGWNRHICDCSGTGFLGPNCETESTVLSY-DGSMFLKVLMPRAQHTEAEDVSLRFMSQRAYGLLMATTSSESAD----TLRLELDGGRVKLTV--NLGKGPETLY-AGQKLNDNEWHSVKVVRRGKSLQLSVDNVTVEGQMSGAHTQLEFHHIET---------------GIMTERRFISVMPSNFIGHLQGLNFNGLPYLDQCKNGDISY 599          
BLAST of neurexin-1 isoform X19 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002142.1 (pep scaffold:Pmarinus_7.0:GL476386:209124:506099:1 gene:ENSPMAG00000001935.1 transcript:ENSPMAT00000002142.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 332.798 bits (852), Expect = 2.328e-94
Identity = 288/1086 (26.52%), Postives = 490/1086 (45.12%), Query Frame = 1
Query:  217 EIPVATFLQDAYI-YNSINIPTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSG-------QLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFL-TRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLN--------QFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFL-PHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGR----------GNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEKKYNFSGSSKLLSNDIIAVGKYETDKFSRY----FTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXXXXXXXXXXKKVRKEIK--IDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPT--KNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQN---DK-----TFDS--------------FSGYLSGLYFN 3297
            E  +ATF    Y+ Y+    P  S  D I L FKT Q    I + G           Y+ + L D  + + I    L    F+     +     DN WH + V+R    + +S G       Q+V+ + VDG +          T L S    + G  P T +D       S + N  NF GC++++IY   +  L++   AK     +   GEI F  C ++  + PI+F    ++ITL  W   + G + F F+T E + L+ + + + S++         + DF+A E+ +  L   ++ GSG  + K + + V+DG  ++V    +     + +++ +         + LD   ++++GG+PE     L P  LWS +L  G+VGC+ D+ ++G   D+   AE +N  G+   C+ D   +  C++ PC + G C  G+NR++CDC+ T YTG +C R A ++ ++G   M + MP    +E EDVTLRF++ R  G+ + T SR S  + RLE+     KL I L+  R          G +I+ +  +  D  WHT+++ RR  ++ L +D         G    L    I  G     +++      F G++ +  FNG+ Y +L +       E+ A  G      + PI F +  SY+ L  +  Y    L F  K+ ++ G +L   G + DY+ +E+V G+              +R   K  ++DN WH VI+ R+N+   +   ++D+Q + +  +     G  N +   +LF+G  EK  S   ++   V S +G++GC++S  +N         +   L   +   N +   C        +C+   C + G C+Q W    CDC MT+F G  C+    T  F+     + Y   P    +T  D LA G  ++ +  + ++ ++      DFI   + + K    + + +N+G+    + E++V + DG YH   F RNG   +LQ+D++      P G      N++  +   + P+   R GR V +   DK      F+S              F G L+GLY+N
Sbjct:    3 EESMATFKGSEYLCYDLAAHPIQSSSDEITLSFKTLQRNGLILHTGK-------AADYVNLALKDGAVSLVIN---LGSGAFEALVEPVTGKFNDNNWHDVKVTRN-LRQLSSIGHAMVNKLQIVVTISVDGILTSTGYTQEDYTMLGSDDFFYVGGSPNT-ADLP----GSPISN--NFMGCLKEVIYKNSDQKLELSKLAKEGEPKMKVVGEISF-TCENVAALDPITFEAPEAFITLPKWKTKRTGSISFDFRTTEPSGLIIFTQGKVSEVKDSKGLRSRKGDFFAIELFDGHLFLLLDMGSGTIKLKATESNVNDGEWYHVDFQRDGRTGSISVNSQRSPFTAGGDNEILDLDSEVFLGGLPEDKADLLLPTELWSALLNIGYVGCVRDLFIDGQSKDVRQLAEQQNAAGVKPFCAKDSPKQ--CSSNPCRNHGVCREGWNRYVCDCTATGYTGRSCEREASILSYDGSMFMKVVMPVVIHTEAEDVTLRFVSQRAYGLLLATTSRDSADTLRLELDSARVKLTINLDCVRIKCNSTSARKGPEILYAGKHLNDNVWHTVQVIRRGKTLKLTVDGTSADGLMDGDHTRLEFHNIETGIMTERRYTSVMPSNFMGHLQNVVFNGMAYIDLCRNGDIRYCELNARFGMRTIIAD-PIIFKTRGSYLTLATLQAYTSMYLFFQFKSTSSDGLILYNSGDANDYIAVELVKGH-IHYIFDLGNGQDLIRDNSKRVLNDNRWHNVIISRDNNNIHT--LKVDTQTVSQNVN-----GARNLDLKGDLFIGGLEK--SMYAKLPKLVASREGYQGCLASLDLN-------GRLPDLLKEASYKVNEIERGC---EGPSTTCQEYSCGNQGMCVQHWATFTCDCTMTSFSGAYCNDPGTTYIFSKGGGLITYTWRPNDRPSTRADRLAVG-FSTHLKDALLVRVDSAATLGDFIELYIKQGK----VGVTFNVGTEDISVNETNVAVNDGNYHVARFSRNGGNCTLQLDNHPINERYPSGNID---NERLALARQRIPY---RLGRVVDDWLLDKGRQLTIFNSQATITIGGQDRERPFQGQLAGLYYN 1035          

HSP 2 Score: 87.4261 bits (215), Expect = 1.661e-17
Identity = 115/480 (23.96%), Postives = 195/480 (40.62%), Query Frame = 1
Query: 1543 GRVAPLVKFNGFQQMIINMP-NGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGN-----KIIRSDYNCFDGNWHTLKLKR--RQLS-------------VILIIDDM--EKKYNFSGSSKLLSNDIIAVG------KYETDKFSRYFTGYMMHFTFNG----INYFELAKEESPSNIEVTATIGDAEPTKEF-PISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGK-------------SGDYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRE--------NSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMN-QTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFN 2814
            GR   +  F G + +  ++  +  QS  +++TL F T + NG+ + T      A+D + + L++G +++++N G G      + +   +N  D NWH +K+ R  RQLS             V + +D +     Y     + L S+D   VG             S  F G +    +      +   +LAKE  P    V       E      PI+F +  ++I LPK        + F  +T    G ++   GK              GD+  +E+  G+L LL + G+G  K    E  ++D  W+ V   R+        NS+ S F    D++ +   + + L  GGL  +  + L     E + +  N          G+ GC+   +++ Q+K V   +  QN         GV   C +D   Q  C  N C + G C + W R  CDC  T + G  C++ +  L ++
Sbjct:    1 GREESMATFKGSEYLCYDLAAHPIQSSSDEITLSFKTLQRNGLILHTGK----AADYVNLALKDGAVSLVINLGSGAFEALVEPVTGKFN--DNNWHDVKVTRNLRQLSSIGHAMVNKLQIVVTISVDGILTSTGYTQEDYTMLGSDDFFYVGGSPNTADLPGSPISNNFMGCLKEVIYKNSDQKLELSKLAKEGEPKMKVVGEISFTCENVAALDPITFEAPEAFITLPKWKTKRTGSISFDFRTTEPSGLIIFTQGKVSEVKDSKGLRSRKGDFFAIELFDGHLFLLLDMGSGTIKLKATESNVNDGEWYHVDFQRDGRTGSISVNSQRSPFTAGGDNEILDLDSEVFL--GGLPEDKADLLL--PTELWSALLN---------IGYVGCVRDLFIDGQSKDVRQLAEQQNAA-------GVKPFCAKDSPKQ--CSSNPCRNHGVCREGWNRYVCDCTATGYTGRSCEREASILSYD 452          
BLAST of neurexin-1 isoform X19 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004299.1 (pep scaffold:Pmarinus_7.0:GL477235:143017:163597:1 gene:ENSPMAG00000003933.1 transcript:ENSPMAT00000004299.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 122.479 bits (306), Expect = 2.175e-30
Identity = 93/354 (26.27%), Postives = 161/354 (45.48%), Query Frame = 1
Query: 1759 GRGNKIIRSDYNCFDGNWHTLKL----KRRQLSVILIIDDMEKKYNFSGSSKLLSNDIIAVGKYETDKFSRY----FTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXX-XXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRID--SQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCD 2787
            G+G +++ +     D  WHT+++    KRR   + L +D++ K+   +G    L    I  G     +++      F G++    FNG+ Y +L K    +  E+ A  G      + P++F + +SY+ L  +  Y    L F  KT +  G +L   G   D++ LE+V GYL+            K + E +++DN WH VI++R+ +   +     D  +Q   E  +++LK          +LF+G   +     + +   V S  GF+GC++S  +N            +LL  AL  +G +E   E       C+ + C + G C+QQW    CDC MT++ G  C+
Sbjct:    2 GKGPEVLHAGQKLNDNEWHTVRVSRRGKRRGKLLKLSVDEVSKEDEMAGDHTRLEFHNIETGIMTERRYTSVVPSNFIGHLQSLVFNGLPYLDLCKNGDVALCEINARFGLRTIIAD-PVTFRTRSSYLTLATLQAYAAMHLFFQFKTMSPDGLLLYNGGDGTDFIALELVQGYLHYAFDLGKGPSVIKGKSEGQLNDNQWHSVIVMRDANNLHTLKVDRDMATQNGNEARNLDLKG---------DLFVGGLPR--EHYSGLHKLVVSRDGFQGCLASVDLN--------GRLPDLLDDALRRSGQIERGCE--GPSTVCQDDSCSNQGLCVQQWEEFTCDCTMTSYTGAFCN 333          

HSP 2 Score: 102.449 bits (254), Expect = 1.506e-23
Identity = 76/235 (32.34%), Postives = 117/235 (49.79%), Query Frame = 1
Query:  859 FIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHFSINTGSG--VYQQKVSSTPVSDGLSHYVKLWFEDGNVE-VQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGILRQGFVGCLLDISVNG---DQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTC 1542
             I  P++F T +SY+TLA         L F FKT+  + LL Y   + +     DF A E+ + +LH++ + G G  V + K S   ++D   H V +  +  N+  +++D D   ++ N   + LD   DL++GG+P    S L H L   + R GF GCL  + +NG   D  D AL+   +    I  GC G  T   +C +  C + G C+  +  F CDC+ T+YTG  C
Sbjct:  115 IIADPVTFRTRSSYLTLATLQAYAAMHLFFQFKTMSPDGLLLYNGGDGT-----DFIALELVQGYLHYAFDLGKGPSVIKGK-SEGQLNDNQWHSVIVMRDANNLHTLKVDRDMATQNGNE-ARNLDLKGDLFVGGLPREHYSGL-HKLV--VSRDGFQGCLASVDLNGRLPDLLDDALRRSGQ----IERGCEGPST---VCQDDSCSNQGLCVQQWEEFTCDCTMTSYTGAFC 332          
BLAST of neurexin-1 isoform X19 vs. Ensembl Sea Lamprey
Match: cntnap2b (contactin associated protein like 2b [Source:ZFIN;Acc:ZDB-GENE-070912-26])

HSP 1 Score: 73.9442 bits (180), Expect = 1.976e-13
Identity = 105/419 (25.06%), Postives = 161/419 (38.42%), Query Frame = 1
Query:  676 DSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLT-RGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESF-LHFSINTGSGVYQQKV-SSTPVSDGLSHYVKLW--FEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKG-LCANRPCMDGRCIIGYNRFICDCSRTNYTGDTC-GRVAPLVKFNGFQQ--------------MIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFL----ENGKLNILLNF-GRGNKIIRSDYNCFDGNWHTLKLKR--RQLSV 1848
            D+D    +  S L         MQ +I  TD A    L++A  K   L+  G+ +F           + FTT +SY+            + F FKT   + ++         +   DF   +++    + FS + G+G  +  V S  P++D   H V +    ++ ++ V L   + +      + +L  +  LY+G       S   HS        GF+GC+  + +NG   DL  +A      G+  GCSG     G LC N     GRCI  YN + CDCS ++Y G +C   V    +   + Q                I  P       E V L F TT    I +         +D  E F     E+G+L I     G    I     N  +G  H L + R  R++SV
Sbjct:  676 DTDMEHWKEDSGLLGYKPHLPVMQLLIGDTDRA----LSEAAYKVGPLSCHGDRHF--------WNSVLFTTPSSYLHFPPIRAETSLDIAFFFKTTTDSGVI------LENMGASDFIRVQLKSPHEVSFSFDVGNGPVEMAVRSEQPLNDEEWHVVSVERSLKEASLRVDLLPRELVPAPAQGHTSLQLSSQLYVGS------SVSGHS--------GFLGCVRSLRINGATLDLEERARV--TPGVKPGCSGHCRSYGSLCRN----GGRCIERYNGYSCDCSTSSYNGPSCTNEVGGFFELGTWIQYDLLEDDDDEEAVAAAIREPLEDSLPGETVLLSFSTTSVPAILLYV------GTDSWEYFAVLLQEDGRLQIRYQLGGETEAIYMEPRNLANGQPHGLNVTRHGREISV 1050          

HSP 2 Score: 62.7734 bits (151), Expect = 4.969e-10
Identity = 82/364 (22.53%), Postives = 142/364 (39.01%), Query Frame = 1
Query: 2092 ISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEI--VHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKA-GGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRP--NICHSGGRCIQQWIRIRCDCAMTTFIGERC-DKVSKTLKFNDYPAYLIYKL------------SPTKNTTLDE---LAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQI 3120
            + F + +SY+  P I       + F  KT  + G +L+  G S D++ +++   H                VR E  ++D  WH V + R   ++S    R+D  P   R  +   A G  +      L++GS+             V+   GF GC+ S  +N            +L   A    GV   C         CR   ++C +GGRCI+++    CDC+ +++ G  C ++V    +   +  Y + +              P +++   E   L+F   +       +      G  S    A L+++ GR  L I Y LG     +     N+A+G  H +   R+G   S+Q+
Sbjct:  731 VLFTTPSSYLHFPPIRAETSLDIAFFFKTTTDSGVILENMGAS-DFIRVQLKSPHEVSFSFDVGNGPVEMAVRSEQPLNDEEWHVVSVERSLKEAS---LRVDLLP---RELVPAPAQGHTSLQLSSQLYVGSS-------------VSGHSGFLGCVRSLRINGATL--------DLEERARVTPGVKPGC------SGHCRSYGSLCRNGGRCIERYNGYSCDCSTSSYNGPSCTNEVGGFFELGTWIQYDLLEDDDDEEAVAAAIREPLEDSLPGETVLLSFSTTSVPAILLYV------GTDSWEYFAVLLQEDGR--LQIRYQLGGETEAIYMEPRNLANGQPHGLNVTRHGREISVQV 1052          
BLAST of neurexin-1 isoform X19 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000342.1 (pep scaffold:Pmarinus_7.0:GL477011:22393:100421:-1 gene:ENSPMAG00000000299.1 transcript:ENSPMAT00000000342.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.9366 bits (167), Expect = 6.981e-12
Identity = 77/288 (26.74%), Postives = 118/288 (40.97%), Query Frame = 1
Query:  727 NFKGCMQKIIYSTDNANLDILAQAKIKRYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHFSINTG--------SGVYQQKVSS-TPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDT-TRDLY-IGGIPETLVSF---LPHSLWSGILRQGFVGCLLDISVNGDQFDLALKAES--ENITGIVSGCSGDVTDKGLCANRPCMDGRCIIGYNRFICDCSRTNYTGDTC 1542
            NF+GC++ + Y  +  NL  LA+ +    ++T G + F  C++  ++ PI+F    S + L G AW +   +    +T  +   L Y            F     R S L   ++ G         G     +S+ + ++DG  H V +      V V LD D+     +  Y  LD  T D+Y +GG P          PH          F+GCL  I +     D+ L  +    N TG      G + D+ L  N     G+C   ++ F CDC  T Y GDTC
Sbjct:   81 NFQGCLENVSY--NGVNLIDLAKRRKPAVYIT-GNVSF-ACAEPRVV-PITFPLPGSSLWLWGPAWHEALSVVLELRTWSARGTLVYTA----------FSPAGPRASSLSIGLDDGRLTVTLLQPGRDALHLSAGSDLNDGQWHSVSVSLRRNFVGVTLDGDEASAIQS--YNPLDILTGDVYYLGGCPAVAAPGQCRAPHG--------SFLGCLRSIRIAEQDLDMGLVEQGMLGNFTGAQLNTCG-ILDRCL-PNHCEHGGQCSQEWDSFFCDCDGTGYLGDTC 341          

HSP 2 Score: 56.225 bits (134), Expect = 6.208e-8
Identity = 100/487 (20.53%), Postives = 175/487 (35.93%), Query Frame = 1
Query:  877 SFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIR---ESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDA-DKKIEHTNSLYKT-LDTTRDLYIGGIPETLVSFLPHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKG-LCANRPCMDGRCIIGYNRFICDCSRTNYTGDTCGR-VAPLVKFNGFQQMIINMPNGFQS---------------ECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLE-NGKLNILLNFGRGNKIIRS----DYNCFDGNWHTLKLKRRQLSVILIID---DMEKKYNFSGSSKLLSNDIIAVGKYETDKFS----------RYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTK--EFPISFPSVNSYIRLPKIDMYGDF--KLEFLIKTRNNKGSVLQ 2205
            SF+   +Y+    +   +   + F FKTV               L    F   E++   E  L F +  G  V    VS  P++D   H V          +Q+D   +++  +     T L     L++G                   ++GF+GCL  + +NG    L  +A +  + G+  GC+G  +  G LC N     GRC+  Y+ + CDC+ T + G  C + V    +     Q  ++  +  QS               + E     F T     + +   +     S  L I LE NG L +    G G    R+      N  DG  H + + RR   ++L +D       +     +    + D + +G+   D+            R F G +    +NG    + A  + P +  V   +G   P+     P +   V+     P    + +    +   ++  N +G+ L+
Sbjct:  553 SFSNRTAYLLFPTFRGEKSADISFYFKTVAPFGTF------LENLGLQHFLRLELKSPLEVSLRFDVGDGP-VELIAVSPWPLNDDQWHRVCAERNVKRASLQVDELPRRVRRSPPDGHTRLRLNSQLFVGATASG--------------KRGFLGCLRALQMNGVTLSLEERARTA-VGGVNPGCTGHCSSYGSLCRN----GGRCVERYSGYSCDCTHTPFDGPFCTQEVGAYFEAGTVVQFSLDSESREQSIEEDEDEQAEEEDDLDEERAIFSFSTVHAPAVLLHASTHAY-PSSYLAIVLEHNGSLQLWFG-GSGTSSPRTVSAGMRNLADGQVHAVNMTRRGTLILLQLDHYLPTAHRLPTGHAPYPRAADTLYLGRVP-DEVPLEPEVAGLNWRGFGGCLSRVQYNGWAPLKAALRQGPHSSLVVTVMGRLVPSSCAAVPQTVAPVSPSTPYPWAHQHAEHLKSMCMNLQPENGQGTALR 1010          

HSP 3 Score: 49.2914 bits (116), Expect = 7.781e-6
Identity = 40/159 (25.16%), Postives = 64/159 (40.25%), Query Frame = 1
Query: 2314 KIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDK 2790
             ++D+ WHRV   R   ++S    ++D  P   R         L  NS   LF+G+               +  +GF GC+ +  MN    V+     +   A+   N G    C        S   ++C +GGRC++++    CDC  T F G  C +
Sbjct:  627 PLNDDQWHRVCAERNVKRAS---LQVDELPRRVRRSPPDGHTRLRLNS--QLFVGAT-------------ASGKRGFLGCLRALQMNG---VTLSLEERARTAVGGVNPGCTGHC--------SSYGSLCRNGGRCVERYSGYSCDCTHTPFDGPFCTQ 756          
BLAST of neurexin-1 isoform X19 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007718.1 (pep scaffold:Pmarinus_7.0:GL476589:4931:52526:1 gene:ENSPMAG00000006969.1 transcript:ENSPMAT00000007718.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.2402 bits (160), Expect = 3.628e-11
Identity = 77/285 (27.02%), Postives = 122/285 (42.81%), Query Frame = 1
Query:  727 NFKGCMQKIIYSTDNANLDILAQAKIKRYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAG---W---AWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHF--SINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLD--TTRDLYIGGIPETLVSFLPHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDV---TDKGLCANRPCMDGRCIIGYNRFICDCSRTNYTGDTC 1542
            NF GCM+ + Y+ ++   D+  +AK + +    G + F   +++ +I P++F +   Y+ LAG   W   A  Q   L   F+T ++  LL  Q     Q +  +     + E  LH   S+N         V+ + ++DG  H V L   D ++ V +D     EH   L   L        Y GG   T     P    S +    F+GC+  I ++    D+ L    + + G       D+   TD+ L  N     GRC+  +  F CDC  T+YTG TC
Sbjct:  198 NFLGCMENVYYNGEDVT-DLARRAKPQIHIT--GNVMFGCPAEVALI-PVTFPSPGGYLALAGHLLWPNHAQPQIQSLGLQFRTWDAAGLL-LQVVSVVQGHGVEGLRLALSEGKLHMTSSLNLQGRTELFLVTGSSLNDGEWHGVTLQARDDSLLVMVDGR---EHFVMLSPVLHLIAGNAYYFGGTNTT-----PGHPQSAVAP--FLGCMRLIHMDNQPVDITLL--QQGLLGTFINVHFDLCGLTDRCL-PNHCEHGGRCMQTWGGFSCDCQGTSYTGSTC 464          
BLAST of neurexin-1 isoform X19 vs. Ensembl Nematostella
Match: EDO47422 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM09])

HSP 1 Score: 94.7449 bits (234), Expect = 7.879e-20
Identity = 110/447 (24.61%), Postives = 177/447 (39.60%), Query Frame = 1
Query:  895 SYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLD-ADKKIEHTNSLYKTLD--TTRDLYIGGIPETLVSFLPHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMDGRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMI----INMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGNKIIRSDYNCF-DGNWHTLKLKRRQLSVILIIDDMEK-------KYNF----SGSSKLLSNDIIAVGKYETDKFS-----RYFTGYMMHFTFNGIN-----YFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYG 2148
            SY T     W   G++ F F+T +SN LL YQ          DF    +    +   I       Q+K+     +D   H V++  E  NV   +D A  K+  + S        T R LY+   P TL   L   +        F GCL D+     +  L  +A   + +G  SGC+       L  N+    GRC     R  C+C  T Y GD CG  +    FNG   ++    I+ P G  +    +  RF T  P+G+ +      S   D + + L  G + +  + G+G   I S   C  DG WH++ + R++  V L +D  E+       +++F     G  KL        G  ++D  +     + FTG +    F+        + +   +E  +  EV+          + P+  P+ +   R+P +D+ G
Sbjct:   33 SYTTFE--PWNLHGEVSFVFRTNQSNGLLLYQDD-----GMHDFVELFLDNGNVRIKIGIDDCYIQEKLVQGSFNDFHWHRVRITREPRNVTFAVDRAWLKLPCSPSKGDKFARATGRFLYVASFPPTLGLNLNWLV--------FPGCLGDLWFTTSEQRLD-QATLRDSSGTTSGCNSPCRTPQL--NKCLHGGRCSAEIGRVECECQGTGYEGDDCGIESSSAWFNGSSYVLYDVGIHQP-GRSTLTNTIAFRFATGNPDGVIV----HSSMFDDHVVVELSKGFVRVSFDLGQGRLNITSREGCLHDGTWHSVTIHRKRRRVTLDLDKQERVTVVIPGQFSFLDFKGGQEKLY-----FCGGPDSDTLAYSYSRKNFTGIIQQLRFDEYQVIDEVFTDRVHKEFVAVGEVSNASAILSKISQNPLPLPNCSRLARVPPVDLCG 451          

HSP 2 Score: 55.8398 bits (133), Expect = 1.035e-7
Identity = 75/369 (20.33%), Postives = 146/369 (39.57%), Query Frame = 1
Query: 2092 ISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSG--DYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAG---GLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRP---NICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKL---SPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTS 3165
            I++P   SY      +++G+    F    R N+ + L LY   G  D++ L + +G + +     + + ++   +   +D  WHRV + RE  ++ +FA         +RA ++L      G  F      FL     Y++          +   F GC+   +   ++    ++  ++       ++G    C         CR    N C  GGRC  +  R+ C+C  T + G+ C   S +  FN   +Y++Y +    P ++T  + +AF          +    +G    S      ++ +  +  + + ++LG G   +      + DG +H V   R     +L +D   R+     G+ S
Sbjct:   27 ITYPKY-SYTTFEPWNLHGEVSFVF----RTNQSNGLLLYQDDGMHDFVELFLDNGNVRIKIGIDDCYIQEKLVQGSFNDFHWHRVRITRE-PRNVTFAV--------DRAWLKLPCSPSKGDKFARATGRFL-----YVASFPPTLGLNLNWLVFPGCLGDLWFTTSEQRLDQATLRD-------SSGTTSGC------NSPCRTPQLNKCLHGGRCSAEIGRVECECQGTGYEGDDCGIESSSAWFNGS-SYVLYDVGIHQPGRSTLTNTIAF--------RFATGNPDGVIVHSSMFDDHVVVELSKGFVRVSFDLGQGRLNITSREGCLHDGTWHSVTIHRKRRRVTLDLDKQERVTVVIPGQFS 354          
BLAST of neurexin-1 isoform X19 vs. Ensembl Nematostella
Match: EDO46873 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNK6])

HSP 1 Score: 83.5741 bits (205), Expect = 3.258e-16
Identity = 84/336 (25.00%), Postives = 146/336 (43.45%), Query Frame = 1
Query: 1021 DFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTL-DTTRDLYIGGIP----ETLVSFLPHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMDGRCIIGYNRFICDCSRTNYTGDTCGRV----APLVKFNGFQQM----IINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGNK-IIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEKKYNFSGSS--KLLSNDIIAVGKYET-DKFSRYFTGYM 1977
            DF +  +RE  + F  + GSG    + SSTP+   + H + +  +     + LD    +  T+    +L    +++Y+GG+     +  +  +PH         GF GC+ ++ VN  +  L       N+      C        LC N     G C    + + C C+   YTG  C R     AP    +GF +     I++  +G  +E E     F T   +G+ +  +       D + I L +G L +  + G G + +IRS     DG WH++K  R+ L+  L +DD E K   +  S  + L++D++ +G   T D+  R+ +G +
Sbjct:  337 DFISLSLREGIVEFIFDCGSGPAVIR-SSTPIMADIWHTIVISRDGRTGGLSLDGGPPVVGTSPGRMSLISLEQEVYLGGMADYKQQPAIVDMPH---------GFNGCIQEVKVNSRELHLPSARSGLNVLN----CDHICVTHLLCFN----GGTCQAKMDHYKCHCA-VGYTGMMCERARRVSAPTFAGDGFMKFKGSEILSRLSGKNTELE---FLFRTQESSGLLLSVQKESVSHGDHITIGLIDGILEVRYDLGVGRETVIRSTATLDDGYWHSVKFVRKSLAAYLKVDD-EIKAGIASDSQYRQLNSDVLFIGGAPTVDR--RFMSGLV 647          

HSP 2 Score: 62.003 bits (149), Expect = 1.260e-9
Identity = 99/417 (23.74%), Postives = 164/417 (39.33%), Query Frame = 1
Query: 2017 AKEESPSNIEV------TATIGDAEPTKEFPISFPSV--NSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYG----KSGDYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHN----YQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDK----VSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIE--YNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVG 3201
            A+E+S S  E       T +I  AEP        P     SY+ LP++        E  I  + + G  L LYG    K  D+L L + +G++   F+ G     +VR    I  N WH V++ R+   +      +D+   G+     LK      +    LFLG   +    T+   D V    GF GC+ SF ++      ++++   + +  +   G   DC   HN    Y VS  P                 C C + T+ G  C+     V  +     Y  Y  +  S  +  T+  +      S          + DGK +DFIS  L +       I+E  ++ GSG   ++ SS  I    +H +   R+G    L +D    ++ +  G+ S+  + ++ +Y+G
Sbjct:   37 AEEQSASRPEKLANGLKTQSIEAAEPNAR-SARQPRFKGTSYMSLPRLPRSARTSFELSIMFKASSGDGLLLYGGRKDKRKDFLALGLRNGHVEFRFSCGADIA-QVRSRQNITLNQWHNVVVFRDKRDAH---LMVDN---GDLVTQSLKGTQSMMDLKTRLFLGGVPRMRRVTS---DAVPYHSGFTGCVKSFVVDGRMLDLSQALGDVVKSRQVEECGESRDCECHHNAPCHYAVSGEPI----------------CACPLGTY-GRLCEHDFKLVMPSFSGQSYLTYPSFGQSTLRTFTISLVL--KPRSDTGLILFNSQKKDGK-TDFISLSLREG------IVEFIFDCGSGPA-VIRSSTPIMADIWHTIVISRDGRTGGLSLDGGPPVVGTSPGRMSL-ISLEQEVYLG 414          

HSP 3 Score: 61.6178 bits (148), Expect = 1.803e-9
Identity = 128/588 (21.77%), Postives = 234/588 (39.80%), Query Frame = 1
Query: 1543 GRVAPLVKFNGFQQM-IINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDME-KKYNFSGS-------SKLLSNDIIAVGKYETDKFSRY--FTGYMMHFTFNGINYFELAK-----------EE------------SPSNIEVTATIGDAEP--------TKEFPISFPSVN--SYIRLPKI--DMYGDFKLEFLIKTRNNKGSVL---QLYGKSGDYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFEN-LFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGV-VEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAM--TTFIGERCDKVSKT-------LKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDD 3126
             R A   +F G   M +  +P   ++  E +++ F  +  +G+ +    R     D L + L NG +    + G     +RS  N     WH + + R +    L++D+ +    +  G+       ++L    +  + +  +D    +  FTG +  F  +G    +L++           EE            +P +  V+     A P          +F +  PS +  SY+  P         F +  ++K R++ G +L   Q      D++ L +  G +  +F+ G+G    +R    I  +IWH +++ R+          +D  P      +    G ++  S E  ++LG    Y     Q    V    GF GCI    +N  +           L +  A +G+ V +C  DH   +     +C +GG C  +    +C CA+  T  + ER  +VS         +KF    + ++ +LS  KNT   EL F  +T   +   + + +      D I+  L+      +L + Y+LG G   ++ S+  + DG++H V F R    A L++DD
Sbjct:   64 ARSARQPRFKGTSYMSLPRLPRSARTSFE-LSIMFKASSGDGLLLY-GGRKDKRKDFLALGLRNGHVEFRFSCGADIAQVRSRQNITLNQWHNVVVFRDKRDAHLMVDNGDLVTQSLKGTQSMMDLKTRLFLGGVPRMRRVTSDAVPYHSGFTGCVKSFVVDG-RMLDLSQALGDVVKSRQVEECGESRDCECHHNAPCHYAVSGEPICACPLGTYGRLCEHDFKLVMPSFSGQSYLTYPSFGQSTLRTFTISLVLKPRSDTGLILFNSQKKDGKTDFISLSLREGIVEFIFDCGSGPAV-IRSSTPIMADIWHTIVISRDGRTG---GLSLDGGP----PVVGTSPGRMSLISLEQEVYLGGMADY----KQQPAIVDMPHGFNGCIQEVKVNSRE-----------LHLPSARSGLNVLNC--DH---ICVTHLLCFNGGTCQAKMDHYKCHCAVGYTGMMCERARRVSAPTFAGDGFMKFKG--SEILSRLS-GKNT---ELEFLFRTQESSGLLLSVQKESVSHGDHITIGLID----GILEVRYDLGVGRETVIRSTATLDDGYWHSVKFVRKSLAAYLKVDD 610          

HSP 4 Score: 57.7658 bits (138), Expect = 3.193e-8
Identity = 72/322 (22.36%), Postives = 124/322 (38.51%), Query Frame = 1
Query:  895 SYITLAGWAWAQKGKLQFS--FKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLD-ADKKIEHTNSLYKTLDTTRDLYIGGIPE---TLVSFLPHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMDGRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRP---NGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGNKIIRSDYNCFDGNWHTLKLKR 1833
            SY++L     + +   + S  FK    + LL Y   +     + DF A  +R   + F  + G+ + Q + S   ++    H V ++ +  +  + +D  D   +        +D    L++GG+P         +P+         GF GC+    V+G   DL+        +  V  C G+  D     N PC     + G    IC C    Y G  C     LV  +   Q  +  P+  QS     T+  L  +P    G+ +    +  G +D + + L  G +  + + G G  +IRS        WHT+ + R
Sbjct:   76 SYMSLPRLPRSARTSFELSIMFKASSGDGLLLYGGRKD---KRKDFLALGLRNGHVEFRFSCGADIAQVR-SRQNITLNQWHNVVVFRDKRDAHLMVDNGDLVTQSLKGTQSMMDLKTRLFLGGVPRMRRVTSDAVPY-------HSGFTGCVKSFVVDGRMLDLSQALGDVVKSRQVEEC-GESRDCECHHNAPCH--YAVSGEP--ICACPLGTY-GRLCEHDFKLVMPSFSGQSYLTYPSFGQSTLRTFTIS-LVLKPRSDTGLILFNSQKKDGKTDFISLSLREGIVEFIFDCGSGPAVIRSSTPIMADIWHTIVISR 379          
BLAST of neurexin-1 isoform X19 vs. Ensembl Nematostella
Match: EDO36419 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIM8])

HSP 1 Score: 76.6406 bits (187), Expect = 1.985e-15
Identity = 71/231 (30.74%), Postives = 106/231 (45.89%), Query Frame = 1
Query:  874 ISFT-TEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADK---KIEHTNSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGILRQGFVGCLLDISV---NGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTC 1542
            +SF   ++S+     W  +  G L FSFKT   +ALL YQ          D++  E++   L  +I TG    Q  + +  ++D   H V +  E   + + LD      KI   N   K  + +R LY GG+P +L S    S  + +  + F GC+ D+ +   NG Q +L L  ES+   G V GC      +  C + PC + GRCI       CDCS T + G+ C
Sbjct:    1 VSFVDPKSSFAQHQQWRVSSNGTLTFSFKTFLKDALLIYQDDGV-----MDYFNLELKVGRLLLNIRTGRKTSQVTLGNQ-LNDLSWHQVSIHVEHVKIGLTLDDHTRVVKIPRKNLALKN-NPSRYLYFGGLPRSL-SISTLSFPAVVFAKRFTGCIKDVEIQTGNGVQEELRL-VESK---GRVRGC------RNACRSNPCQNGGRCINKIWSSACDCSGTGFYGNQC 213          
BLAST of neurexin-1 isoform X19 vs. Ensembl Nematostella
Match: EDO36109 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJJ6])

HSP 1 Score: 76.2554 bits (186), Expect = 5.731e-14
Identity = 101/402 (25.12%), Postives = 162/402 (40.30%), Query Frame = 1
Query:  910 AGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFE---IRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNS-----LYKTLDTTRD-----LYIGGIPETLVSFLPHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDV---TDKGLCANRPCMDGRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPN------GFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIID----DMEKKYNFSGSSKLLSND--IIAVGKYETDKFS------RYFTGYMMHFTFNGINYFE 2013
            A W +  +G   F F+T  S   L Y   E  + N + F   +     + +L F +   S V Q  +      D   H V ++   G  EV L  DK +  +       + K +   R      +Y+GGIP     +   SL     R  F GC+ ++       + A +A+ +    +  GC       T    C N    DG+CI     F CDC  T Y G  C + + +V  NG    I   PN       +  +   ++ R +   PNGI +    R    +D   I L N  + + +N G G+ I++S+       ++ +++ RRQ  V+L I+     M+ +   S SS  L  D  +  +G    +  S      R F+G++  F F  IN F+
Sbjct:   41 APWNFTTEGTFSFMFRTNTSKGALLY--GEVKKGNHYLFITLDGGIALQFYLTFCL---SYVTQLDIPGN-FYDDQWHEVAVFL--GLNEVTLTVDKILSASTECKPDIIEKEIAKERGKRWHLMYLGGIPIPSKEWKFPSLQFNYFR--FYGCIGNLMYQ-KGIEKAFRAKLKEKVLVKHGCENACISRTQSSRCRN----DGKCIDHIKTFECDCEGTGYEGKYCDQESSMVFING-STYITYTPNQTNPYADWSMKVNQLSFRMVAKNPNGIVLYMGDR---EADHFLIELVNAAIRLSVNLGGGSLILQSNVTLNMSAYYWVQVTRRQRKVLLDINYGWVQMQAETPGSLSSLDLKGDSRVAYIGGGPGNIVSPLSLSKRNFSGFLQQFVFEEINVFD 423          
BLAST of neurexin-1 isoform X19 vs. Ensembl Nematostella
Match: EDO39258 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAQ4])

HSP 1 Score: 73.9442 bits (180), Expect = 2.898e-13
Identity = 83/346 (23.99%), Postives = 137/346 (39.60%), Query Frame = 1
Query: 1792 NCFDGNWHTLKLKRRQLSVILIIDDMEKKYNFSGSSKLLSND-IIAVG--------KYETDKFSRYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAE---PTKEF-PISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFEN-LFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCD 2787
            N  D  WHT+K+ R Q S++L +D+ E + N +GS   L  D  I VG         Y   + +  F G +    F+ I+    A+ E    +   +T G      P  ++ P+ FPS+N+++RL  +    +F +    +T +  G VL     +   + L +VH  L L    G     K+     ++D +WH V               +D +P    A+  LK    N   F    ++GS               T   GF GC+++  +N    V  + + + +    +    +             C PN C +GG C + W    CDC  T + G  C+
Sbjct:   12 NLDDNKWHTVKVARNQRSLLLTLDNKETRTNTAGSFVRLDLDKFIFVGGVDRSLPDDYHGARDAPNFKGCLKDVYFDFIDILYGAQYE----LLYYSTYGRLSYICPLDDYTPVGFPSLNTHLRLTDLSP-NNFTVWLSFRTYSGDG-VLAFKMSTDARVYLSLVHAKLELEIRIGTDRPIKISLGENLNDGLWHDVT---SGINRKELWLTLDDKPEVRHANPWLK----NIGKFRRRTYIGSG--------------TQKTGFVGCMNNIKLNGA-LVRPRKLSKEVAGAVIGRCSITS----------KCFPNPCQNGGACKESWDSYTCDCQGTFYEGATCE 319          

HSP 2 Score: 73.1738 bits (178), Expect = 5.728e-13
Identity = 86/363 (23.69%), Postives = 149/363 (41.05%), Query Frame = 1
Query:  496 DNRWHTISVSRK----------KTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKR-YFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDT-TRDLYIGGIPETLVSFLPHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSG-CSGDVTDKGLCANRPCMDG-RCIIGYNRFICDCSRTNYTGDTC 1542
            DN+WHT+ V+R           K +  N++G                     V   + + I  GG+      D S+ +     ++  NFKGC++ + +      +DIL  A+ +  Y+ T G + +    D +   P+ F +  +++ L   +      +  SF+T   + +LA++ S  +++         +  + L   I  G+    +      ++DGL H V        + + LD   ++ H N   K +    R  YIG               SG  + GFVGC+ +I +NG    +  +  S+ + G V G CS  +T K  C   PC +G  C   ++ + CDC  T Y G TC
Sbjct:   15 DNKWHTVKVARNQRSLLLTLDNKETRTNTAGSF-------------------VRLDLDKFIFVGGV------DRSLPDDYHGARDAPNFKGCLKDVYFDF----IDILYGAQYELLYYSTYGRLSYICPLDDYT--PVGFPSLNTHLRLTDLS-PNNFTVWLSFRTYSGDGVLAFKMSTDARV------YLSLVHAKLELEIRIGTDRPIKISLGENLNDGLWHDVTSGINRKELWLTLDDKPEVRHANPWLKNIGKFRRRTYIG---------------SGTQKTGFVGCMNNIKLNGAL--VRPRKLSKEVAGAVIGRCS--ITSK--CFPNPCQNGGACKESWDSYTCDCQGTFYEGATC 318          
BLAST of neurexin-1 isoform X19 vs. Ensembl Medaka
Match: ENSORLT00000034989.1 (neurexin 1 [Source:NCBI gene;Acc:101159771])

HSP 1 Score: 357.451 bits (916), Expect = 8.353e-102
Identity = 330/1286 (25.66%), Postives = 564/1286 (43.86%), Query Frame = 1
Query:  226 VATFLQDAYIYNSINI-PTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLT-RGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAY---------QKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFL-PHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNF---------GRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEK-KYNFSGSSKLLSNDIIAVGKYETDKF----SRYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXXXXXXXXXXK-KVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEK----YLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPT--KNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDD---------------------------YNRIIAS---PKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDNISYAGIKLLNRSNVYVENKFIPNFQSKQSILSEQGXXXXXXXXXXXXIVVAKSNCSNIEPLHNLDCKVSDSAGIIRPIVSYKINTVTHSQKITTTPDNDIYTENTKSESSTIYKSLEINNSGVIN------------------IWLIIGFSVGGSLLLVFITCFIYRCFRKDEGSYNVEDDHIFIDPS 3837
            VATF    +    +++ P  S  D I L FKT Q    + + G           Y+ + L +  + + I    L    F+     +     DN WH + V+R    + +  G  ++ + VDG +          T L S    + G  P T +D       S + N  NF GC+++++Y  ++  L++   AK     +   G + F KC ++  + PI+F T  S+I L  W   + G + F F+T E N LL +         + S++ Q  + DF+A E+ E  L+  ++ GSG  + K  +  V+DG  ++V    +  +  + ++  +         + LD   +LY+GG+PE  +  + P  +W+ +L  G+VGC+ D+ ++G   D+   AE +  TG+   CS + + +  C + PC + G C  G+NR++CDCS T Y G +C R A ++ ++G + M + +P    +E EDV+LRF + R  GI I T SR S  + RLE  L++G++ + +N           +G + I +  N  D  WHT+++ RR  S+ L +DD+   +   +G    L    I  G     +F       F G++   +FNG++Y +L K       E+ A IG      + P++F S +SY+ L  +  Y    L F  KT +  G +L   G   D++++E+V GYL+ + + GNG +  K      + DN WH VI+ R+ +        + +  I  +   +   G  N +   NL++G   K    YL K       V + +GF+GC++S  +N            +L++ AL   G +E   E  +   +C+ + C + G C+QQW    CDC+MTTF G  C+    T  F      + Y   P    +T  D LA G  T +  +  + +    G   DF+  +L  DKG+  ++  +N+G+    + E +  + DG YH V F R+G  A+LQ+DD                             R++      KG+    FN Q TI +G +           + D++  SF G LSGLY+N + + +M              SNV ++        S  SI  +     N      + + +  +  S                       S ++   T  +   TT D  + +    S+   I    E ++ G+ N                    +++G     +L ++ +   +Y+   +DEGSY+V++   +I  S
Sbjct:  263 VATFKGSEFFCYDLSLNPIQSSSDEITLSFKTLQRNGLMLHTGKSA-------DYVNLALKNGAVSLVIN---LGSGAFEALVEPVNGKFNDNDWHDVKVTRN-LRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPST-ADLP----GSPVSN--NFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGTVAF-KCENVATLDPITFETPESFIVLNKWNAKKTGSISFDFRTTEPNGLLLFSHGKPKQQPKDSKSPQTFKVDFFAIEMLEGHLYLLLDMGSGTTKTKAVNKKVNDGEWYHVDFQRDGRSGTISINTLRTAYTAPGESEILDLDDNLYLGGLPENKMGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDVRRLAEIQKATGVKPSCSKEPSKQ--CLSNPCQNNGICREGWNRYVCDCSGTGYLGRSCEREATILSYDGSKFMKVQLPVVMHTEAEDVSLRFRSQRAYGILIATTSRDSADTLRLE--LDSGRVRLTVNLDCIRINCTSSKGPETIFAGQNLNDNEWHTVRVFRRGKSLKLTVDDLSPIEGQMAGDHTQLEFHNIETGIVTEKRFMSTVPSNFIGHLQSLSFNGMSYIDLCKNGDIDYCELNAMIGFKNIIAD-PVTFKSRSSYVTLTTLQAYYSMHLFFQFKTTSPDGLILYNSGDGNDFIVVELVKGYLHYVSDLGNGAHLIKGNSNKPLSDNQWHNVIISRDTNN-------LHTVKIDTKITTQTTTGAKNLDLKGNLYIGGVAKDMYMYLPKL------VHAKEGFQGCLASVDLN--------GRLPDLMSDALDCVGQIERGCEGPS--TTCQEDSCANQGVCLQQWEGFSCDCSMTTFGGPLCNDAGTTYIFGRDGGLITYTWPPNDRPSTRADRLAIGFSTHLKDAVLVRVDSSSG-LGDFL--KLHIDKGKVAVV--FNVGTDDINIEEKAKFVNDGKYHIVKFTRSGGNATLQVDDLPVNERYPTGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQTTIQIGGW-----------ERDRS-QSFQGQLSGLYYNGLKVFNMAAE---------GDSNVKIQGSVRLVGDSPSSITPQSSTTANRSETSTSIMEITTTTAS-----------------------SRRVKQTTPREPQQTTDDFLVASAECPSDDEDI-DPCEPSSGGLANPTFAGPNPPEIIREASSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYHVDESRNYISNS 1451          

HSP 2 Score: 124.02 bits (310), Expect = 6.024e-28
Identity = 205/898 (22.83%), Postives = 343/898 (38.20%), Query Frame = 1
Query:  874 ISFT-TEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGILRQ--GFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMDGRCIIGYNRFICDCSRTNYTGDTC----------------------GRVAPLVKFNGFQQMIINMP-NGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGN-----KIIRSDYNCFDGNWHTLKLKR--RQLS------VILIIDDM--EKKYNFSGSSKLLSNDIIAVGKYET------DKFSRYFTGYMMHFTFNG----INYFELAKEESPS-NIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSG--------------DYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKS--SSFAFRIDSQPIGERAHIELK----AGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMN-QTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNL------GSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKG-KTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDN 3327
            + FT  E  +     W    + ++ F+ KT  S+ LL Y   E       DF    IR   L    +         +S T V+D   H V +     N  + +D + K     S  + +     L++GGIP  L S +   L S  ++    F G + D++VN  +  +     SE +   + G +       +C N     G C +  N   CDCS T + G  C                      G+   +  F G +    ++  N  QS  +++TL F T + NG+ + T      ++D + + L+NG +++++N G G      + +   +N  D +WH +K+ R  RQ S      V + +D +     Y     + L S+D   VG   +         S  F G +    +      +    LAK+  P   I  T            PI+F +  S+I L K +      + F  +T    G +L  +GK                D+  +E++ G+L LL + G+G  K      K++D  W+ V   R+      S    R      GE   ++L      GGL  N    +F    E + +  N          G+ GCI   +++ Q+K V      + L  I  A  GV   C ++ + Q  C  N C + G C + W R  CDC+ T ++G  C++ +  L + D   ++  +L    +T  ++++   ++       I     D       + RL  D GR  L +  +        S     + +  N+ D  +H V   R G    L +DD + I     G  T + F+   T  V +  F +              +F G+L  L FN +   D+  N
Sbjct:   28 LEFTGAEGQWARFPVWNACCESEMSFNMKTKSSHGLLVYFDDE----GFCDFLELLIRNGKLSLRFSIFCAEPATVISDTAVNDSRWHTVTIRRNFKNTTLMVDNEIKWVEVMSKRRDMTVFSHLFVGGIPPELRS-VALRLTSAAVKDEPPFAGWITDVTVNNTECAI---INSEGVLMDICGTA------NMCQN----GGICSLIDNEPTCDCSHTGFQGKDCSEEDNYTEGLAHLMMGDQDRIKGKEEYVATFKGSEFFCYDLSLNPIQSSSDEITLSFKTLQRNGLMLHTGK----SADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFN--DNDWHDVKVTRNLRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGTVAFKCENVATLDPITFETPESFIVLNKWNAKKTGSISFDFRTTEPNGLLLFSHGKPKQQPKDSKSPQTFKVDFFAIEMLEGHLYLLLDMGSGTTKTKAVNKKVNDGEWYHVDFQRDGRSGTISINTLRTAYTAPGESEILDLDDNLYLGGLPENKMGLVF--PTEVWTALLN---------YGYVGCIRDLFIDGQSKDV------RRLAEIQKA-TGVKPSCSKEPSKQ--CLSNPCQNNGICREGWNRYVCDCSGTGYLGRSCEREATILSY-DGSKFMKVQLPVVMHTEAEDVSLRFRSQRAYGILIATTSRDSAD----TLRLELDSGRVRLTVNLDCIRINCTSSKGPETIFAGQNLNDNEWHTVRVFRRGKSLKLTVDDLSPIEGQMAGDHTQLEFHNIETGIVTEKRFMS----------TVPSNFIGHLQSLSFNGMSYIDLCKN 866          
BLAST of neurexin-1 isoform X19 vs. Ensembl Medaka
Match: ENSORLT00000046931.1 (neurexin 1 [Source:NCBI gene;Acc:101159771])

HSP 1 Score: 357.451 bits (916), Expect = 1.033e-101
Identity = 330/1286 (25.66%), Postives = 564/1286 (43.86%), Query Frame = 1
Query:  226 VATFLQDAYIYNSINI-PTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLT-RGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAY---------QKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFL-PHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNF---------GRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEK-KYNFSGSSKLLSNDIIAVGKYETDKF----SRYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXXXXXXXXXXK-KVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEK----YLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPT--KNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDD---------------------------YNRIIAS---PKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDNISYAGIKLLNRSNVYVENKFIPNFQSKQSILSEQGXXXXXXXXXXXXIVVAKSNCSNIEPLHNLDCKVSDSAGIIRPIVSYKINTVTHSQKITTTPDNDIYTENTKSESSTIYKSLEINNSGVIN------------------IWLIIGFSVGGSLLLVFITCFIYRCFRKDEGSYNVEDDHIFIDPS 3837
            VATF    +    +++ P  S  D I L FKT Q    + + G           Y+ + L +  + + I    L    F+     +     DN WH + V+R    + +  G  ++ + VDG +          T L S    + G  P T +D       S + N  NF GC+++++Y  ++  L++   AK     +   G + F KC ++  + PI+F T  S+I L  W   + G + F F+T E N LL +         + S++ Q  + DF+A E+ E  L+  ++ GSG  + K  +  V+DG  ++V    +  +  + ++  +         + LD   +LY+GG+PE  +  + P  +W+ +L  G+VGC+ D+ ++G   D+   AE +  TG+   CS + + +  C + PC + G C  G+NR++CDCS T Y G +C R A ++ ++G + M + +P    +E EDV+LRF + R  GI I T SR S  + RLE  L++G++ + +N           +G + I +  N  D  WHT+++ RR  S+ L +DD+   +   +G    L    I  G     +F       F G++   +FNG++Y +L K       E+ A IG      + P++F S +SY+ L  +  Y    L F  KT +  G +L   G   D++++E+V GYL+ + + GNG +  K      + DN WH VI+ R+ +        + +  I  +   +   G  N +   NL++G   K    YL K       V + +GF+GC++S  +N            +L++ AL   G +E   E  +   +C+ + C + G C+QQW    CDC+MTTF G  C+    T  F      + Y   P    +T  D LA G  T +  +  + +    G   DF+  +L  DKG+  ++  +N+G+    + E +  + DG YH V F R+G  A+LQ+DD                             R++      KG+    FN Q TI +G +           + D++  SF G LSGLY+N + + +M              SNV ++        S  SI  +     N      + + +  +  S                       S ++   T  +   TT D  + +    S+   I    E ++ G+ N                    +++G     +L ++ +   +Y+   +DEGSY+V++   +I  S
Sbjct:  273 VATFKGSEFFCYDLSLNPIQSSSDEITLSFKTLQRNGLMLHTGKSA-------DYVNLALKNGAVSLVIN---LGSGAFEALVEPVNGKFNDNDWHDVKVTRN-LRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPST-ADLP----GSPVSN--NFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGTVAF-KCENVATLDPITFETPESFIVLNKWNAKKTGSISFDFRTTEPNGLLLFSHGKPKQQPKDSKSPQTFKVDFFAIEMLEGHLYLLLDMGSGTTKTKAVNKKVNDGEWYHVDFQRDGRSGTISINTLRTAYTAPGESEILDLDDNLYLGGLPENKMGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDVRRLAEIQKATGVKPSCSKEPSKQ--CLSNPCQNNGICREGWNRYVCDCSGTGYLGRSCEREATILSYDGSKFMKVQLPVVMHTEAEDVSLRFRSQRAYGILIATTSRDSADTLRLE--LDSGRVRLTVNLDCIRINCTSSKGPETIFAGQNLNDNEWHTVRVFRRGKSLKLTVDDLSPIEGQMAGDHTQLEFHNIETGIVTEKRFMSTVPSNFIGHLQSLSFNGMSYIDLCKNGDIDYCELNAMIGFKNIIAD-PVTFKSRSSYVTLTTLQAYYSMHLFFQFKTTSPDGLILYNSGDGNDFIVVELVKGYLHYVSDLGNGAHLIKGNSNKPLSDNQWHNVIISRDTNN-------LHTVKIDTKITTQTTTGAKNLDLKGNLYIGGVAKDMYMYLPKL------VHAKEGFQGCLASVDLN--------GRLPDLMSDALDCVGQIERGCEGPS--TTCQEDSCANQGVCLQQWEGFSCDCSMTTFGGPLCNDAGTTYIFGRDGGLITYTWPPNDRPSTRADRLAIGFSTHLKDAVLVRVDSSSG-LGDFL--KLHIDKGKVAVV--FNVGTDDINIEEKAKFVNDGKYHIVKFTRSGGNATLQVDDLPVNERYPTGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQTTIQIGGW-----------ERDRS-QSFQGQLSGLYYNGLKVFNMAAE---------GDSNVKIQGSVRLVGDSPSSITPQSSTTANRSETSTSIMEITTTTAS-----------------------SRRVKQTTPREPQQTTDDFLVASAECPSDDEDI-DPCEPSSGGLANPTFAGPNPPEIIREASSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYHVDESRNYISNS 1461          

HSP 2 Score: 119.783 bits (299), Expect = 1.279e-26
Identity = 205/908 (22.58%), Postives = 343/908 (37.78%), Query Frame = 1
Query:  874 ISFT-TEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGILRQ--GFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMDGRCIIGYNRFICDCSRTNYTGDTC--------------------------------GRVAPLVKFNGFQQMIINMP-NGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGN-----KIIRSDYNCFDGNWHTLKLKR--RQLS------VILIIDDM--EKKYNFSGSSKLLSNDIIAVGKYET------DKFSRYFTGYMMHFTFNG----INYFELAKEESPS-NIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSG--------------DYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKS--SSFAFRIDSQPIGERAHIELK----AGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMN-QTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNL------GSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKG-KTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDN 3327
            + FT  E  +     W    + ++ F+ KT  S+ LL Y   E       DF    IR   L    +         +S T V+D   H V +     N  + +D + K     S  + +     L++GGIP  L S +   L S  ++    F G + D++VN  +  +     SE +   + G +       +C N     G C +  N   CDCS T + G  C                                G+   +  F G +    ++  N  QS  +++TL F T + NG+ + T      ++D + + L+NG +++++N G G      + +   +N  D +WH +K+ R  RQ S      V + +D +     Y     + L S+D   VG   +         S  F G +    +      +    LAK+  P   I  T            PI+F +  S+I L K +      + F  +T    G +L  +GK                D+  +E++ G+L LL + G+G  K      K++D  W+ V   R+      S    R      GE   ++L      GGL  N    +F    E + +  N          G+ GCI   +++ Q+K V      + L  I  A  GV   C ++ + Q  C  N C + G C + W R  CDC+ T ++G  C++ +  L + D   ++  +L    +T  ++++   ++       I     D       + RL  D GR  L +  +        S     + +  N+ D  +H V   R G    L +DD + I     G  T + F+   T  V +  F +              +F G+L  L FN +   D+  N
Sbjct:   28 LEFTGAEGQWARFPVWNACCESEMSFNMKTKSSHGLLVYFDDE----GFCDFLELLIRNGKLSLRFSIFCAEPATVISDTAVNDSRWHTVTIRRNFKNTTLMVDNEIKWVEVMSKRRDMTVFSHLFVGGIPPELRS-VALRLTSAAVKDEPPFAGWITDVTVNNTECAI---INSEGVLMDICGTA------NMCQN----GGICSLIDNEPTCDCSHTGFQGKDCSEGLAHLMMGDQDRIKGQRGEAWLLRSLLSTPGKEEYVATFKGSEFFCYDLSLNPIQSSSDEITLSFKTLQRNGLMLHTGK----SADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFN--DNDWHDVKVTRNLRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGTVAFKCENVATLDPITFETPESFIVLNKWNAKKTGSISFDFRTTEPNGLLLFSHGKPKQQPKDSKSPQTFKVDFFAIEMLEGHLYLLLDMGSGTTKTKAVNKKVNDGEWYHVDFQRDGRSGTISINTLRTAYTAPGESEILDLDDNLYLGGLPENKMGLVF--PTEVWTALLN---------YGYVGCIRDLFIDGQSKDV------RRLAEIQKA-TGVKPSCSKEPSKQ--CLSNPCQNNGICREGWNRYVCDCSGTGYLGRSCEREATILSY-DGSKFMKVQLPVVMHTEAEDVSLRFRSQRAYGILIATTSRDSAD----TLRLELDSGRVRLTVNLDCIRINCTSSKGPETIFAGQNLNDNEWHTVRVFRRGKSLKLTVDDLSPIEGQMAGDHTQLEFHNIETGIVTEKRFMS----------TVPSNFIGHLQSLSFNGMSYIDLCKN 876          
BLAST of neurexin-1 isoform X19 vs. Ensembl Medaka
Match: ENSORLT00000030454.1 (neurexin 1 [Source:NCBI gene;Acc:101159771])

HSP 1 Score: 356.681 bits (914), Expect = 1.700e-101
Identity = 327/1286 (25.43%), Postives = 559/1286 (43.47%), Query Frame = 1
Query:  226 VATFLQDAYIYNSINI-PTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLT-RGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAY---------QKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFL-PHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNF---------GRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEK-KYNFSGSSKLLSNDIIAVGKYETDKF----SRYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXX-XXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEK----YLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPT--KNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDD---------------------------YNRIIAS---PKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDNISYAGIKLLNRSNVYVENKFIPNFQSKQSILSEQGXXXXXXXXXXXXIVVAKSNCSNIEPLHNLDCKVSDSAGIIRPIVSYKINTVTHSQKITTTPDNDIYTENTKSESSTIYKSLEINNSGVIN------------------IWLIIGFSVGGSLLLVFITCFIYRCFRKDEGSYNVEDDHIFIDPS 3837
            VATF    +    +++ P  S  D I L FKT Q    + + G           Y+ + L +  + + I    L    F+     +     DN WH + V+R    + +  G  ++ + VDG +          T L S    + G  P T +D       S + N  NF GC+++++Y  ++  L++   AK     +   G + F KC ++  + PI+F T  S+I L  W   + G + F F+T E N LL +         + S++ Q  + DF+A E+ E  L+  ++ GSG  + K  +  V+DG  ++V    +  +  + ++  +         + LD   +LY+GG+PE  +  + P  +W+ +L  G+VGC+ D+ ++G   D+   AE +  TG+   CS + + +  C + PC + G C  G+NR++CDCS T Y G +C R A ++ ++G + M + +P    +E EDV+LRF + R  GI I T SR S  + RLE  L++G++ + +N           +G + I +  N  D  WHT+++ RR  S+ L +DD+   +   +G    L    I  G     +F       F G++   +FNG++Y +L K       E+ A IG      + P++F S +SY+ L  +  Y    L F  KT +  G +L   G   D++++E+V GYL+ +          K      + DN WH VI+ R+ +        + +  I  +   +   G  N +   NL++G   K    YL K       V + +GF+GC++S  +N            +L++ AL   G +E   E  +   +C+ + C + G C+QQW    CDC+MTTF G  C+    T  F      + Y   P    +T  D LA G  T +  +  + +    G   DF+  +L  DKG+  ++  +N+G+    + E +  + DG YH V F R+G  A+LQ+DD                             R++      KG+    FN Q TI +G +           + D++  SF G LSGLY+N + + +M              SNV ++        S  SI  +     N      + + +  +  S                       S ++   T  +   TT D  + +    S+   I    E ++ G+ N                    +++G     +L ++ +   +Y+   +DEGSY+V++   +I  S
Sbjct:  279 VATFKGSEFFCYDLSLNPIQSSSDEITLSFKTLQRNGLMLHTGKSA-------DYVNLALKNGAVSLVIN---LGSGAFEALVEPVNGKFNDNDWHDVKVTRN-LRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPST-ADLP----GSPVSN--NFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGTVAF-KCENVATLDPITFETPESFIVLNKWNAKKTGSISFDFRTTEPNGLLLFSHGKPKQQPKDSKSPQTFKVDFFAIEMLEGHLYLLLDMGSGTTKTKAVNKKVNDGEWYHVDFQRDGRSGTISINTLRTAYTAPGESEILDLDDNLYLGGLPENKMGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDVRRLAEIQKATGVKPSCSKEPSKQ--CLSNPCQNNGICREGWNRYVCDCSGTGYLGRSCEREATILSYDGSKFMKVQLPVVMHTEAEDVSLRFRSQRAYGILIATTSRDSADTLRLE--LDSGRVRLTVNLDCIRINCTSSKGPETIFAGQNLNDNEWHTVRVFRRGKSLKLTVDDLSPIEGQMAGDHTQLEFHNIETGIVTEKRFMSTVPSNFIGHLQSLSFNGMSYIDLCKNGDIDYCELNAMIGFKNIIAD-PVTFKSRSSYVTLTTLQAYYSMHLFFQFKTTSPDGLILYNSGDGNDFIVVELVKGYLHYVSDLGNGAHLIKGNSNKPLSDNQWHNVIISRDTNN-------LHTVKIDTKITTQTTTGAKNLDLKGNLYIGGVAKDMYMYLPKL------VHAKEGFQGCLASVDLN--------GRLPDLMSDALDCVGQIERGCEGPS--TTCQEDSCANQGVCLQQWEGFSCDCSMTTFGGPLCNDAGTTYIFGRDGGLITYTWPPNDRPSTRADRLAIGFSTHLKDAVLVRVDSSSG-LGDFL--KLHIDKGKVAVV--FNVGTDDINIEEKAKFVNDGKYHIVKFTRSGGNATLQVDDLPVNERYPTGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQTTIQIGGW-----------ERDRS-QSFQGQLSGLYYNGLKVFNMAAE---------GDSNVKIQGSVRLVGDSPSSITPQSSTTANRSETSTSIMEITTTTAS-----------------------SRRVKQTTPREPQQTTDDFLVASAECPSDDEDI-DPCEPSSGGLANPTFAGPNPPEIIREASSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYHVDESRNYISNS 1467          

HSP 2 Score: 117.472 bits (293), Expect = 6.248e-26
Identity = 205/914 (22.43%), Postives = 343/914 (37.53%), Query Frame = 1
Query:  874 ISFT-TEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGILRQ--GFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMDGRCIIGYNRFICDCSRTNYTGDTC--------------------------------------GRVAPLVKFNGFQQMIINMP-NGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGN-----KIIRSDYNCFDGNWHTLKLKR--RQLS------VILIIDDM--EKKYNFSGSSKLLSNDIIAVGKYET------DKFSRYFTGYMMHFTFNG----INYFELAKEESPS-NIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSG--------------DYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKS--SSFAFRIDSQPIGERAHIELK----AGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMN-QTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNL------GSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKG-KTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDN 3327
            + FT  E  +     W    + ++ F+ KT  S+ LL Y   E       DF    IR   L    +         +S T V+D   H V +     N  + +D + K     S  + +     L++GGIP  L S +   L S  ++    F G + D++VN  +  +     SE +   + G +       +C N     G C +  N   CDCS T + G  C                                      G+   +  F G +    ++  N  QS  +++TL F T + NG+ + T      ++D + + L+NG +++++N G G      + +   +N  D +WH +K+ R  RQ S      V + +D +     Y     + L S+D   VG   +         S  F G +    +      +    LAK+  P   I  T            PI+F +  S+I L K +      + F  +T    G +L  +GK                D+  +E++ G+L LL + G+G  K      K++D  W+ V   R+      S    R      GE   ++L      GGL  N    +F    E + +  N          G+ GCI   +++ Q+K V      + L  I  A  GV   C ++ + Q  C  N C + G C + W R  CDC+ T ++G  C++ +  L + D   ++  +L    +T  ++++   ++       I     D       + RL  D GR  L +  +        S     + +  N+ D  +H V   R G    L +DD + I     G  T + F+   T  V +  F +              +F G+L  L FN +   D+  N
Sbjct:   28 LEFTGAEGQWARFPVWNACCESEMSFNMKTKSSHGLLVYFDDE----GFCDFLELLIRNGKLSLRFSIFCAEPATVISDTAVNDSRWHTVTIRRNFKNTTLMVDNEIKWVEVMSKRRDMTVFSHLFVGGIPPELRS-VALRLTSAAVKDEPPFAGWITDVTVNNTECAI---INSEGVLMDICGTA------NMCQN----GGICSLIDNEPTCDCSHTGFQGKDCSEEDNYTEGLAHLMMGDQDRIKGQRGEAWLLRSLLSTPGKEEYVATFKGSEFFCYDLSLNPIQSSSDEITLSFKTLQRNGLMLHTGK----SADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFN--DNDWHDVKVTRNLRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGTVAFKCENVATLDPITFETPESFIVLNKWNAKKTGSISFDFRTTEPNGLLLFSHGKPKQQPKDSKSPQTFKVDFFAIEMLEGHLYLLLDMGSGTTKTKAVNKKVNDGEWYHVDFQRDGRSGTISINTLRTAYTAPGESEILDLDDNLYLGGLPENKMGLVF--PTEVWTALLN---------YGYVGCIRDLFIDGQSKDV------RRLAEIQKA-TGVKPSCSKEPSKQ--CLSNPCQNNGICREGWNRYVCDCSGTGYLGRSCEREATILSY-DGSKFMKVQLPVVMHTEAEDVSLRFRSQRAYGILIATTSRDSAD----TLRLELDSGRVRLTVNLDCIRINCTSSKGPETIFAGQNLNDNEWHTVRVFRRGKSLKLTVDDLSPIEGQMAGDHTQLEFHNIETGIVTEKRFMS----------TVPSNFIGHLQSLSFNGMSYIDLCKN 882          
BLAST of neurexin-1 isoform X19 vs. Ensembl Medaka
Match: ENSORLT00000033187.1 (neurexin 1 [Source:NCBI gene;Acc:101159771])

HSP 1 Score: 356.681 bits (914), Expect = 1.700e-101
Identity = 327/1286 (25.43%), Postives = 559/1286 (43.47%), Query Frame = 1
Query:  226 VATFLQDAYIYNSINI-PTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLT-RGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAY---------QKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFL-PHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNF---------GRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEK-KYNFSGSSKLLSNDIIAVGKYETDKF----SRYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXX-XXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEK----YLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPT--KNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDD---------------------------YNRIIAS---PKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDNISYAGIKLLNRSNVYVENKFIPNFQSKQSILSEQGXXXXXXXXXXXXIVVAKSNCSNIEPLHNLDCKVSDSAGIIRPIVSYKINTVTHSQKITTTPDNDIYTENTKSESSTIYKSLEINNSGVIN------------------IWLIIGFSVGGSLLLVFITCFIYRCFRKDEGSYNVEDDHIFIDPS 3837
            VATF    +    +++ P  S  D I L FKT Q    + + G           Y+ + L +  + + I    L    F+     +     DN WH + V+R    + +  G  ++ + VDG +          T L S    + G  P T +D       S + N  NF GC+++++Y  ++  L++   AK     +   G + F KC ++  + PI+F T  S+I L  W   + G + F F+T E N LL +         + S++ Q  + DF+A E+ E  L+  ++ GSG  + K  +  V+DG  ++V    +  +  + ++  +         + LD   +LY+GG+PE  +  + P  +W+ +L  G+VGC+ D+ ++G   D+   AE +  TG+   CS + + +  C + PC + G C  G+NR++CDCS T Y G +C R A ++ ++G + M + +P    +E EDV+LRF + R  GI I T SR S  + RLE  L++G++ + +N           +G + I +  N  D  WHT+++ RR  S+ L +DD+   +   +G    L    I  G     +F       F G++   +FNG++Y +L K       E+ A IG      + P++F S +SY+ L  +  Y    L F  KT +  G +L   G   D++++E+V GYL+ +          K      + DN WH VI+ R+ +        + +  I  +   +   G  N +   NL++G   K    YL K       V + +GF+GC++S  +N            +L++ AL   G +E   E  +   +C+ + C + G C+QQW    CDC+MTTF G  C+    T  F      + Y   P    +T  D LA G  T +  +  + +    G   DF+  +L  DKG+  ++  +N+G+    + E +  + DG YH V F R+G  A+LQ+DD                             R++      KG+    FN Q TI +G +           + D++  SF G LSGLY+N + + +M              SNV ++        S  SI  +     N      + + +  +  S                       S ++   T  +   TT D  + +    S+   I    E ++ G+ N                    +++G     +L ++ +   +Y+   +DEGSY+V++   +I  S
Sbjct:  279 VATFKGSEFFCYDLSLNPIQSSSDEITLSFKTLQRNGLMLHTGKSA-------DYVNLALKNGAVSLVIN---LGSGAFEALVEPVNGKFNDNDWHDVKVTRN-LRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPST-ADLP----GSPVSN--NFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGTVAF-KCENVATLDPITFETPESFIVLNKWNAKKTGSISFDFRTTEPNGLLLFSHGKPKQQPKDSKSPQTFKVDFFAIEMLEGHLYLLLDMGSGTTKTKAVNKKVNDGEWYHVDFQRDGRSGTISINTLRTAYTAPGESEILDLDDNLYLGGLPENKMGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDVRRLAEIQKATGVKPSCSKEPSKQ--CLSNPCQNNGICREGWNRYVCDCSGTGYLGRSCEREATILSYDGSKFMKVQLPVVMHTEAEDVSLRFRSQRAYGILIATTSRDSADTLRLE--LDSGRVRLTVNLDCIRINCTSSKGPETIFAGQNLNDNEWHTVRVFRRGKSLKLTVDDLSPIEGQMAGDHTQLEFHNIETGIVTEKRFMSTVPSNFIGHLQSLSFNGMSYIDLCKNGDIDYCELNAMIGFKNIIAD-PVTFKSRSSYVTLTTLQAYYSMHLFFQFKTTSPDGLILYNSGDGNDFIVVELVKGYLHYVSDLGNGAHLIKGNSNKPLSDNQWHNVIISRDTNN-------LHTVKIDTKITTQTTTGAKNLDLKGNLYIGGVAKDMYMYLPKL------VHAKEGFQGCLASVDLN--------GRLPDLMSDALDCVGQIERGCEGPS--TTCQEDSCANQGVCLQQWEGFSCDCSMTTFGGPLCNDAGTTYIFGRDGGLITYTWPPNDRPSTRADRLAIGFSTHLKDAVLVRVDSSSG-LGDFL--KLHIDKGKVAVV--FNVGTDDINIEEKAKFVNDGKYHIVKFTRSGGNATLQVDDLPVNERYPTGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQTTIQIGGW-----------ERDRS-QSFQGQLSGLYYNGLKVFNMAAE---------GDSNVKIQGSVRLVGDSPSSITPQSSTTANRSETSTSIMEITTTTAS-----------------------SRRVKQTTPREPQQTTDDFLVASAECPSDDEDI-DPCEPSSGGLANPTFAGPNPPEIIREASSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYHVDESRNYISNS 1467          

HSP 2 Score: 117.472 bits (293), Expect = 6.248e-26
Identity = 205/914 (22.43%), Postives = 343/914 (37.53%), Query Frame = 1
Query:  874 ISFT-TEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGILRQ--GFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMDGRCIIGYNRFICDCSRTNYTGDTC--------------------------------------GRVAPLVKFNGFQQMIINMP-NGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGN-----KIIRSDYNCFDGNWHTLKLKR--RQLS------VILIIDDM--EKKYNFSGSSKLLSNDIIAVGKYET------DKFSRYFTGYMMHFTFNG----INYFELAKEESPS-NIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSG--------------DYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKS--SSFAFRIDSQPIGERAHIELK----AGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMN-QTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNL------GSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKG-KTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDN 3327
            + FT  E  +     W    + ++ F+ KT  S+ LL Y   E       DF    IR   L    +         +S T V+D   H V +     N  + +D + K     S  + +     L++GGIP  L S +   L S  ++    F G + D++VN  +  +     SE +   + G +       +C N     G C +  N   CDCS T + G  C                                      G+   +  F G +    ++  N  QS  +++TL F T + NG+ + T      ++D + + L+NG +++++N G G      + +   +N  D +WH +K+ R  RQ S      V + +D +     Y     + L S+D   VG   +         S  F G +    +      +    LAK+  P   I  T            PI+F +  S+I L K +      + F  +T    G +L  +GK                D+  +E++ G+L LL + G+G  K      K++D  W+ V   R+      S    R      GE   ++L      GGL  N    +F    E + +  N          G+ GCI   +++ Q+K V      + L  I  A  GV   C ++ + Q  C  N C + G C + W R  CDC+ T ++G  C++ +  L + D   ++  +L    +T  ++++   ++       I     D       + RL  D GR  L +  +        S     + +  N+ D  +H V   R G    L +DD + I     G  T + F+   T  V +  F +              +F G+L  L FN +   D+  N
Sbjct:   28 LEFTGAEGQWARFPVWNACCESEMSFNMKTKSSHGLLVYFDDE----GFCDFLELLIRNGKLSLRFSIFCAEPATVISDTAVNDSRWHTVTIRRNFKNTTLMVDNEIKWVEVMSKRRDMTVFSHLFVGGIPPELRS-VALRLTSAAVKDEPPFAGWITDVTVNNTECAI---INSEGVLMDICGTA------NMCQN----GGICSLIDNEPTCDCSHTGFQGKDCSEEDNYTEGLAHLMMGDQDRIKGQRGEAWLLRSLLSTPGKEEYVATFKGSEFFCYDLSLNPIQSSSDEITLSFKTLQRNGLMLHTGK----SADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFN--DNDWHDVKVTRNLRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGTVAFKCENVATLDPITFETPESFIVLNKWNAKKTGSISFDFRTTEPNGLLLFSHGKPKQQPKDSKSPQTFKVDFFAIEMLEGHLYLLLDMGSGTTKTKAVNKKVNDGEWYHVDFQRDGRSGTISINTLRTAYTAPGESEILDLDDNLYLGGLPENKMGLVF--PTEVWTALLN---------YGYVGCIRDLFIDGQSKDV------RRLAEIQKA-TGVKPSCSKEPSKQ--CLSNPCQNNGICREGWNRYVCDCSGTGYLGRSCEREATILSY-DGSKFMKVQLPVVMHTEAEDVSLRFRSQRAYGILIATTSRDSAD----TLRLELDSGRVRLTVNLDCIRINCTSSKGPETIFAGQNLNDNEWHTVRVFRRGKSLKLTVDDLSPIEGQMAGDHTQLEFHNIETGIVTEKRFMS----------TVPSNFIGHLQSLSFNGMSYIDLCKN 882          
BLAST of neurexin-1 isoform X19 vs. Ensembl Medaka
Match: ENSORLT00000027034.1 (neurexin 1 [Source:NCBI gene;Acc:101159771])

HSP 1 Score: 356.681 bits (914), Expect = 1.951e-101
Identity = 330/1286 (25.66%), Postives = 564/1286 (43.86%), Query Frame = 1
Query:  226 VATFLQDAYIYNSINI-PTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLT-RGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAY---------QKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFL-PHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMD-GRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNF---------GRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEK-KYNFSGSSKLLSNDIIAVGKYETDKF----SRYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXXXXXXXXXXK-KVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEK----YLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPT--KNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDD---------------------------YNRIIAS---PKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDNISYAGIKLLNRSNVYVENKFIPNFQSKQSILSEQGXXXXXXXXXXXXIVVAKSNCSNIEPLHNLDCKVSDSAGIIRPIVSYKINTVTHSQKITTTPDNDIYTENTKSESSTIYKSLEINNSGVIN------------------IWLIIGFSVGGSLLLVFITCFIYRCFRKDEGSYNVEDDHIFIDPS 3837
            VATF    +    +++ P  S  D I L FKT Q    + + G           Y+ + L +  + + I    L    F+     +     DN WH + V+R    + +  G  ++ + VDG +          T L S    + G  P T +D       S + N  NF GC+++++Y  ++  L++   AK     +   G + F KC ++  + PI+F T  S+I L  W   + G + F F+T E N LL +         + S++ Q  + DF+A E+ E  L+  ++ GSG  + K  +  V+DG  ++V    +  +  + ++  +         + LD   +LY+GG+PE  +  + P  +W+ +L  G+VGC+ D+ ++G   D+   AE +  TG+   CS + + +  C + PC + G C  G+NR++CDCS T Y G +C R A ++ ++G + M + +P    +E EDV+LRF + R  GI I T SR S  + RLE  L++G++ + +N           +G + I +  N  D  WHT+++ RR  S+ L +DD+   +   +G    L    I  G     +F       F G++   +FNG++Y +L K       E+ A IG      + P++F S +SY+ L  +  Y    L F  KT +  G +L   G   D++++E+V GYL+ + + GNG +  K      + DN WH VI+ R+ +        + +  I  +   +   G  N +   NL++G   K    YL K       V + +GF+GC++S  +N            +L++ AL   G +E   E  +   +C+ + C + G C+QQW    CDC+MTTF G  C+    T  F      + Y   P    +T  D LA G  T +  +  + +    G   DF+  +L  DKG+  ++  +N+G+    + E +  + DG YH V F R+G  A+LQ+DD                             R++      KG+    FN Q TI +G +           + D++  SF G LSGLY+N + + +M              SNV ++        S  SI  +     N      + + +  +  S                       S ++   T  +   TT D  + +    S+   I    E ++ G+ N                    +++G     +L ++ +   +Y+   +DEGSY+V++   +I  S
Sbjct:  275 VATFKGSEFFCYDLSLNPIQSSSDEITLSFKTLQRNGLMLHTGKSA-------DYVNLALKNGAVSLVIN---LGSGAFEALVEPVNGKFNDNDWHDVKVTRN-LRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPST-ADLP----GSPVSN--NFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGTVAF-KCENVATLDPITFETPESFIVLNKWNAKKTGSISFDFRTTEPNGLLLFSHGKPKQQPKDSKSPQTFKVDFFAIEMLEGHLYLLLDMGSGTTKTKAVNKKVNDGEWYHVDFQRDGRSGTISINTLRTAYTAPGESEILDLDDNLYLGGLPENKMGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDVRRLAEIQKATGVKPSCSKEPSKQ--CLSNPCQNNGICREGWNRYVCDCSGTGYLGRSCEREATILSYDGSKFMKVQLPVVMHTEAEDVSLRFRSQRAYGILIATTSRDSADTLRLE--LDSGRVRLTVNLDCIRINCTSSKGPETIFAGQNLNDNEWHTVRVFRRGKSLKLTVDDLSPIEGQMAGDHTQLEFHNIETGIVTEKRFMSTVPSNFIGHLQSLSFNGMSYIDLCKNGDIDYCELNAMIGFKNIIAD-PVTFKSRSSYVTLTTLQAYYSMHLFFQFKTTSPDGLILYNSGDGNDFIVVELVKGYLHYVSDLGNGAHLIKGNSNKPLSDNQWHNVIISRDTNN-------LHTVKIDTKITTQTTTGAKNLDLKGNLYIGGVAKDMYMYLPKL------VHAKEGFQGCLASVDLN--------GRLPDLMSDALDCVGQIERGCEGPS--TTCQEDSCANQGVCLQQWEGFSCDCSMTTFGGPLCNDAGTTYIFGRDGGLITYTWPPNDRPSTRADRLAIGFSTHLKDAVLVRVDSSSG-LGDFL--KLHIDKGKVAVV--FNVGTDDINIEEKAKFVNDGKYHIVKFTRSGGNATLQVDDLPVNERYPTGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQTTIQIGGW-----------ERDRS-QSFQGQLSGLYYNGLKVFNMAAE---------GDSNVKIQGSVRLVGDSPSSITPQSSTTANRSETSTSIMEITTTTAS-----------------------SRRVKQTTPREPQQTTDDFLVASAECPSDDEDI-DPCEPSSGGLANPTFAGPNPPEIIREASSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYHVDESRNYISNS 1463          

HSP 2 Score: 118.627 bits (296), Expect = 2.585e-26
Identity = 205/910 (22.53%), Postives = 343/910 (37.69%), Query Frame = 1
Query:  874 ISFT-TEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGILRQ--GFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMDGRCIIGYNRFICDCSRTNYTGDTC----------------------------------GRVAPLVKFNGFQQMIINMP-NGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGN-----KIIRSDYNCFDGNWHTLKLKR--RQLS------VILIIDDM--EKKYNFSGSSKLLSNDIIAVGKYET------DKFSRYFTGYMMHFTFNG----INYFELAKEESPS-NIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSG--------------DYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKS--SSFAFRIDSQPIGERAHIELK----AGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMN-QTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNL------GSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKG-KTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDN 3327
            + FT  E  +     W    + ++ F+ KT  S+ LL Y   E       DF    IR   L    +         +S T V+D   H V +     N  + +D + K     S  + +     L++GGIP  L S +   L S  ++    F G + D++VN  +  +     SE +   + G +       +C N     G C +  N   CDCS T + G  C                                  G+   +  F G +    ++  N  QS  +++TL F T + NG+ + T      ++D + + L+NG +++++N G G      + +   +N  D +WH +K+ R  RQ S      V + +D +     Y     + L S+D   VG   +         S  F G +    +      +    LAK+  P   I  T            PI+F +  S+I L K +      + F  +T    G +L  +GK                D+  +E++ G+L LL + G+G  K      K++D  W+ V   R+      S    R      GE   ++L      GGL  N    +F    E + +  N          G+ GCI   +++ Q+K V      + L  I  A  GV   C ++ + Q  C  N C + G C + W R  CDC+ T ++G  C++ +  L + D   ++  +L    +T  ++++   ++       I     D       + RL  D GR  L +  +        S     + +  N+ D  +H V   R G    L +DD + I     G  T + F+   T  V +  F +              +F G+L  L FN +   D+  N
Sbjct:   28 LEFTGAEGQWARFPVWNACCESEMSFNMKTKSSHGLLVYFDDE----GFCDFLELLIRNGKLSLRFSIFCAEPATVISDTAVNDSRWHTVTIRRNFKNTTLMVDNEIKWVEVMSKRRDMTVFSHLFVGGIPPELRS-VALRLTSAAVKDEPPFAGWITDVTVNNTECAI---INSEGVLMDICGTA------NMCQN----GGICSLIDNEPTCDCSHTGFQGKDCSEEDNYTEGLAHLMMGDQGQRGEAWLLRSLLSTPGKEEYVATFKGSEFFCYDLSLNPIQSSSDEITLSFKTLQRNGLMLHTGK----SADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFN--DNDWHDVKVTRNLRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGTVAFKCENVATLDPITFETPESFIVLNKWNAKKTGSISFDFRTTEPNGLLLFSHGKPKQQPKDSKSPQTFKVDFFAIEMLEGHLYLLLDMGSGTTKTKAVNKKVNDGEWYHVDFQRDGRSGTISINTLRTAYTAPGESEILDLDDNLYLGGLPENKMGLVF--PTEVWTALLN---------YGYVGCIRDLFIDGQSKDV------RRLAEIQKA-TGVKPSCSKEPSKQ--CLSNPCQNNGICREGWNRYVCDCSGTGYLGRSCEREATILSY-DGSKFMKVQLPVVMHTEAEDVSLRFRSQRAYGILIATTSRDSAD----TLRLELDSGRVRLTVNLDCIRINCTSSKGPETIFAGQNLNDNEWHTVRVFRRGKSLKLTVDDLSPIEGQMAGDHTQLEFHNIETGIVTEKRFMS----------TVPSNFIGHLQSLSFNGMSYIDLCKN 878          
BLAST of neurexin-1 isoform X19 vs. Planmine SMEST
Match: SMESG000058569.1 (SMESG000058569.1)

HSP 1 Score: 2471.04 bits (6403), Expect = 0.000e+0
Identity = 1273/1275 (99.84%), Postives = 1274/1275 (99.92%), Query Frame = 1
Query:  157 METINFFLISFVIIHTGTTEEIPVATFLQDAYIYNSINIPTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMDGRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEKKYNFSGSSKLLSNDIIAVGKYETDKFSRYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDNISYAGIKLLNRSNVYVENKFIPNFQSKQSILSEQGXXXXXXXXXXXXIVVAKSNCSNIEPLHNLDCKVSDSAGIIRPIVSYKINTVTHSQKITTTPDNDIYTENTKSESSTIYKSLEINNSGVINIWLIIGFSVGGSLLLVFITCFIYRCFRKDEGSYNVEDDHIFIDPSHXXXXXXXXXXDIELKNNYQTLNSATFNSSKHKQSRNEKSTNTKEWYV 3981
            METINFFLISFVIIHTGTTEEIPVATFLQDAYIYNSINIPTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSGQLVIKVVVDGKVVVDRMVGLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGILRQGFVGCLLDISVNGDQ+DLALKAESENITGIVSGCSGDVTDKGLCANRPCMDGRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEKKYNFSGSSKLLSNDIIAVGKYETDKFSRYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYLNLLFNWGNGFNKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGIQTSVITSSSIILIEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDNISYAGIKLLNRSNVYVENKFIPNFQSKQSILSEQGEKENNPTKKNNPIVVAKSNCSNIEPLHNLDCKVSDSAGIIRPIVSYKINTVTHSQKITTTPDN IYTENTKSESSTIYKSLEINNSGVINIWLIIGFSVGGSLLLVFITCFIYRCFRKDEGSYNVEDDHIFIDPSHKSLNLLNSSKDIELKNNYQTLNSATFNSSKHKQSRNEKSTNTKEWYV
Sbjct:    1 METINFFLISFVIIHTGTTEEIPVATFLQDAYIYNSINIPTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSGQLVIKVVVDGKVVVDRMVGLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGILRQGFVGCLLDISVNGDQYDLALKAESENITGIVSGCSGDVTDKGLCANRPCMDGRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEKKYNFSGSSKLLSNDIIAVGKYETDKFSRYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYLNLLFNWGNGFNKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGIQTSVITSSSIILIEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDNISYAGIKLLNRSNVYVENKFIPNFQSKQSILSEQGEKENNPTKKNNPIVVAKSNCSNIEPLHNLDCKVSDSAGIIRPIVSYKINTVTHSQKITTTPDNGIYTENTKSESSTIYKSLEINNSGVINIWLIIGFSVGGSLLLVFITCFIYRCFRKDEGSYNVEDDHIFIDPSHKSLNLLNSSKDIELKNNYQTLNSATFNSSKHKQSRNEKSTNTKEWYV 1275          
BLAST of neurexin-1 isoform X19 vs. Planmine SMEST
Match: SMESG000058569.1 (SMESG000058569.1)

HSP 1 Score: 2449.47 bits (6347), Expect = 0.000e+0
Identity = 1264/1275 (99.14%), Postives = 1265/1275 (99.22%), Query Frame = 1
Query:  157 METINFFLISFVIIHTGTTEEIPVATFLQDAYIYNSINIPTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMDGRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEKKYNFSGSSKLLSNDIIAVGKYETDKFSRYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDNISYAGIKLLNRSNVYVENKFIPNFQSKQSILSEQGXXXXXXXXXXXXIVVAKSNCSNIEPLHNLDCKVSDSAGIIRPIVSYKINTVTHSQKITTTPDNDIYTENTKSESSTIYKSLEINNSGVINIWLIIGFSVGGSLLLVFITCFIYRCFRKDEGSYNVEDDHIFIDPSHXXXXXXXXXXDIELKNNYQTLNSATFNSSKHKQSRNEKSTNTKEWYV 3981
            METINFFLISFVIIHTGTTEEIPVATFLQDAYIYNSINIPTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTS         IKVVVDGKVVVDRMVGLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGILRQGFVGCLLDISVNGDQ+DLALKAESENITGIVSGCSGDVTDKGLCANRPCMDGRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEKKYNFSGSSKLLSNDIIAVGKYETDKFSRYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYLNLLFNWGNGFNKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGIQTSVITSSSIILIEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDNISYAGIKLLNRSNVYVENKFIPNFQSKQSILSEQGEKENNPTKKNNPIVVAKSNCSNIEPLHNLDCKVSDSAGIIRPIVSYKINTVTHSQKITTTPDN IYTENTKSESSTIYKSLEINNSGVINIWLIIGFSVGGSLLLVFITCFIYRCFRKDEGSYNVEDDHIFIDPSHKSLNLLNSSKDIELKNNYQTLNSATFNSSKHKQSRNEKSTNTKEWYV
Sbjct:    1 METINFFLISFVIIHTGTTEEIPVATFLQDAYIYNSINIPTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTS---------IKVVVDGKVVVDRMVGLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGILRQGFVGCLLDISVNGDQYDLALKAESENITGIVSGCSGDVTDKGLCANRPCMDGRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEKKYNFSGSSKLLSNDIIAVGKYETDKFSRYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYLNLLFNWGNGFNKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGIQTSVITSSSIILIEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDNISYAGIKLLNRSNVYVENKFIPNFQSKQSILSEQGEKENNPTKKNNPIVVAKSNCSNIEPLHNLDCKVSDSAGIIRPIVSYKINTVTHSQKITTTPDNGIYTENTKSESSTIYKSLEINNSGVINIWLIIGFSVGGSLLLVFITCFIYRCFRKDEGSYNVEDDHIFIDPSHKSLNLLNSSKDIELKNNYQTLNSATFNSSKHKQSRNEKSTNTKEWYV 1266          
BLAST of neurexin-1 isoform X19 vs. Planmine SMEST
Match: SMESG000058569.1 (SMESG000058569.1)

HSP 1 Score: 2412.49 bits (6251), Expect = 0.000e+0
Identity = 1247/1261 (98.89%), Postives = 1248/1261 (98.97%), Query Frame = 1
Query:  199 HTGTTEEIPVATFLQDAYIYNSINIPTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMDGRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEKKYNFSGSSKLLSNDIIAVGKYETDKFSRYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDNISYAGIKLLNRSNVYVENKFIPNFQSKQSILSEQGXXXXXXXXXXXXIVVAKSNCSNIEPLHNLDCKVSDSAGIIRPIVSYKINTVTHSQKITTTPDNDIYTENTKSESSTIYKSLEINNSGVINIWLIIGFSVGGSLLLVFITCFIYRCFRKDEGSYNVEDDHIFIDPSHXXXXXXXXXXDIELKNNYQTLNSATFNSSKHKQSRNEKSTNTKEWYV 3981
             TG  EEIPVATFLQDAYIYNSINIPTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTS         IKVVVDGKVVVDRMVGLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGILRQGFVGCLLDISVNGDQ+DLALKAESENITGIVSGCSGDVTDKGLCANRPCMDGRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEKKYNFSGSSKLLSNDIIAVGKYETDKFSRYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYLNLLFNWGNGFNKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGIQTSVITSSSIILIEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDNISYAGIKLLNRSNVYVENKFIPNFQSKQSILSEQGEKENNPTKKNNPIVVAKSNCSNIEPLHNLDCKVSDSAGIIRPIVSYKINTVTHSQKITTTPDN IYTENTKSESSTIYKSLEINNSGVINIWLIIGFSVGGSLLLVFITCFIYRCFRKDEGSYNVEDDHIFIDPSHKSLNLLNSSKDIELKNNYQTLNSATFNSSKHKQSRNEKSTNTKEWYV
Sbjct:  381 ETGNPEEIPVATFLQDAYIYNSINIPTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTS---------IKVVVDGKVVVDRMVGLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGILRQGFVGCLLDISVNGDQYDLALKAESENITGIVSGCSGDVTDKGLCANRPCMDGRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEKKYNFSGSSKLLSNDIIAVGKYETDKFSRYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYLNLLFNWGNGFNKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGIQTSVITSSSIILIEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDNISYAGIKLLNRSNVYVENKFIPNFQSKQSILSEQGEKENNPTKKNNPIVVAKSNCSNIEPLHNLDCKVSDSAGIIRPIVSYKINTVTHSQKITTTPDNGIYTENTKSESSTIYKSLEINNSGVINIWLIIGFSVGGSLLLVFITCFIYRCFRKDEGSYNVEDDHIFIDPSHKSLNLLNSSKDIELKNNYQTLNSATFNSSKHKQSRNEKSTNTKEWYV 1632          
BLAST of neurexin-1 isoform X19 vs. Planmine SMEST
Match: SMESG000058569.1 (SMESG000058569.1)

HSP 1 Score: 2410.95 bits (6247), Expect = 0.000e+0
Identity = 1247/1261 (98.89%), Postives = 1248/1261 (98.97%), Query Frame = 1
Query:  199 HTGTTEEIPVATFLQDAYIYNSINIPTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGILRQGFVGCLLDISVNGDQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMDGRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEKKYNFSGSSKLLSNDIIAVGKYETDKFSRYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDNISYAGIKLLNRSNVYVENKFIPNFQSKQSILSEQGXXXXXXXXXXXXIVVAKSNCSNIEPLHNLDCKVSDSAGIIRPIVSYKINTVTHSQKITTTPDNDIYTENTKSESSTIYKSLEINNSGVINIWLIIGFSVGGSLLLVFITCFIYRCFRKDEGSYNVEDDHIFIDPSHXXXXXXXXXXDIELKNNYQTLNSATFNSSKHKQSRNEKSTNTKEWYV 3981
             TG  EEIPVATFLQDAYIYNSINIPTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTS         IKVVVDGKVVVDRMVGLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGILRQGFVGCLLDISVNGDQ+DLALKAESENITGIVSGCSGDVTDKGLCANRPCMDGRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEKKYNFSGSSKLLSNDIIAVGKYETDKFSRYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYLNLLFNWGNGFNKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGIQTSVITSSSIILIEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDNISYAGIKLLNRSNVYVENKFIPNFQSKQSILSEQGEKENNPTKKNNPIVVAKSNCSNIEPLHNLDCKVSDSAGIIRPIVSYKINTVTHSQKITTTPDN IYTENTKSESSTIYKSLEINNSGVINIWLIIGFSVGGSLLLVFITCFIYRCFRKDEGSYNVEDDHIFIDPSHKSLNLLNSSKDIELKNNYQTLNSATFNSSKHKQSRNEKSTNTKEWYV
Sbjct:  350 ETGNPEEIPVATFLQDAYIYNSINIPTVSDMDAINLEFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPESTFKVTCVSIYSTCTDNRWHTISVSRKKTS---------IKVVVDGKVVVDRMVGLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRYFLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGILRQGFVGCLLDISVNGDQYDLALKAESENITGIVSGCSGDVTDKGLCANRPCMDGRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEKKYNFSGSSKLLSNDIIAVGKYETDKFSRYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYLNLLFNWGNGFNKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGIQTSVITSSSIILIEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKGKTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDNISYAGIKLLNRSNVYVENKFIPNFQSKQSILSEQGEKENNPTKKNNPIVVAKSNCSNIEPLHNLDCKVSDSAGIIRPIVSYKINTVTHSQKITTTPDNGIYTENTKSESSTIYKSLEINNSGVINIWLIIGFSVGGSLLLVFITCFIYRCFRKDEGSYNVEDDHIFIDPSHKSLNLLNSSKDIELKNNYQTLNSATFNSSKHKQSRNEKSTNTKEWYV 1601          
BLAST of neurexin-1 isoform X19 vs. Planmine SMEST
Match: SMESG000066308.1 (SMESG000066308.1)

HSP 1 Score: 716.457 bits (1848), Expect = 0.000e+0
Identity = 452/1267 (35.67%), Postives = 717/1267 (56.59%), Query Frame = 1
Query:  295 AINLEFKTKQDFSHIFYVGTQPSHSK----TGLQYILMYLDDRQLGIRIKHDRLPESTF---KVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSGQLXXXXXXXXXXXXXXXXXLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKIIYSTDNANLDILAQAKIKRY-FLTRGEIYFDKCSDLFIIKPISFTTEASYITLAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLN-QFDFYAFEIRESFLHFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHTNSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGILRQGFVGCLLDISVNGD--QFDLALKAESENITGIVSGC--SGDVTDKGLCANRPCMDGRCIIGYNRFICDCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTRPNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGNKIIRSDYNCFDGNWHTLKLKRRQLSVILIIDDMEKKYNFS-GSSKLLSNDIIAVGKYETDKFSRYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPSVNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGYXXXXXXXXXXXXKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPIGERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCISSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVS-CRPNICHSGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTKNTTLDELAFGXXXXXXXXXXXXXXEGDGKQSDFISARLMKDKGRALLIIEYNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKG-KTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIPLSDMIDNISYAGIKLLNRSNVYVENKFIPNFQSKQS----ILSEQGXXXXXXXXXXXXIVVAKSNCSNIEPLHNLDCKVSDSAGIIRPIVSY----------KINTVTHSQKITTTPDNDIYTENTKSESSTIYKSLEINNSGV--------INIWLIIGFSVGGSLLLVFITCFIYRCFRKDEGSYNVEDDHIFIDPSHXXXXXXXXXXDIELKNNYQTLNSATFNSSKHKQSRNEKSTNTKEWYV 3981
            +IN +FKTKQD S +FY+G+ P  ++    +  Q+I +Y++D    I I + +  +S+F   K  C SIY TC D++WH + +            +    +V+           L+   L +++I            +  Q        L+ F+GCM++I    +N  L+I+     K Y F + G++  D C ++F IKP+SFT  + Y+   G    +K K   SFKT +S+ L+AYQ S    ++   DFY+ EIR+  L+FSI   S VY + +S+  VS+GL H + L FE   + + LD +  + + ++ Y  ++    LYIG + +T +  + H +WSGIL   F GC+  ++++    Q DL +K  S     I SGC  S ++    +CAN+PC +G C I +++  CDC++TN+TG+TC + A + +FNG+Q M I  PN ++SE E+  L F +  PNG+ + T+++ SG +D+LEIF++NG + ILLNFGRGNK  ++  NCFD  WH++K+KRR+ ++ + IDD   ++N    SSKL+SNDII +GK +  + +++F GYMMHF +NG NYFELAK+ SP NIE+TA++  A   ++F I+F S  SY+ +PK++++GDF+LEF +KT    G +L L G+S DYLILE+V+G L++++NWG+G+ +K+ +   ++D +WH V ++R  SK+ SFAFR+D +P   RA + +  GGLNFN F  + LG   +  S      +   S  GF+GCI+SFY+N +    T  +Y++LL  A   + V E+CP++HN + + C  + C  GG+C Q W++  CDC+ T+F G +C+ VS T +F  +P+YL+YK S  K  ++++LAFG QT+    + +I I G    S  ++  +        + +EY   +G    +ES +N+ DG YH V FR++   A+L++DD +  I  P G   +   +++  + VG     ++            +SF G++SGL  N I + D +     + I L+N+SNV      +PNFQ ++S      SE+  K     +KNN IVVA+  C  I       C+     GI++P V++          K N    + + T  P   +   N ++ S     +++IN            INIWLI  FS GG+ +L+ ++C IYRC  KDEGSYNV++D I I  ++ + + L S  + + K+N Q+L +   N  K K+ R   S  TKEWYV
Sbjct:  274 SINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIK-----------EFRNDIVITLDDFQKEFKNLSNQQL-TKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTRNSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRIILDKENYVLNISTNYHDIEFEGSLYIGSLDDTKILSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNS----SISSGCKTSEEMHSLNVCANQPCNEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNIQDSSSKLVSNDIIHLGKVKRME-NQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPRSKGGFQGCIASFYVNNSISTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSINQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNTVVDEELMVIVGSSEVSSK------------NSFQGFISGLTINEIAILDTLKENFNSYILLINKSNV----DLVPNFQPRRSDQSLKQSEEEPKNPETNQKNNRIVVARPQCPGITEAEKFQCQQYHYKGIVKPGVAFKKPNTQEKHSKTNFEEFASRSTNKPFEYLLPNNDQTTSDFNINNMKINPKNENTIKSNLNINIWLIAAFSCGGTFMLIALSCLIYRCSTKDEGSYNVKEDRICIQ-TNLNSSKLKSKLNCDEKSN-QSLLTKIPNKRKSKRKR---SGETKEWYV 1502          
The following BLAST results are available for this feature:
BLAST of neurexin-1 isoform X19 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NRXN11.447e-10425.65neurexin 1 [Source:HGNC Symbol;Acc:HGNC:8008][more]
NRXN12.073e-10125.52neurexin 1 [Source:HGNC Symbol;Acc:HGNC:8008][more]
NRXN31.926e-10026.91neurexin 3 [Source:HGNC Symbol;Acc:HGNC:8010][more]
NRXN13.631e-10025.28neurexin 1 [Source:HGNC Symbol;Acc:HGNC:8008][more]
NRXN14.084e-10025.14neurexin 1 [Source:HGNC Symbol;Acc:HGNC:8008][more]
back to top
BLAST of neurexin-1 isoform X19 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nrx-17.297e-7425.67NeuReXin related [Source:UniProtKB/TrEMBL;Acc:I2H... [more]
nrx-11.738e-7325.67NeuReXin related [Source:UniProtKB/TrEMBL;Acc:I2H... [more]
nrx-12.488e-7325.44NeuReXin related [Source:UniProtKB/TrEMBL;Acc:I2H... [more]
nrx-13.142e-7325.44NeuReXin related [Source:UniProtKB/TrEMBL;Acc:I2H... [more]
unc-523.008e-928.19Basement membrane proteoglycan [Source:UniProtKB/... [more]
back to top
BLAST of neurexin-1 isoform X19 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nrx-11.389e-8525.43gene:FBgn0038975 transcript:FBtr0334611[more]
Nrx-11.919e-8525.59gene:FBgn0038975 transcript:FBtr0334609[more]
Nrx-12.656e-8525.59gene:FBgn0038975 transcript:FBtr0334610[more]
Nrx-12.684e-8525.52gene:FBgn0038975 transcript:FBtr0334612[more]
Nrx-12.684e-8525.52gene:FBgn0038975 transcript:FBtr0334608[more]
back to top
BLAST of neurexin-1 isoform X19 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nrxn1a4.469e-10825.67neurexin 1a [Source:NCBI gene;Acc:565531][more]
nrxn1a1.012e-10425.41neurexin 1a [Source:NCBI gene;Acc:565531][more]
nrxn1a1.142e-10425.41neurexin 1a [Source:NCBI gene;Acc:565531][more]
nrxn1a3.230e-10425.35neurexin 1a [Source:NCBI gene;Acc:565531][more]
nrxn1a3.897e-10425.14neurexin 1a [Source:NCBI gene;Acc:565531][more]
back to top
BLAST of neurexin-1 isoform X19 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NRXN31.663e-10127.84neurexin 3 [Source:NCBI gene;Acc:100379902][more]
NRXN32.314e-9927.32neurexin 3 [Source:NCBI gene;Acc:100379902][more]
NRXN33.173e-9826.87neurexin 3 [Source:NCBI gene;Acc:100379902][more]
NRXN33.345e-9827.50neurexin 3 [Source:NCBI gene;Acc:100379902][more]
NRXN33.376e-9827.50neurexin 3 [Source:NCBI gene;Acc:100379902][more]
back to top
BLAST of neurexin-1 isoform X19 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nrxn19.037e-10527.25neurexin I [Source:MGI Symbol;Acc:MGI:1096391][more]
Nrxn11.976e-10127.06neurexin I [Source:MGI Symbol;Acc:MGI:1096391][more]
Nrxn12.422e-10026.71neurexin I [Source:MGI Symbol;Acc:MGI:1096391][more]
Nrxn14.354e-10026.78neurexin I [Source:MGI Symbol;Acc:MGI:1096391][more]
Nrxn14.790e-10026.78neurexin I [Source:MGI Symbol;Acc:MGI:1096391][more]
back to top
BLAST of neurexin-1 isoform X19 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9ULB1|NRX1A_HUMAN6.949e-10425.65Neurexin-1 OS=Homo sapiens OX=9606 GN=NRXN1 PE=1 S... [more]
sp|A1XQX0|NR1AA_DANRE3.017e-10225.06Neurexin-1a OS=Danio rerio OX=7955 GN=nrxn1a PE=2 ... [more]
sp|Q28146|NRX1A_BOVIN1.836e-10025.12Neurexin-1 OS=Bos taurus OX=9913 GN=NRXN1 PE=1 SV=... [more]
sp|Q9CS84|NRX1A_MOUSE1.694e-9926.71Neurexin-1 OS=Mus musculus OX=10090 GN=Nrxn1 PE=1 ... [more]
sp|A1XQY1|NR3BA_DANRE3.590e-9926.40Neurexin-3b OS=Danio rerio OX=7955 GN=nrxn3b PE=2 ... [more]
back to top
BLAST of neurexin-1 isoform X19 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210PI375.447e-11430.04Neurexin-1a OS=Mizuhopecten yessoensis OX=6573 GN=... [more]
A0A4E0S3K82.401e-11227.24Neurexin OS=Fasciola hepatica OX=6192 GN=D915_0000... [more]
A0A430QHY54.979e-11227.40Neurexin OS=Schistosoma bovis OX=6184 GN=DC041_001... [more]
A0A4Z2DG091.617e-11128.19Neurexin-1 (Fragment) OS=Schistosoma japonicum OX=... [more]
A0A3P8G6Q01.060e-11027.64Uncharacterized protein OS=Schistosoma margrebowie... [more]
back to top
BLAST of neurexin-1 isoform X19 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000011949.23.213e-10125.77pep primary_assembly:Astyanax_mexicanus-2.0:6:2098... [more]
ENSAMXT00000000309.21.760e-9925.08pep primary_assembly:Astyanax_mexicanus-2.0:21:105... [more]
nrxn3a3.171e-9827.16neurexin 3 [Source:NCBI gene;Acc:103035103][more]
nrxn3a3.010e-9726.86neurexin 3 [Source:NCBI gene;Acc:103035103][more]
ENSAMXT00000043111.12.268e-9628.03pep primary_assembly:Astyanax_mexicanus-2.0:14:799... [more]
back to top
BLAST of neurexin-1 isoform X19 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002142.12.328e-9426.52pep scaffold:Pmarinus_7.0:GL476386:209124:506099:1... [more]
ENSPMAT00000004299.12.175e-3026.27pep scaffold:Pmarinus_7.0:GL477235:143017:163597:1... [more]
cntnap2b1.976e-1325.06contactin associated protein like 2b [Source:ZFIN;... [more]
ENSPMAT00000000342.16.981e-1226.74pep scaffold:Pmarinus_7.0:GL477011:22393:100421:-1... [more]
ENSPMAT00000007718.13.628e-1127.02pep scaffold:Pmarinus_7.0:GL476589:4931:52526:1 ge... [more]
back to top
BLAST of neurexin-1 isoform X19 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of neurexin-1 isoform X19 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO474227.879e-2024.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468733.258e-1625.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO364191.985e-1530.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361095.731e-1425.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO392582.898e-1323.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of neurexin-1 isoform X19 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000034989.18.353e-10225.66neurexin 1 [Source:NCBI gene;Acc:101159771][more]
ENSORLT00000046931.11.033e-10125.66neurexin 1 [Source:NCBI gene;Acc:101159771][more]
ENSORLT00000030454.11.700e-10125.43neurexin 1 [Source:NCBI gene;Acc:101159771][more]
ENSORLT00000033187.11.700e-10125.43neurexin 1 [Source:NCBI gene;Acc:101159771][more]
ENSORLT00000027034.11.951e-10125.66neurexin 1 [Source:NCBI gene;Acc:101159771][more]
back to top
BLAST of neurexin-1 isoform X19 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000058569.10.000e+099.84SMESG000058569.1[more]
SMESG000058569.10.000e+099.14SMESG000058569.1[more]
SMESG000058569.10.000e+098.89SMESG000058569.1[more]
SMESG000058569.10.000e+098.89SMESG000058569.1[more]
SMESG000066308.10.000e+035.67SMESG000066308.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016804 ID=SMED30016804|Name=neurexin-1 isoform X19|organism=Schmidtea mediterranea sexual|type=transcript|length=4108bp
AAGGATTTTTAAAATAATTTTACTAAGAAGAATAAAAAGGTCAATCGGTT
TTCCAGAAATTATAAATGAAAAATTATCTTTTCTTGACAAATCATTAAAC
TCTTTTGAAAAGTGATTCTTTGATGATCATTATAATTCATTAAATGTTAT
TATAAAATGGAAACTATTAATTTCTTTTTGATCTCTTTTGTTATAATTCA
CACAGGAACTACCGAAGAAATACCTGTAGCAACATTCCTCCAAGATGCAT
ATATTTACAATTCAATTAATATTCCTACTGTCAGTGACATGGATGCGATT
AATTTAGAATTCAAAACCAAACAAGATTTCTCCCATATTTTTTATGTTGG
AACGCAGCCATCACATTCAAAGACTGGGTTGCAGTACATACTGATGTATC
TGGATGACAGACAATTGGGCATTAGAATCAAGCACGACAGACTCCCAGAG
TCCACATTCAAAGTCACTTGTGTCAGCATCTATTCAACCTGTACCGACAA
TCGTTGGCATACAATCTCGGTATCCCGGAAAAAAACCTCTGAGAAAAATT
CTTCTGGACAGTTAGTTATCAAAGTCGTCGTTGATGGAAAAGTCGTCGTG
GATAGGATGGTGGGGCTGACAGTCACCCATCTCATCAGTCAATCTATCAC
ATTTGGTGGAATGATTCCAATGACTGATTCTGATTTCAGTATCCAGGAAA
CTGCATCTTTTCTACAAAACTTGACAAACTTTAAGGGATGCATGCAAAAA
ATAATATACTCAACTGATAATGCCAATTTGGATATACTTGCTCAAGCAAA
AATAAAAAGATATTTTCTAACTCGTGGAGAAATATATTTTGATAAATGTT
CAGATCTCTTCATTATTAAACCTATATCATTTACTACTGAAGCGTCTTAC
ATAACTCTAGCAGGATGGGCATGGGCTCAAAAGGGTAAACTTCAATTTTC
CTTTAAAACTGTCGAATCAAACGCTTTGCTTGCATATCAAAAGTCAGAAA
CATCTCAATTGAATCAATTTGATTTCTATGCTTTTGAAATTAGAGAGTCT
TTCCTTCATTTTTCAATAAACACTGGATCTGGAGTTTACCAACAAAAAGT
GTCTTCTACACCTGTATCAGATGGTCTAAGTCATTATGTAAAACTTTGGT
TTGAAGATGGCAATGTCGAAGTTCAACTCGATGCCGATAAAAAAATAGAG
CACACTAATAGCTTATATAAAACACTTGACACTACAAGAGATCTTTATAT
TGGAGGAATCCCTGAAACCCTTGTGTCGTTTCTTCCTCATTCTCTGTGGT
CAGGAATTTTGCGACAAGGATTTGTTGGATGTTTATTAGATATCAGCGTA
AATGGTGATCAGTTCGATTTAGCATTGAAGGCTGAAAGTGAAAATATAAC
TGGAATTGTTAGTGGATGTTCTGGTGATGTGACTGACAAAGGTCTTTGTG
CAAACAGACCGTGCATGGATGGAAGATGTATTATTGGATATAACAGATTC
ATTTGCGATTGTTCAAGGACAAATTACACTGGCGATACATGCGGGAGAGT
GGCTCCATTGGTGAAATTCAATGGATTTCAACAAATGATAATAAATATGC
CCAACGGATTTCAATCGGAATGTGAGGACGTTACGCTAAGATTTCTAACC
ACGCGTCCCAATGGCATATTTATTGTAACTAAAAGTCGAGTTTCCGGAGC
TTCTGATAGACTTGAGATATTTCTCGAAAACGGAAAATTAAATATTTTGC
TCAATTTCGGCCGTGGAAATAAAATTATTCGATCAGATTATAATTGTTTC
GACGGGAATTGGCATACTCTAAAACTGAAGAGGCGTCAATTGTCAGTTAT
TCTCATCATTGATGACATGGAAAAGAAATATAATTTTAGTGGATCTAGCA
AATTGCTATCGAACGATATCATTGCAGTGGGTAAATATGAAACTGATAAA
TTCAGTCGGTATTTCACTGGATATATGATGCATTTTACATTTAATGGAAT
AAATTATTTTGAACTCGCAAAAGAAGAATCACCTTCAAATATCGAAGTCA
CCGCCACAATTGGTGATGCTGAACCGACGAAAGAATTCCCAATCTCTTTT
CCCTCGGTCAACTCTTATATCCGACTGCCGAAAATCGATATGTATGGAGA
TTTTAAATTAGAATTCTTAATTAAAACAAGAAATAATAAAGGATCAGTTC
TTCAATTGTACGGGAAAAGTGGTGACTATTTAATTTTAGAAATAGTTCAC
GGTTACTTGAACCTGTTATTTAATTGGGGGAATGGATTCAATAAAAAGGT
CAGAAAAGAGATCAAAATTGACGACAACATATGGCACAGAGTAATACTGA
TCAGGGAGAATTCAAAATCAAGTTCATTTGCTTTTCGAATTGACAGTCAA
CCTATAGGTGAAAGAGCTCATATTGAATTGAAAGCTGGAGGGTTAAACTT
CAATTCTTTTGAAAATCTCTTTCTTGGAAGTGCAGAGAAATATTTATCTA
AAACCAATCAAATCAGAGATAAAGTAACATCAAGTCAAGGGTTTGAAGGT
TGTATATCTTCATTTTATATGAATCAGACAAAATACGTTTCAACAAAATC
AGTGTATCAAAACCTTTTAGCTATAGCCTTAGCGAATAACGGAGTTGTAG
AAGATTGTCCTGAAGACCACAATTATCAAGTGAGCTGTCGACCTAATATT
TGTCATTCCGGAGGTAGATGTATACAGCAATGGATACGAATTAGATGTGA
CTGTGCAATGACTACATTTATCGGCGAAAGATGTGATAAAGTTAGTAAAA
CACTGAAGTTCAACGATTATCCGGCCTATTTGATTTACAAATTGTCTCCG
ACAAAAAATACAACTCTGGACGAGCTGGCATTTGGTATACAAACATCAGT
AATCACGTCTTCATCCATCATTCTGATAGAAGGCGATGGAAAGCAATCGG
ATTTCATATCAGCCAGATTAATGAAGGATAAGGGTAGGGCACTGTTGATA
ATTGAGTACAATCTGGGGAGTGGGATCACGAGGCTGGTCGAGTCTTCTGT
GAACATCGCTGATGGGTTTTATCATAGGGTAGCGTTTAGGAGAAACGGAA
ATCTCGCTTCTTTACAAATTGATGATTACAATAGGATAATCGCATCACCT
AAAGGTAAAACAAGTATACATTTCAATCAACAGCGCACGATTTATGTCGG
TAAGTATCCATTTCCAAACCAGAGAACAGGACGATCAGTGCAGAATGACA
AAACGTTTGATTCTTTCAGCGGTTATTTGTCAGGCCTATATTTTAATCGG
ATTCCCCTGAGCGATATGATCGACAATATCAGCTATGCTGGGATTAAATT
GTTGAACCGATCAAATGTTTATGTTGAAAACAAATTTATCCCGAATTTCC
AATCCAAACAATCTATATTATCAGAACAAGGAGAAAAAGAAAATAATCCA
ACAAAAAAAAACAATCCAATTGTGGTAGCCAAGTCGAATTGTTCAAACAT
AGAACCTTTGCATAATTTAGATTGTAAAGTGTCGGATTCAGCTGGCATAA
TACGACCCATTGTATCTTATAAAATAAATACTGTCACCCATTCACAGAAA
ATAACAACAACCCCAGACAACGACATTTACACTGAAAACACGAAATCAGA
ATCCAGTACGATATACAAATCGCTGGAAATAAACAATTCAGGAGTCATAA
ATATTTGGTTAATAATCGGATTCTCAGTTGGCGGAAGTCTTTTGTTGGTG
TTTATCACTTGTTTCATATACAGATGTTTCCGAAAAGACGAAGGTTCGTA
CAATGTCGAAGATGATCATATCTTTATAGATCCCTCTCATAAATCACTAA
ATCTTTTAAATTCCTCAAAAGACATTGAATTGAAAAACAATTATCAAACA
TTGAATAGTGCAACTTTTAATTCTTCAAAACATAAACAATCGAGGAATGA
AAAATCAACAAACACCAAAGAATGGTACGTGTGACATCCGGTCGGGTCAC
CTGAGGAATTATGTGCATTTATCTAATATATATATTTATAATTAACCTCT
TTTTTAAAGAGTTCCTTGTATATAGAATGTGATCAAGTTTTTTACATTTG
TTAATAAT
back to top

protein sequence of SMED30016804-orf-1

>SMED30016804-orf-1 ID=SMED30016804-orf-1|Name=SMED30016804-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1276bp
METINFFLISFVIIHTGTTEEIPVATFLQDAYIYNSINIPTVSDMDAINL
EFKTKQDFSHIFYVGTQPSHSKTGLQYILMYLDDRQLGIRIKHDRLPEST
FKVTCVSIYSTCTDNRWHTISVSRKKTSEKNSSGQLVIKVVVDGKVVVDR
MVGLTVTHLISQSITFGGMIPMTDSDFSIQETASFLQNLTNFKGCMQKII
YSTDNANLDILAQAKIKRYFLTRGEIYFDKCSDLFIIKPISFTTEASYIT
LAGWAWAQKGKLQFSFKTVESNALLAYQKSETSQLNQFDFYAFEIRESFL
HFSINTGSGVYQQKVSSTPVSDGLSHYVKLWFEDGNVEVQLDADKKIEHT
NSLYKTLDTTRDLYIGGIPETLVSFLPHSLWSGILRQGFVGCLLDISVNG
DQFDLALKAESENITGIVSGCSGDVTDKGLCANRPCMDGRCIIGYNRFIC
DCSRTNYTGDTCGRVAPLVKFNGFQQMIINMPNGFQSECEDVTLRFLTTR
PNGIFIVTKSRVSGASDRLEIFLENGKLNILLNFGRGNKIIRSDYNCFDG
NWHTLKLKRRQLSVILIIDDMEKKYNFSGSSKLLSNDIIAVGKYETDKFS
RYFTGYMMHFTFNGINYFELAKEESPSNIEVTATIGDAEPTKEFPISFPS
VNSYIRLPKIDMYGDFKLEFLIKTRNNKGSVLQLYGKSGDYLILEIVHGY
LNLLFNWGNGFNKKVRKEIKIDDNIWHRVILIRENSKSSSFAFRIDSQPI
GERAHIELKAGGLNFNSFENLFLGSAEKYLSKTNQIRDKVTSSQGFEGCI
SSFYMNQTKYVSTKSVYQNLLAIALANNGVVEDCPEDHNYQVSCRPNICH
SGGRCIQQWIRIRCDCAMTTFIGERCDKVSKTLKFNDYPAYLIYKLSPTK
NTTLDELAFGIQTSVITSSSIILIEGDGKQSDFISARLMKDKGRALLIIE
YNLGSGITRLVESSVNIADGFYHRVAFRRNGNLASLQIDDYNRIIASPKG
KTSIHFNQQRTIYVGKYPFPNQRTGRSVQNDKTFDSFSGYLSGLYFNRIP
LSDMIDNISYAGIKLLNRSNVYVENKFIPNFQSKQSILSEQGEKENNPTK
KNNPIVVAKSNCSNIEPLHNLDCKVSDSAGIIRPIVSYKINTVTHSQKIT
TTPDNDIYTENTKSESSTIYKSLEINNSGVINIWLIIGFSVGGSLLLVFI
TCFIYRCFRKDEGSYNVEDDHIFIDPSHKSLNLLNSSKDIELKNNYQTLN
SATFNSSKHKQSRNEKSTNTKEWYV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000240body wall musculature
PLANA:0000418head
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR000742EGF-like_dom
IPR001791Laminin_G
IPR013320ConA-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005509calcium ion binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001791Laminin G domainSMARTSM00282LamG_3coord: 423..550
e-value: 1.0E-13
score: 61.5
coord: 599..743
e-value: 3.6E-14
score: 63.1
coord: 838..984
e-value: 1.2E-13
score: 61.3
coord: 193..336
e-value: 9.8E-25
score: 98.2
coord: 2..139
e-value: 0.94
score: 2.4
IPR001791Laminin G domainPFAMPF02210Laminin_G_2coord: 11..136
e-value: 1.4E-7
score: 32.1
coord: 201..335
e-value: 6.3E-19
score: 68.8
coord: 431..549
e-value: 1.5E-12
score: 48.2
coord: 607..742
e-value: 2.7E-16
score: 60.3
coord: 855..983
e-value: 6.2E-14
score: 52.7
IPR001791Laminin G domainPROSITEPS50025LAM_G_DOMAINcoord: 816..1010
score: 22.169
IPR001791Laminin G domainPROSITEPS50025LAM_G_DOMAINcoord: 579..769
score: 28.467
IPR001791Laminin G domainPROSITEPS50025LAM_G_DOMAINcoord: 173..356
score: 34.41
IPR001791Laminin G domainPROSITEPS50025LAM_G_DOMAINcoord: 403..573
score: 18.143
IPR001791Laminin G domainPROSITEPS50025LAM_G_DOMAINcoord: 1..166
score: 18.828
IPR000742EGF-like domainSMARTSM00181egf_5coord: 365..398
e-value: 4.2
score: 16.3
coord: 778..812
e-value: 14.0
score: 14.3
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 362..398
score: 9.841
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 775..812
score: 12.155
NoneNo IPR availableGENE3DG3DSA:2.60.120.200coord: 577..754
e-value: 1.3E-25
score: 92.1
NoneNo IPR availableGENE3DG3DSA:2.60.120.200coord: 4..155
e-value: 6.2E-11
score: 44.1
NoneNo IPR availableGENE3DG3DSA:2.60.120.200coord: 400..574
e-value: 7.0E-26
score: 92.9
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 363..399
e-value: 3.5E-8
score: 35.1
coord: 776..811
e-value: 1.0E-11
score: 46.5
NoneNo IPR availableGENE3DG3DSA:2.60.120.200coord: 171..356
e-value: 2.0E-41
score: 143.7
NoneNo IPR availableGENE3DG3DSA:2.60.120.200coord: 812..998
e-value: 4.5E-30
score: 106.8
NoneNo IPR availablePANTHERPTHR15036FAMILY NOT NAMEDcoord: 41..989
NoneNo IPR availablePANTHERPTHR15036:SF51NEUREXIN-1coord: 41..989
NoneNo IPR availableCDDcd00110LamGcoord: 824..982
e-value: 2.3306E-18
score: 81.3104
NoneNo IPR availableCDDcd00110LamGcoord: 425..542
e-value: 3.92868E-14
score: 68.984
NoneNo IPR availableCDDcd00110LamGcoord: 174..334
e-value: 2.14877E-23
score: 95.5628
NoneNo IPR availableCDDcd00110LamGcoord: 580..741
e-value: 1.27051E-19
score: 84.7772
NoneNo IPR availableTMHMMTMhelixcoord: 1118..1140
IPR013320Concanavalin A-like lectin/glucanase domain superfamilySUPERFAMILYSSF49899Concanavalin A-like lectins/glucanasescoord: 579..770
IPR013320Concanavalin A-like lectin/glucanase domain superfamilySUPERFAMILYSSF49899Concanavalin A-like lectins/glucanasescoord: 166..356
IPR013320Concanavalin A-like lectin/glucanase domain superfamilySUPERFAMILYSSF49899Concanavalin A-like lectins/glucanasescoord: 384..552
IPR013320Concanavalin A-like lectin/glucanase domain superfamilySUPERFAMILYSSF49899Concanavalin A-like lectins/glucanasescoord: 798..987
IPR013320Concanavalin A-like lectin/glucanase domain superfamilySUPERFAMILYSSF49899Concanavalin A-like lectins/glucanasescoord: 7..167