Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A

Overview
NamePhosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A
Smed IDSMED30016801
Length (bp)1451
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A (SMED30016801) t-SNE clustered cells

Violin plots show distribution of expression levels for Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A (SMED30016801) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A (SMED30016801) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A (SMED30016801) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016801

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30016801SMESG000037748.1 PL05004B2B08ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30016801SMESG000037748.1 PL030015B20G02ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30016801SMESG000037748.1 Contig6532GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30016801SMESG000037748.1 dd_Smed_v4_1306_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30016801SMESG000037748.1 dd_Smed_v4_1306_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30016801SMESG000037748.1 dd_Smed_v6_1306_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
glial cellSMED30016801SMESG000037748.1 dd_Smed_v6_1306_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Human
Match: PLA2G15 (phospholipase A2 group XV [Source:HGNC Symbol;Acc:HGNC:17163])

HSP 1 Score: 202.986 bits (515), Expect = 1.172e-59
Identity = 133/376 (35.37%), Postives = 216/376 (57.45%), Query Frame = 3
Query:  198 PIILIPGDGGSRAYSNVD-----YRIFTTKV----LVWVNFEYM---VFPSLLRNVFKLEYNTTNHKTSNMKGSDVFFPGWGDTETIEELDEKLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFRKAPNENQKMLDDLKILIEDTYRKSGNERVVIXXXXXXXXXXXXFFKQMTMSWKKQYIRAFLSVSGPLGGAVKAVTLETSGESLGSPR-SPIYFREMQRSFPSTSFLLPKPEIFGKEP-FIITPTRNYSSYDYEDLFKDMSMPYGSTMYNDTKNLVDGTETPEGIDELYCIHSYGLPTTKQLTFKAFPDGQPQFTTGDGDYTVNIQSLKICEKWKN-----VNYFTIKGADHMQIVSTPEFMLKLKQIL 1268
            P++L+PGD G++  + +D     + + + K      +W+N E +   +    + N+ +L YN T+  T    G DV  PG+G T ++E LD       +YF  +V++LV    Y R + VRGAPYD+R+APNEN      L+ +IE+ Y+  G   VV++ HS+G++Y+LYF ++   +WK +YIRAF+S+  P GG  K + +  SG++   P   P+  RE QRS  STS+LLP    +  E  F+ TPT NY+  DY   F+D+    G  M  DT+ LV+ T  P G+ +L+C++  G+PT     +++FPD  P+   GDGD TVN++S   C+ W++     V    + G++H+++++    +  LK++L
Sbjct:   39 PVVLVPGDLGNQLEAKLDKPTVVHYLCSKKTESYFTIWLNLELLLPVIIDCWIDNI-RLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLV-GWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGP-VVLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFEDGWLMRQDTEGLVEAT-MPPGV-QLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVL 409          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Human
Match: LCAT (lecithin-cholesterol acyltransferase [Source:HGNC Symbol;Acc:HGNC:6522])

HSP 1 Score: 147.132 bits (370), Expect = 1.567e-38
Identity = 112/386 (29.02%), Postives = 189/386 (48.96%), Query Frame = 3
Query:  198 PIILIPGDGGSRAYSNVD---------YRIFTTKVLVWVNFEYMVFP----SLLRNVFKLEYNTTNHKTSNMKGSDVFFPGWGDTETIEELDE-KLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFRKAPNENQKMLDDLKILIEDTYRKSGNERVVIXXXXXXXXXXXXFFKQMTMSWKKQYIRAFLSVSGPLGGAVKAVTLETSGESLGSP-RSPIYFREMQRSFPSTSFLLPKPEIFGKEP-FIITPTRNYSSYDYEDLFKDMSMPYGSTMYNDTKNLVDGTETPEGIDELYCIHSYGLPTTKQLTF-KAFPDGQP-QFTTGDGDYTVNIQSLKICEKWKN-----VNYFTIKGADHMQIVSTPEFMLKLKQIL---YRQ 1277
            P+IL+PG  G++  + +D         YR       +W++   M  P      + N  ++ YN ++   SN  G  +  PG+G T ++E LD  KL     Y   LV NLV +  YVR++TVR APYD+R  P + ++    L  L+E+ +   G    +I           +  +Q   +WK ++I  F+S+  P GG++K + +  SG++ G P  S I  +E QR   ++ ++ P    + ++  FI TP+ NY+  D++  F D+    G  M+  +++L+ G   P G+ E+YC++  GLPT +   +   FP   P      DGD TV  +S ++C  W+      V+   + G  H+ +V +   +  +  IL   YRQ
Sbjct:   48 PVILVPGCLGNQLEAKLDKPDVVNWMCYRKTEDFFTIWLDLN-MFLPLGVDCWIDNT-RVVYNRSSGLVSNAPGVQIRVPGFGKTYSVEYLDSSKL---AGYLHTLVQNLV-NNGYVRDETVRAAPYDWRLEPGQQEEYYRKLAGLVEEMHAAYGKPVFLIGHSLGCLHLLYFLLRQ-PQAWKDRFIDGFISLGAPWGGSIKPMLVLASGDNQGIPIMSSIKLKEEQRITTTSPWMFPSRMAWPEDHVFISTPSFNYTGRDFQRFFADLHFEEGWYMWLQSRDLLAGLPAP-GV-EVYCLYGVGLPTPRTYIYDHGFPYTDPVGVLYEDGDDTVATRSTELCGLWQGRQPQPVHLLPLHGIQHLNMVFSNLTLEHINAILLGAYRQ 424          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Human
Match: PLA2G15 (phospholipase A2 group XV [Source:HGNC Symbol;Acc:HGNC:17163])

HSP 1 Score: 126.331 bits (316), Expect = 4.742e-32
Identity = 72/203 (35.47%), Postives = 117/203 (57.64%), Query Frame = 3
Query:  681 KQMTMSWKKQYIRAFLSVSGPLGGAVKAVTLETSGESLGSPR-SPIYFREMQRSFPSTSFLLPKPEIFGKEP-FIITPTRNYSSYDYEDLFKDMSMPYGSTMYNDTKNLVDGTETPEGIDELYCIHSYGLPTTKQLTFKAFPDGQPQFTTGDGDYTVNIQSLKICEKWKN-----VNYFTIKGADHMQIVSTPEFMLKLKQIL 1268
            ++   +WK +YIRAF+S+  P GG  K + +  SG++   P   P+  RE QRS  STS+LLP    +  E  F+ TPT NY+  DY   F+D+    G  M  DT+ LV+ T  P G+ +L+C++  G+PT     +++FPD  P+   GDGD TVN++S   C+ W++     V    + G++H+++++    +  LK++L
Sbjct:  115 QRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFEDGWLMRQDTEGLVEAT-MPPGV-QLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVL 315          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Human
Match: PLA2G15 (phospholipase A2 group XV [Source:HGNC Symbol;Acc:HGNC:17163])

HSP 1 Score: 114.005 bits (284), Expect = 8.961e-28
Identity = 87/256 (33.98%), Postives = 138/256 (53.91%), Query Frame = 3
Query:  198 PIILIPGDGGSRAYSNVD-----YRIFTTKV----LVWVNFEYM---VFPSLLRNVFKLEYNTTNHKTSNMKGSDVFFPGWGDTETIEELDEKLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFRKAP--------------------NENQKMLDDLKILIEDTYRKSGNERVVIXXXXXXXXXXXXFFKQMTMSWKKQYIRAFLSVSGPLGGAVKAVTLETSGESLGSPR-SPIYFREMQRSFPSTSFLLP 866
            P++L+PGD G++  + +D     + + + K      +W+N E +   +    + N+ +L YN T+  T    G DV  PG+G T ++E LD       +YF  +V++LV    Y R + VRGAPYD+R+AP                    +EN      L+ +IE+ Y+  G   VV++ HS+G++Y+LYF ++   +WK +YIRAF+S+  P GG  K + +  SG++   P   P+  RE QRS  STS+LLP
Sbjct:   39 PVVLVPGDLGNQLEAKLDKPTVVHYLCSKKTESYFTIWLNLELLLPVIIDCWIDNI-RLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLV-GWGYTRGEDVRGAPYDWRRAPTQWFRLQDPSHLTPAWLWPADENGPYFLALREMIEEMYQLYGGP-VVLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLP 291          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Human
Match: LCAT (lecithin-cholesterol acyltransferase [Source:HGNC Symbol;Acc:HGNC:6522])

HSP 1 Score: 110.538 bits (275), Expect = 5.816e-27
Identity = 70/229 (30.57%), Postives = 120/229 (52.40%), Query Frame = 3
Query:  333 KLEYNTTNHKTSNMKGSDVFFPGWGDTETIEELDE-KLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFRKAPNENQKMLDDLKILIEDTYRKSGNERVVIXXXXXXXXXXXXFFKQMTMSWKKQYIRAFLSVSGPLGGAVKAVTLETSGESLGSP-RSPIYFREMQRSFPSTSFLLPKPEIFGKEP-FIITPTRNYSSYDYEDLFKDMSMPYGSTMYNDTKNLVDG 1010
            ++ YN ++   SN  G  +  PG+G T ++E LD  KL     Y   LV NLV +  YVR++TVR APYD+R  P + ++    L  L+E+ +   G    +I           +  +Q   +WK ++I  F+S+  P GG++K + +  SG++ G P  S I  +E QR   ++ ++ P    + ++  FI TP+ NY+  D++  F D+    G  M+  +++L+ G
Sbjct:   32 RVVYNRSSGLVSNAPGVQIRVPGFGKTYSVEYLDSSKL---AGYLHTLVQNLV-NNGYVRDETVRAAPYDWRLEPGQQEEYYRKLAGLVEEMHAAYGKPVFLIGHSLGCLHLLYFLLRQ-PQAWKDRFIDGFISLGAPWGGSIKPMLVLASGDNQGIPIMSSIKLKEEQRITTTSPWMFPSRMAWPEDHVFISTPSFNYTGRDFQRFFADLHFEEGWYMWLQSRDLLAG 255          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Celegans
Match: M05B5.4 (pep chromosome:WBcel235:I:7188465:7190581:1 gene:WBGene00010872.1 transcript:M05B5.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:M05B5.4)

HSP 1 Score: 186.037 bits (471), Expect = 1.527e-53
Identity = 130/386 (33.68%), Postives = 211/386 (54.66%), Query Frame = 3
Query:  198 PIILIPGDGGSRAYSNVDYRIFTTKVL----------VWVNFEYMVFPSLLRNVF----KLEYNTTNHKTSNMKGSDVFFPGWGDTETIEELDEKLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFRKAPNENQKMLDDLKILIEDTYRKSGNERVVIXXXXXXXXXXXXFFKQ-MTMSWKKQYIRAFLSVSGPLGGAVKAVTLETSGESLGSPR---SPIYFREMQRSFPSTSFLLPKPEIFG-KEPFIITPTRNYSSYDYEDLFKDMSMPYGSTMYNDTKNLVDGTETPEGIDELYCIHSYGLPTTKQLTFKA--FPDGQPQFTTGDGDYTVNIQSLKICEKWKN------VNYFTIKGADHMQIVSTPEFMLKLKQILYR 1274
            P+IL+PGDGGS+  SN+  +      +          +W+N +  +F  L+ + +    +L +NTT   + NM G D+   G+G TE++E LD+    Q  YF ++VD++V    Y R K V GAP+D+RK+PNE    L  LK LIE TYR + N+++V++GHS+G+  SLYF    +  +WK +YI +F+S++ P  G+++ V L  SG ++   R    P   R MQRSF S++FL P P  +   E    T  +NY+  + ++ F+D++   G   Y     L +G  +  G+  ++CI+  G+PT ++ ++    FPD  P    GDGD TVN +S  +C  W        V    +  ADHM I+  P  +  +++ +++
Sbjct:   35 PVILVPGDGGSQLESNLTGKPSVVHYVCSKQTADYFDLWLNLQ--LFTPLVIDCWADNMQLVFNTTTGLSENMPGVDIRVAGFGATESVEWLDKSKASQGRYFFDIVDSMV-SWGYRRGKNVIGAPFDWRKSPNELNDYLIQLKSLIETTYRWNDNQKIVLVGHSMGNPLSLYFLNNYVDQAWKDKYISSFVSLAAPWAGSMQIVRLFASGYNMNYYRVILPPSSLRAMQRSFSSSAFLFPSPVAWKPHEILATTADKNYTVGNIKEFFQDINYMVGWEQYKQAARL-NGNLSSPGV-PVHCIYGTGVPTPEKFSWAPGYFPDYPPTEFMGDGDGTVNKKSATVCTNWIGNNNGYKVTVHEVFQADHMAILKHPNAIELVRKAIFQ 415          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Fly
Match: CG31683 (gene:FBgn0051683 transcript:FBtr0330662)

HSP 1 Score: 199.904 bits (507), Expect = 1.100e-58
Identity = 133/383 (34.73%), Postives = 205/383 (53.52%), Query Frame = 3
Query:  195 SPIILIPGDGGSRAYS-----NVDYRIFTTK---VLVWVNFEYMVFP---SLLRNVFKLEYNTTNHKTSNMKGSDVFFPGWGDTETIEELDEKLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFRKAPNENQKMLDDLKILIEDTYRKSGNERVVIXXXXXXXXXXXXFFKQMTMSWKKQYIRAFLSVSGPLGGAVKAVTLETSGESLGS-PRSPIYFREMQRSFPSTSFLLPKPEIFGK--EPFIITPTRNYSSYDYEDLFKDMSMPYGSTMYNDTKNLVDGTETPEGIDELYCIHSYGLPTTKQLTFKA--FPDGQPQFTTGDGDYTVNIQSLKICEKWKN-----VNYFTIKGADHMQIVSTPEFMLKLKQILYRQP 1280
            SP+I +PGDGGS+  +     N  Y I         +W++ E +V P     + NV KL Y+     T N  G +   PGWG+ E +E +D   +    YF ++ + LV    Y+R + + GAPYDFRKAPNENQ+   DLK L+ED+Y  +    V  + HS+GSL +L F ++ T+ WK +Y++  +S++G   G+ KAV +   G+ L S   S    +  Q + PST++LLP P +F K  E   +TP+RNY+    E+ FKD+    G  M  DT       + P    EL+C++  G+ T ++L +K        P+   G GD TVN +SL+ C+ W       +N   ++  DH+ I+S P+ +LK  + + +QP
Sbjct:   45 SPVIFVPGDGGSQMDARLNKPNSPYLICQKTHDWYNLWLDLEQLVIPIVYCWIDNV-KLYYDKVTRTTHNTPGVETRIPGWGNPEVVEWIDPTKNSAGAYFKDIANELV-KLGYIRKQNIHGAPYDFRKAPNENQQFFIDLKQLVEDSYEANNQSAVTFISHSMGSLMTLVFLQEQTLQWKAKYVKRMISLAGVWAGSFKAVKVFAMGDDLDSFALSAKILKAEQITHPSTAWLLPSP-LFWKPTEVLAMTPSRNYTMAQLEEFFKDLDYMTGWEMRKDTIRYNRNFDPPNV--ELHCLYGEGIDTVERLQYKKSDISGETPKLIMGLGDGTVNQRSLRACKYWAGYSKAPINTLALQNVDHLHILSNPD-VLKYIRTVMQQP 421          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Fly
Match: CG31683 (gene:FBgn0051683 transcript:FBtr0081365)

HSP 1 Score: 199.904 bits (507), Expect = 1.100e-58
Identity = 133/383 (34.73%), Postives = 205/383 (53.52%), Query Frame = 3
Query:  195 SPIILIPGDGGSRAYS-----NVDYRIFTTK---VLVWVNFEYMVFP---SLLRNVFKLEYNTTNHKTSNMKGSDVFFPGWGDTETIEELDEKLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFRKAPNENQKMLDDLKILIEDTYRKSGNERVVIXXXXXXXXXXXXFFKQMTMSWKKQYIRAFLSVSGPLGGAVKAVTLETSGESLGS-PRSPIYFREMQRSFPSTSFLLPKPEIFGK--EPFIITPTRNYSSYDYEDLFKDMSMPYGSTMYNDTKNLVDGTETPEGIDELYCIHSYGLPTTKQLTFKA--FPDGQPQFTTGDGDYTVNIQSLKICEKWKN-----VNYFTIKGADHMQIVSTPEFMLKLKQILYRQP 1280
            SP+I +PGDGGS+  +     N  Y I         +W++ E +V P     + NV KL Y+     T N  G +   PGWG+ E +E +D   +    YF ++ + LV    Y+R + + GAPYDFRKAPNENQ+   DLK L+ED+Y  +    V  + HS+GSL +L F ++ T+ WK +Y++  +S++G   G+ KAV +   G+ L S   S    +  Q + PST++LLP P +F K  E   +TP+RNY+    E+ FKD+    G  M  DT       + P    EL+C++  G+ T ++L +K        P+   G GD TVN +SL+ C+ W       +N   ++  DH+ I+S P+ +LK  + + +QP
Sbjct:   45 SPVIFVPGDGGSQMDARLNKPNSPYLICQKTHDWYNLWLDLEQLVIPIVYCWIDNV-KLYYDKVTRTTHNTPGVETRIPGWGNPEVVEWIDPTKNSAGAYFKDIANELV-KLGYIRKQNIHGAPYDFRKAPNENQQFFIDLKQLVEDSYEANNQSAVTFISHSMGSLMTLVFLQEQTLQWKAKYVKRMISLAGVWAGSFKAVKVFAMGDDLDSFALSAKILKAEQITHPSTAWLLPSP-LFWKPTEVLAMTPSRNYTMAQLEEFFKDLDYMTGWEMRKDTIRYNRNFDPPNV--ELHCLYGEGIDTVERLQYKKSDISGETPKLIMGLGDGTVNQRSLRACKYWAGYSKAPINTLALQNVDHLHILSNPD-VLKYIRTVMQQP 421          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Fly
Match: CG18858 (gene:FBgn0042175 transcript:FBtr0332971)

HSP 1 Score: 199.519 bits (506), Expect = 1.385e-58
Identity = 133/383 (34.73%), Postives = 206/383 (53.79%), Query Frame = 3
Query:  195 SPIILIPGDGGSRAYS-----NVDYRIFTTK---VLVWVNFEYMVFPSL---LRNVFKLEYNTTNHKTSNMKGSDVFFPGWGDTETIEELDEKLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFRKAPNENQKMLDDLKILIEDTYRKSGNERVVIXXXXXXXXXXXXFFKQMTMSWKKQYIRAFLSVSGPLGGAVKAVTLETSGESLGS-PRSPIYFREMQRSFPSTSFLLPKPEIFGK--EPFIITPTRNYSSYDYEDLFKDMSMPYGSTMYNDTKNLVDGTETPEGIDELYCIHSYGLPTTKQLTFKA--FPDGQPQFTTGDGDYTVNIQSLKICEKWKN-----VNYFTIKGADHMQIVSTPEFMLKLKQILYRQP 1280
            SP+I +PGDGGS+  +     N  Y I         +W++ E +V P +   + NV KL Y+     T N  G +   PGWG+ E +E +D   +    YF ++ + LV    Y+R + + GAPYDFRKAPNENQ+   DLK L+ED+Y  +    V  + HS+GSL +L F ++ T+ WK +Y++  +S++G   G+ KAV +   G+ L S   S    +  Q + PST++LLP P +F K  E   +TP+RNY+    E+ FKD+    G  M  DT       + P    EL+C++  G+ T ++L +K        P+   G GD TVN +SL+ C+ W       +N   ++  DH+ I+S P+ +LK  + + +QP
Sbjct:   45 SPVIFVPGDGGSQMDARLNKPNSPYLICQKTHDWYNLWLDLEQLVIPMVYCWIDNV-KLYYDKVTRTTHNTPGVETRIPGWGNPEVVEWIDPTKNSAGAYFKDIANELV-KLGYIRKQNIHGAPYDFRKAPNENQQFFIDLKQLVEDSYEANNQSAVTFISHSMGSLMTLVFLQEQTLQWKAKYVKRMISLAGVWAGSFKAVKVFAMGDDLDSFALSAKILKAEQITHPSTAWLLPSP-LFWKPSEVLAMTPSRNYTMAQLEEFFKDLDYMTGWEMRKDTIRYNRNFDPPNV--ELHCLYGEGIDTVERLQYKKSDISGETPKLIMGLGDGTVNQRSLRACKYWAGYSKAPINTLALQNVDHLHILSNPD-VLKYIRTVMQQP 421          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Fly
Match: CG18858 (gene:FBgn0042175 transcript:FBtr0081364)

HSP 1 Score: 199.519 bits (506), Expect = 1.385e-58
Identity = 133/383 (34.73%), Postives = 206/383 (53.79%), Query Frame = 3
Query:  195 SPIILIPGDGGSRAYS-----NVDYRIFTTK---VLVWVNFEYMVFPSL---LRNVFKLEYNTTNHKTSNMKGSDVFFPGWGDTETIEELDEKLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFRKAPNENQKMLDDLKILIEDTYRKSGNERVVIXXXXXXXXXXXXFFKQMTMSWKKQYIRAFLSVSGPLGGAVKAVTLETSGESLGS-PRSPIYFREMQRSFPSTSFLLPKPEIFGK--EPFIITPTRNYSSYDYEDLFKDMSMPYGSTMYNDTKNLVDGTETPEGIDELYCIHSYGLPTTKQLTFKA--FPDGQPQFTTGDGDYTVNIQSLKICEKWKN-----VNYFTIKGADHMQIVSTPEFMLKLKQILYRQP 1280
            SP+I +PGDGGS+  +     N  Y I         +W++ E +V P +   + NV KL Y+     T N  G +   PGWG+ E +E +D   +    YF ++ + LV    Y+R + + GAPYDFRKAPNENQ+   DLK L+ED+Y  +    V  + HS+GSL +L F ++ T+ WK +Y++  +S++G   G+ KAV +   G+ L S   S    +  Q + PST++LLP P +F K  E   +TP+RNY+    E+ FKD+    G  M  DT       + P    EL+C++  G+ T ++L +K        P+   G GD TVN +SL+ C+ W       +N   ++  DH+ I+S P+ +LK  + + +QP
Sbjct:   45 SPVIFVPGDGGSQMDARLNKPNSPYLICQKTHDWYNLWLDLEQLVIPMVYCWIDNV-KLYYDKVTRTTHNTPGVETRIPGWGNPEVVEWIDPTKNSAGAYFKDIANELV-KLGYIRKQNIHGAPYDFRKAPNENQQFFIDLKQLVEDSYEANNQSAVTFISHSMGSLMTLVFLQEQTLQWKAKYVKRMISLAGVWAGSFKAVKVFAMGDDLDSFALSAKILKAEQITHPSTAWLLPSP-LFWKPSEVLAMTPSRNYTMAQLEEFFKDLDYMTGWEMRKDTIRYNRNFDPPNV--ELHCLYGEGIDTVERLQYKKSDISGETPKLIMGLGDGTVNQRSLRACKYWAGYSKAPINTLALQNVDHLHILSNPD-VLKYIRTVMQQP 421          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Zebrafish
Match: lcat (lecithin-cholesterol acyltransferase [Source:ZFIN;Acc:ZDB-GENE-010716-3])

HSP 1 Score: 194.512 bits (493), Expect = 1.721e-56
Identity = 145/394 (36.80%), Postives = 219/394 (55.58%), Query Frame = 3
Query:  171 PRNDSKIPSPIILIPGDGGSRAYSNVD---------YRIFTTKVLVWVNFEYMVFP----SLLRNVFKLEYNTTNHKTSNMKGSDVFFPGWGDTETIEELDEKLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFRKAPNENQKMLDDLKILIEDTYRKSGNERVVIXXXXXXXXXXXXFFKQMTMSWKKQYIRAFLSVSGPLGGAVKAVTLETSGESLGSP-RSPIYFREMQRSFPSTSFLLPKPEIFGKE-PFIITPTRNYSSYDYEDLFKDMSMPYGSTMYNDTKNLVDGTETPEGIDELYCIHSYGLPTTKQLTF-KAFPDGQP-QFTTGDGDYTVNIQSLKICEKW-----KNVNYFTIKGADHMQIVSTPEFMLKLKQIL---YRQ 1277
            PR  +    P+I++PG+ G+R  + +D         Y+       +W++   M  P      + N+ ++ YN T  KTSN  G DV  PG+G T  IE LD  L+  T YF  +V +LV    YVRN+TVRGAPYD+R APNE ++    LK L+E+ + +   + V +LGHS+GS Y LYF  Q T  WK  YI+ F+S+  P GGAVK + +  SGE+ G P  S I  RE QR   +  +++P  E + K+  FI TP  NY++ DY   FKD++   G  M++DT+NL  G   P G+ E+YC++  GLPT     + + FP+  P      DGD TV+ +S+ +C++W     + V+    +G  H+ +V   + +  +++IL   YR+
Sbjct:   40 PRVINNSTPPLIIVPGNLGNRLEAKIDKPTLVHWMCYKKSEDWFPLWIDLN-MFMPIGVDCWIDNI-RIVYNRTTRKTSNAPGVDVRVPGFGQTHPIEFLD--LNKLTGYFHTMVQHLV-SIGYVRNETVRGAPYDWRIAPNEQEEYFSRLKNLVEEMHDEY-KQPVYLLGHSMGSNYILYFLNQQTQDWKDHYIKGFISLGAPWGGAVKPLRVLASGENDGIPFVSNIKIREEQRMTTTNPWMIPSEETWPKDHTFISTPFFNYTNQDYMQFFKDINFEDGWYMWDDTRNLTAGLPAP-GV-EVYCLYGVGLPTPVTYIYDEQFPNADPIDILYDDGDDTVDSRSMSLCKRWIGKQEQAVHVTEFRGMPHLDMVFNHKSLTTVQRILEGTYRE 425          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Zebrafish
Match: pla2g15 (phospholipase A2, group XV [Source:ZFIN;Acc:ZDB-GENE-030131-6948])

HSP 1 Score: 194.897 bits (494), Expect = 3.126e-56
Identity = 128/385 (33.25%), Postives = 210/385 (54.55%), Query Frame = 3
Query:  171 PRNDSKIPSPIILIPGDGGSRAYSNVD---------YRIFTTKVLVWVNFEYMVFPSL--LRNVFKLEYNTTNHKTSNMKGSDVFFPGWGDTETIEELDEKLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFRKAPNENQKMLDDLKILIEDTYRKSGNERVVIXXXXXXXXXXXXFFKQMTMSWKKQYIRAFLSVSGPLGGAVKAVTLETSGESLGSPR-SPIYFREMQRSFPSTSFLLPKPEIFGKEPFII-TPTRNYSSYDYEDLFKDMSMPYGSTMYNDTKNLVDGTETPEGIDELYCIHSYGLPTTKQLTFKAFPDGQPQFTTGDGDYTVNIQSLKICEKWKN-----VNYFTIKGADHMQIVSTPEFMLKLKQILY 1271
            P     +  P++LIPGD G++  + +D         Y+       +W+N E +V  ++    +  +L YN TNH +    G D+  PG+G+T ++E LD        YF  +V +LV D  Y RN  VRGAPYD+RKAPNEN++    L+ +IE+   K+G   VV++ HS+G++Y+LYF      +WK +YI+A++S+  P  G  K + +  +G++   P  SP+  R  QR+  ST++LLP    + K+  ++ TP   Y+  DY+  FKD+    G  M  DT+ LV   + P G+  ++C++  G+PT +   +  FPD  P    GDGD TVN+ S   C++WK      V +  + G +H+ ++     +  +K++L+
Sbjct:   87 PGKVCSVRPPVVLIPGDLGNQLEAKLDKPSVVHYICYKKTEDYFTLWLNLELLVPVAIDCWIDNMRLLYNRTNHLSEPPPGVDIRVPGFGETYSLEYLDPSKRSVGMYFFTIVQSLV-DWGYTRNDDVRGAPYDWRKAPNENKEYFLRLQQMIEEMAHKAGGP-VVLIAHSMGNMYTLYFLNHQPQAWKDRYIKAYVSLGPPWAGVAKTLRVMATGDNNRIPVISPLKIRTQQRTAVSTTWLLPYAHTWPKDMVLVYTPNTTYTVQDYQRFFKDIDYEDGWAMRQDTEPLVSALQ-PPGV-PVHCLYGTGIPTPQGYNYTNFPDTDPAVINGDGDGTVNLISAIQCKRWKGQQKQAVEWLELPGNEHVAMLLNSTTVDYIKKVLF 467          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Xenopus
Match: fam53c (family with sequence similarity 53 member C [Source:Xenbase;Acc:XB-GENE-988933])

HSP 1 Score: 189.119 bits (479), Expect = 2.734e-54
Identity = 151/424 (35.61%), Postives = 224/424 (52.83%), Query Frame = 3
Query:  114 WIFIQLLFIVANFQAESINPRNDSKIPS------------PIILIPGDGGSRAYSNVD---------YRIFTTKVLVWVNFEYMVFP----SLLRNVFKLEYNTTNHKTSNMKGSDVFFPGWGDTETIEELDE-KLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFRKAPNENQKMLDDLKILIEDTYRKSGNERVVIXXXXXXXXXXXXFFKQMTMSWKKQYIRAFLSVSGPLGGAVKAVTLETSGESLGSPR-SPIYFREMQRSFPSTSFLLPK----PEIFGKEPFIITPTRNYSSYDYEDLFKDMSMPYGSTMYNDTKNLVDGTETPEGIDELYCIHSYGLPTTKQLTF-KAFPDGQPQFTT--GDGDYTVNIQSLKICEKW-----KNVNYFTIKGADHMQIVSTPEFMLKLKQIL 1268
            W  I LL I+  + A ++   N    PS            P++L+PG  G++  + VD         YR       +W+N   M  P      + N+ ++ YN T    SN  G DV  PG+G T ++E LD+ KL     YF  LV NLV +  YVR++TVR APYD+R APN  ++  + LK LIE+   K  NE V I+GHSLG+LY LYF       WK +Y++ F+S+  P GGAVK + +  SG++ G P  S I  RE QR   +  ++LP     PE      FI TP+RNY+  +Y  LF D+    G  M+ DTK L++G   P G+ E+YCI+  G+PT +   + + FP+ +P       DGD TV+ +S+++C++W     + V+   + G  H+ +V + E +  +  IL
Sbjct:   10 WTMILLLCIIQFYSARALWLLNVLFPPSNTPEASLNNSTPPVVLVPGCFGNQLEAKVDKEDVVNWMCYRKTDDYFTIWLNLN-MFLPLGIDCWIDNI-RVVYNKTTRMASNAPGVDVHVPGFGKTYSVEYLDKSKL---AGYFHTLVQNLV-NNGYVRDQTVRAAPYDWRIAPNGQKEYFEKLKSLIEEMSNKY-NESVFIIGHSLGNLYLLYFLNHQPQEWKDKYVKGFISLGAPWGGAVKPLLVLMSGDNHGIPMVSNIKIREEQRMTTTNPWMLPTNLGWPE---SHVFISTPSRNYTYKNYRKLFHDIGFEDGWYMWEDTKGLLEGLP-PPGV-EVYCIYGTGIPTPETYIYGEGFPN-EPAIDIKYSDGDDTVHTRSMELCKRWISQQKQKVHIHELPGIQHLNMVFSNETLTLINDIL 420          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Xenopus
Match: PLA2G15 (phospholipase A2 group XV [Source:NCBI gene;Acc:100124780])

HSP 1 Score: 178.718 bits (452), Expect = 2.320e-50
Identity = 126/377 (33.42%), Postives = 206/377 (54.64%), Query Frame = 3
Query:  198 PIILIPGDGGSRAYSNVD------------YRIFTTKVLVWVNFEYMVFPSLLRNVFKLEYNTTNHKTSNMKGSDVFFPGWGDTETIEELDEKLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFRKAPNENQKMLDDLKILIEDTYRKSGNERVVIXXXXXXXXXXXXFFKQMTMSWKKQYIRAFLSVSGPLGGAVKAVTLETSGESLGSPR-SPIYFREMQRSFPSTSFLLPKPEIFGKEP-FIITPTRNYSSYDYEDLFKDMSMPYGSTMYNDTKNLVDGTETPEGIDELYCIHSYGLPTTKQLTFKAFPDGQPQFTTGDGDYTVNIQSLKICEKWKN-----VNYFTIKGADHMQIVSTPEFMLKLKQILY 1271
            P++L+PGD G++  + +D               + T  L       +V    + N+ +L YN T+  T+  +G D+  PG+G T ++E LD       +YF  LV +LV D  Y R++ VRGAPYD+RKAPNEN      L+ L+E  + +S    VV++ HS+G+LY+LYF  Q T  WK +YI +F+++  P GG  K + +  SG++   P  S +  R+ QRS  ST++LLP    + +E  F+ TP +NY+  DY   ++D+    G  M  +T+ L+  +  P G+ E++C++  G+ T     + +FPD  P    G GD TVN++S   C KW+N     V+   + G +H+ ++S    +  +K++L+
Sbjct:   60 PVVLVPGDLGNQLEAKLDKPAVVHYMCSKKTNYYFTLWLNLELLLPVVIDCWIDNI-RLVYNKTSKTTAPPEGVDIRVPGFGQTYSLEFLDPSKRSVGSYFYTLVQSLV-DWGYTRDENVRGAPYDWRKAPNENSDYFVALRKLVESMF-ESYQSPVVLVAHSMGNLYTLYFLNQQTQDWKDKYIHSFVALGAPWGGVSKTLHVLASGDNNRIPVISSLRIRDQQRSAVSTNWLLPYNNTWPQEKVFVRTPNKNYTIKDYRVFYEDIGFQDGWEMRQETEGLIS-SLNPPGV-EVHCLYGTGVDTPDSFLYDSFPDKDPTTVYGGGDGTVNLESALQCGKWRNQQRQKVSLVELPGNEHIAMLSNISTISYVKKVLF 431          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Mouse
Match: Pla2g15 (phospholipase A2, group XV [Source:MGI Symbol;Acc:MGI:2178076])

HSP 1 Score: 197.208 bits (500), Expect = 1.355e-57
Identity = 130/376 (34.57%), Postives = 212/376 (56.38%), Query Frame = 3
Query:  198 PIILIPGDGGSRAYSNVD-----YRIFTTKVLVWVNFEY-------MVFPSLLRNVFKLEYNTTNHKTSNMKGSDVFFPGWGDTETIEELDEKLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFRKAPNENQKMLDDLKILIEDTYRKSGNERVVIXXXXXXXXXXXXFFKQMTMSWKKQYIRAFLSVSGPLGGAVKAVTLETSGESLGSPR-SPIYFREMQRSFPSTSFLLPKPEIFGKEP-FIITPTRNYSSYDYEDLFKDMSMPYGSTMYNDTKNLVDGTETPEGIDELYCIHSYGLPTTKQLTFKAFPDGQPQFTTGDGDYTVNIQSLKICEKWKN-----VNYFTIKGADHMQIVSTPEFMLKLKQIL 1268
            P++L+PGD G++  + +D     + + + K   +            ++    + N+ +L YN T+  T    G DV  PG+G+T ++E LD       +YF  +V++LV    Y R + VRGAPYD+R+APNEN      L+ +IE+ Y+  G   VV++ HS+G++Y LYF ++    WK +YI AF+S+  P GG  K + +  SG++   P   P+  RE QRS  STS+LLP    +  E  F+ TPT NY+  DY   F+D+    G  M  DT+ LV+   TP G+ EL+C++  G+PT     +++FPD  P+   GDGD TVN++S+  C+ W++     V+   + G++H+++++    +  LK++L
Sbjct:   39 PVVLVPGDLGNQLEAKLDKPKVVHYLCSKKTDSYFTLWLNLELLLPVIIDCWIDNI-RLVYNRTSRATQFPDGVDVRVPGFGETFSMEFLDPSKRNVGSYFYTMVESLV-GWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQMYGGP-VVLVAHSMGNVYMLYFLQRQPQVWKDKYIHAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTTNYTLRDYHRFFRDIGFEDGWFMRQDTEGLVEAM-TPPGV-ELHCLYGTGVPTPNSFYYESFPDRDPKICFGDGDGTVNLESVLQCQAWQSRQEHRVSLQELPGSEHIEMLANATTLAYLKRVL 409          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Mouse
Match: Lcat (lecithin cholesterol acyltransferase [Source:MGI Symbol;Acc:MGI:96755])

HSP 1 Score: 162.925 bits (411), Expect = 1.837e-44
Identity = 115/380 (30.26%), Postives = 194/380 (51.05%), Query Frame = 3
Query:  198 PIILIPGDGGSRAYSNVD---------YRIFTTKVLVWVNFEYMVFPSLLRNVF----KLEYNTTNHKTSNMKGSDVFFPGWGDTETIEELDE-KLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFRKAPNENQKMLDDLKILIEDTYRKSGNERVVIXXXXXXXXXXXXFFKQMTMSWKKQYIRAFLSVSGPLGGAVKAVTLETSGESLGSP-RSPIYFREMQRSFPSTSFLLPKPEIFGKEP-FIITPTRNYSSYDYEDLFKDMSMPYGSTMYNDTKNLVDGTETPEGIDELYCIHSYGLPTTKQLTF-KAFPDGQPQFTT-GDGDYTVNIQSLKICEKWKN-----VNYFTIKGADHMQIVSTPEFMLKLKQIL 1268
            P+IL+PG  G+R  + +D         YR       +W++F   +F  L  + +    ++ YN ++ + SN  G  +  PG+G TE++E +D+ KL     Y   LV NLV +  YVR++TVR APYD+R AP++  +    L  L+E+ Y   G    +I           +  +Q   SWK  +I  F+S+  P GG++KA+ +  SG++ G P  S I  +E QR   ++ ++LP P ++ ++  FI TP  NY+  D+E  F D+    G  M+  +++L++    P G+ E+YC++  G PT     +   FP   P      DGD TV  +S ++C +W+      V+   +   DH+ +V + + +  +  IL
Sbjct:   48 PVILVPGCLGNRLEAKLDKPDVVNWMCYRKTEDFFTIWLDFN--LFLPLGVDCWIDNTRIVYNHSSGRVSNAPGVQIRVPGFGKTESVEYVDDNKL---AGYLHTLVQNLV-NNGYVRDETVRAAPYDWRLAPHQQDEYYKKLAGLVEEMYAAYGKPVFLIGHSLGCLHVLHFLLRQ-PQSWKDHFIDGFISLGAPWGGSIKAMRILASGDNQGIPILSNIKLKEEQRITTTSPWMLPAPHVWPEDHVFISTPNFNYTVQDFERFFTDLHFEEGWHMFLQSRDLLERLPAP-GV-EVYCLYGVGRPTPHTYIYDHNFPYKDPVAALYEDGDDTVATRSTELCGQWQGRQSQPVHLLPMNETDHLNMVFSNKTLEHINAIL 418          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Mouse
Match: Pla2g15 (phospholipase A2, group XV [Source:MGI Symbol;Acc:MGI:2178076])

HSP 1 Score: 60.4622 bits (145), Expect = 6.539e-10
Identity = 41/137 (29.93%), Postives = 70/137 (51.09%), Query Frame = 3
Query:  198 PIILIPGDGGSRAYSNVD-----YRIFTTKVLVWVNFEY-------MVFPSLLRNVFKLEYNTTNHKTSNMKGSDVFFPGWGDTETIEELDEKLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFRKAPNENQKM 572
            P++L+PGD G++  + +D     + + + K   +            ++    + N+ +L YN T+  T    G DV  PG+G+T ++E LD       +YF  +V++LV    Y R + VRGAPYD+R+AP     +
Sbjct:   39 PVVLVPGDLGNQLEAKLDKPKVVHYLCSKKTDSYFTLWLNLELLLPVIIDCWIDNI-RLVYNRTSRATQFPDGVDVRVPGFGETFSMEFLDPSKRNVGSYFYTMVESLV-GWGYTRGEDVRGAPYDWRRAPTAATSL 173          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. UniProt/SwissProt
Match: sp|Q8NCC3|PAG15_HUMAN (Phospholipase A2 group XV OS=Homo sapiens OX=9606 GN=PLA2G15 PE=1 SV=2)

HSP 1 Score: 202.986 bits (515), Expect = 5.630e-59
Identity = 133/376 (35.37%), Postives = 216/376 (57.45%), Query Frame = 3
Query:  198 PIILIPGDGGSRAYSNVD-----YRIFTTKV----LVWVNFEYM---VFPSLLRNVFKLEYNTTNHKTSNMKGSDVFFPGWGDTETIEELDEKLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFRKAPNENQKMLDDLKILIEDTYRKSGNERVVIXXXXXXXXXXXXFFKQMTMSWKKQYIRAFLSVSGPLGGAVKAVTLETSGESLGSPR-SPIYFREMQRSFPSTSFLLPKPEIFGKEP-FIITPTRNYSSYDYEDLFKDMSMPYGSTMYNDTKNLVDGTETPEGIDELYCIHSYGLPTTKQLTFKAFPDGQPQFTTGDGDYTVNIQSLKICEKWKN-----VNYFTIKGADHMQIVSTPEFMLKLKQIL 1268
            P++L+PGD G++  + +D     + + + K      +W+N E +   +    + N+ +L YN T+  T    G DV  PG+G T ++E LD       +YF  +V++LV    Y R + VRGAPYD+R+APNEN      L+ +IE+ Y+  G   VV++ HS+G++Y+LYF ++   +WK +YIRAF+S+  P GG  K + +  SG++   P   P+  RE QRS  STS+LLP    +  E  F+ TPT NY+  DY   F+D+    G  M  DT+ LV+ T  P G+ +L+C++  G+PT     +++FPD  P+   GDGD TVN++S   C+ W++     V    + G++H+++++    +  LK++L
Sbjct:   39 PVVLVPGDLGNQLEAKLDKPTVVHYLCSKKTESYFTIWLNLELLLPVIIDCWIDNI-RLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLV-GWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGP-VVLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFEDGWLMRQDTEGLVEAT-MPPGV-QLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVL 409          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. UniProt/SwissProt
Match: sp|Q675A5|PAG15_RAT (Phospholipase A2 group XV OS=Rattus norvegicus OX=10116 GN=Pla2g15 PE=1 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 5.630e-57
Identity = 131/380 (34.47%), Postives = 212/380 (55.79%), Query Frame = 3
Query:  198 PIILIPGDGGSRAYSNVD------------YRIFTTKVLVWVNFEYMVFPSLLRNVFKLEYNTTNHKTSNMKGSDVFFPGWGDTETIEELDEKLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFRKAPNENQKMLDDLKILIEDTYRKSGNERVVIXXXXXXXXXXXXFFKQMTMSWKKQYIRAFLSVSGPLGGAVKAVTLETSGESLGSPR-SPIYFREMQRSFPSTSFLLPKPEIFGKEP-FIITPTRNYSSYDYEDLFKDMSMPYGSTMYNDTKNLVDGTETPEGIDELYCIHSYGLPTTKQLTFKAFPDGQPQFTTGDGDYTVNIQSLKICEKWKN-----VNYFTIKGADHMQIVSTPEFMLKLKQILYRQP 1280
            P++L+PGD G++  + +D               + T  L       ++    + N+ +L YN T+  T    G DV  PG+G+T ++E LD       +YF  +V++LV    Y R + VRGAPYD+R+APNEN      L+ +IE+ Y+  G   VV++ HS+G++Y LYF ++   +WK +YI+AF+S+  P GG  K + +  SG++   P   P+  RE QRS  STS+LLP    +  E  F+ TPT NY+  DY   F+D+    G  M  DT+ LV+    P G+ EL+C++  G+PT     ++ FPD  P+   GDGD TVN++S+  C+ W++     V+   + G++H+++++    +  LK++L  +P
Sbjct:   39 PVVLVPGDLGNQLEAKLDKPKVVHYLCSKRTDSYFTLWLNLELLLPVIIDCWIDNI-RLVYNRTSRTTQFPDGVDVRVPGFGETFSLEFLDPSKRNVGSYFYTMVESLV-GWGYTRGEDVRGAPYDWRRAPNENGPYFLALQEMIEEMYQMYGGP-VVLVAHSMGNMYMLYFLQRQPQAWKDKYIQAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTANYTLRDYHRFFQDIGFEDGWFMRQDTQGLVEAL-VPPGV-ELHCLYGTGVPTPNSFYYENFPDRDPKICFGDGDGTVNLESVLQCQAWQSRQEHKVSLQELPGSEHIEMLANATTLAYLKRVLLEEP 413          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. UniProt/SwissProt
Match: sp|Q6XPZ3|PAG15_CANLF (Phospholipase A2 group XV OS=Canis lupus familiaris OX=9615 GN=PLA2G15 PE=1 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 6.680e-57
Identity = 129/376 (34.31%), Postives = 209/376 (55.59%), Query Frame = 3
Query:  198 PIILIPGDGGSRAYSNVDYRIFTTKVLVWVNFEY------------MVFPSLLRNVFKLEYNTTNHKTSNMKGSDVFFPGWGDTETIEELDEKLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFRKAPNENQKMLDDLKILIEDTYRKSGNERVVIXXXXXXXXXXXXFFKQMTMSWKKQYIRAFLSVSGPLGGAVKAVTLETSGESLGSPR-SPIYFREMQRSFPSTSFLLPKPEIFGKEP-FIITPTRNYSSYDYEDLFKDMSMPYGSTMYNDTKNLVDGTETPEGIDELYCIHSYGLPTTKQLTFKAFPDGQPQFTTGDGDYTVNIQSLKICEKWKN-----VNYFTIKGADHMQIVSTPEFMLKLKQIL 1268
            P++L+PGD G++  + +D       +       Y            ++    + N+ +L YN T+  T    G DV  PG+G T ++E LD       +YF  +V++LV D  Y+R + VRGAPYD+R+APNEN      L+ +IE+ Y+  G   VV++ HS+G++Y+LYF ++   +WK +YI+AF+++  P GG  K + +  SG++   P   P+  RE QRS  STS+LLP    +  E  F+ TPT NY+  DY   F+D+    G  M  DT+ LV+    P G+  L+C++  G+PT     +++FPD  P+   GDGD TVN+QS   C+ W+      V+   + G++H+++++    +  LK++L
Sbjct:   35 PVVLVPGDLGNQLEAKLDKPTVVHYLCSKRTESYFTLWLNLELLLPVIIDCWIDNI-RLVYNRTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLV-DWGYIRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGP-VVLVAHSMGNMYTLYFLQRQPQAWKNKYIQAFVALGAPWGGVAKTLRVLASGDNNRIPVIRPLKIREQQRSAVSTSWLLPYNYTWSPEKIFVHTPTANYTLRDYHQFFQDIGFKDGWLMRQDTEGLVEAM-VPPGV-PLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLQSALQCQAWRGHQEHQVSLQALPGSEHIEMLANATTLAYLKRVL 405          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. UniProt/SwissProt
Match: sp|Q8VEB4|PAG15_MOUSE (Phospholipase A2 group XV OS=Mus musculus OX=10090 GN=Pla2g15 PE=1 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 9.480e-57
Identity = 130/376 (34.57%), Postives = 212/376 (56.38%), Query Frame = 3
Query:  198 PIILIPGDGGSRAYSNVD-----YRIFTTKVLVWVNFEY-------MVFPSLLRNVFKLEYNTTNHKTSNMKGSDVFFPGWGDTETIEELDEKLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFRKAPNENQKMLDDLKILIEDTYRKSGNERVVIXXXXXXXXXXXXFFKQMTMSWKKQYIRAFLSVSGPLGGAVKAVTLETSGESLGSPR-SPIYFREMQRSFPSTSFLLPKPEIFGKEP-FIITPTRNYSSYDYEDLFKDMSMPYGSTMYNDTKNLVDGTETPEGIDELYCIHSYGLPTTKQLTFKAFPDGQPQFTTGDGDYTVNIQSLKICEKWKN-----VNYFTIKGADHMQIVSTPEFMLKLKQIL 1268
            P++L+PGD G++  + +D     + + + K   +            ++    + N+ +L YN T+  T    G DV  PG+G+T ++E LD       +YF  +V++LV    Y R + VRGAPYD+R+APNEN      L+ +IE+ Y+  G   VV++ HS+G++Y LYF ++    WK +YI AF+S+  P GG  K + +  SG++   P   P+  RE QRS  STS+LLP    +  E  F+ TPT NY+  DY   F+D+    G  M  DT+ LV+   TP G+ EL+C++  G+PT     +++FPD  P+   GDGD TVN++S+  C+ W++     V+   + G++H+++++    +  LK++L
Sbjct:   39 PVVLVPGDLGNQLEAKLDKPKVVHYLCSKKTDSYFTLWLNLELLLPVIIDCWIDNI-RLVYNRTSRATQFPDGVDVRVPGFGETFSMEFLDPSKRNVGSYFYTMVESLV-GWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQMYGGP-VVLVAHSMGNVYMLYFLQRQPQVWKDKYIHAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTTNYTLRDYHRFFRDIGFEDGWFMRQDTEGLVEAM-TPPGV-ELHCLYGTGVPTPNSFYYESFPDRDPKICFGDGDGTVNLESVLQCQAWQSRQEHRVSLQELPGSEHIEMLANATTLAYLKRVL 409          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. UniProt/SwissProt
Match: sp|Q8WMP9|PAG15_BOVIN (Phospholipase A2 group XV OS=Bos taurus OX=9913 GN=PLA2G15 PE=1 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 3.456e-53
Identity = 130/377 (34.48%), Postives = 205/377 (54.38%), Query Frame = 3
Query:  198 PIILIPGDGGSRAYSNVDYRIFTTKVLVWVNFEY------------MVFPSLLRNVFKLEYNTTNHKTSNMKGSDVFFPGWGDTETIEELDEKLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFRKAPNENQKMLDDLKILIEDTYRKSGNERVVIXXXXXXXXXXXXFFKQMTMSWKKQYIRAFLSVSGPLGGAVKAVTLETSGESLGSP--RSPIYFREMQRSFPSTSFLLPKPEIFG-KEPFIITPTRNYSSYDYEDLFKDMSMPYGSTMYNDTKNLVDGTETPEGIDELYCIHSYGLPTTKQLTFKAFPDGQPQFTTGDGDYTVNIQSLKICEKWKN-----VNYFTIKGADHMQIVSTPEFMLKLKQIL 1268
            P++L+PGD G++  + +D       V       Y            ++    + NV +L YN T+H T   +G DV  PG+GDT ++E LD       +Y   +V++LV    Y R K VRGAPYD+R+APNEN      L+ +IE+ Y+  G   VV++ HS+G++Y LYF +     WK +YIRAF+++  P GG  K + +  SG++   P  RS +  R  QRS  ST++LLP    +  ++ F+ TP  NY+  DY   F+D+    G +M  DT+ LV+ T  P G+  L+C++  G+PT +   +++FPD  P+   G GD TVN+QS   C  W+      V+   + G +H+ +++    +  LK++L
Sbjct:   34 PVVLVPGDMGNQLEAKLDKPSVVHYVCSKRTDHYFTLWLNLELLLPVIIDCWIDNV-RLIYNQTSHTTQFPEGVDVRVPGFGDTFSMEFLDPSKSSVGSYLHTMVESLV-SWGYERGKDVRGAPYDWRRAPNENGPYFLALRKMIEEMYQLYGGP-VVLVAHSMGNMYMLYFLQHQPQDWKDKYIRAFVALGPPWGGVPKTLRVLASGDNNRIPVIRS-LKIRAQQRSAVSTTWLLPYSYTWSPQKVFVRTPKANYTLQDYRQFFQDIGFKDGWSMRQDTEGLVEAT-VPPGV-RLHCLYGTGVPTPESFDYESFPDRDPKIHYGTGDGTVNLQSALHCHTWRGLQKQEVSLQALPGNEHIAMLANTTTLAYLKRVL 404          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. TrEMBL
Match: A0A4S2LKD5 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006596 PE=4 SV=1)

HSP 1 Score: 323.168 bits (827), Expect = 4.527e-103
Identity = 173/388 (44.59%), Postives = 245/388 (63.14%), Query Frame = 3
Query:  129 LLFIVANFQAESINPRNDSKIPSPIILIPGDGGSRAYSNVDYRIFTTKVLVWVNFEYMVFPSLLRNVFKLEYNTTNHKTSNMKGSDVFFPGWGDTETIEELDEKLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFRKAPNENQKMLDDLKILIEDTYRKSGNERVVIXXXXXXXXXXXXFFKQMTMSWKKQYIRAFLSVSGPLGGAVKAVTLETSGESLGS-PRSPIYFREMQRSFPSTSFLLPKPEIF-GKEPFIITPTRNYSSYDYEDLFKDMSMPYGSTMYNDTKNLVDGTETPEGIDELYCIHSYGLPTTKQLTF-------KAFPDGQPQFTTGDGDYTVNIQSLKICEKWKNVNYFTIKGADHMQIVSTPEFMLKLKQI 1265
            LLF+V       ++    ++   PIIL+PGDGGS+AY N          L+WVN  Y   P  L    +++Y+    + S+    DV FPGWGDT +IE LD   H  T Y  +L+++L  D ++V NKT+RG P+DFRKAPNEN   + DL++LIE+TY  +G+  VV+LGHSLG++YSL F    + SWK++YI+ FLSVSGP GG+VKA  +E SG++ G   RSP+ FR++QRS PST+FL+P P ++   EP IITP  NYS++DY+  F D+  P G  ++ +TK  VDG E P GID+LYCIH   + TT Q+ +       K FPD  P   TGDGD TV+++SL++C  W    Y T++GA+H++IV     +  + ++
Sbjct:    3 LLFVVNLCFLIILHATEAAETQYPIILVPGDGGSQAYCNPKGN--GGSFLLWVNLRYFFVPGTLYEYIRIKYDPKTGEVSDSDLCDVTFPGWGDTWSIENLDTSRHSGTVYLEHLINSLRQDPFFVSNKTLRGTPFDFRKAPNENPDFVRDLRVLIEETYSVAGSRPVVLLGHSLGAVYSLAFLNAQSDSWKRKYIKTFLSVSGPYGGSVKAFKIEASGDNFGVIVRSPLSFRQIQRSLPSTAFLIPDPRLWPPSEPIIITPKVNYSAHDYQKFFDDIGFPQGYELFKNTKPSVDGFEGPTGIDDLYCIHGTNVGTTYQMVYPEPSFFHKGFPDEYPTLLTGDGDGTVHLRSLQLCRFWHGAKYITLEGAEHLRIVGDDRLIKLIHEV 388          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. TrEMBL
Match: A0A074Z6F7 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_09225 PE=4 SV=1)

HSP 1 Score: 324.324 bits (830), Expect = 1.313e-102
Identity = 173/366 (47.27%), Postives = 235/366 (64.21%), Query Frame = 3
Query:  195 SPIILIPGDGGSRAYSNVDYRIFTTKVLVWVNFEYMVFPSLLRNVFKLEYNTTNHKTSNMKGSDVFFPGWGDTETIEELDEKLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFRKAPNENQKMLDDLKILIEDTYRKSGNERVVIXXXXXXXXXXXXFFKQMTMSWKKQYIRAFLSVSGPLGGAVKAVTLETSGESLGS-PRSPIYFREMQRSFPSTSFLLPKPEIF-GKEPFIITPTRNYSSYDYEDLFKDMSMPYGSTMYNDTKNLVDGTETPEGIDELYCIHSYGLPTTKQLTF-------KAFPDGQPQFTTGDGDYTVNIQSLKICEKWKNVNYFTIKGADHMQIVSTPEFMLKLKQI 1265
            SPI+L+PGDGGS+AY +    +     L+WVN  Y + P  L   F + Y+    +  +    +V FPGWGDT +IE LD   H  T YF +LV +L  D +YV N+T+RG P+DFR+APNEN      L++LIE+TY  +G+ RVV+LGHSLGSLY L F    +  WK++YI+AFLSVSGPLGG+VKA+ LE SG++ G   RSP+ FRE+QRS PST+FL+P P ++   EP IITP  NYS++DY+ LF D++ P G     +TK  VDG   P G+DE+YCIH   + TT QL +       K FPD  P   TGDGD TV+++SL++C  W    Y  ++GA+H+ IV    F+  + +I
Sbjct:   66 SPIVLVPGDGGSQAYCSPTGSV--ESFLLWVNLRYFITPGTLAQYFSIIYDPRTGEIHDSDLCNVTFPGWGDTWSIENLDTYKHSGTVYFEHLVTSLRQDPFYVSNRTLRGTPFDFRRAPNENPDFQQRLRLLIEETYIIAGSRRVVLLGHSLGSLYCLAFLHAQSNDWKRKYIKAFLSVSGPLGGSVKALKLEVSGDNFGVLIRSPLSFREVQRSLPSTAFLMPDPRLWPPSEPIIITPKLNYSAHDYQKLFSDINFPQGYAFLQNTKPSVDGFMGPTGLDEVYCIHGSKVSTTYQLVYPEPSFFHKGFPDEYPTLITGDGDGTVHLRSLQLCRLWPGAKYIVLEGAEHLHIVGDERFLKLIHEI 429          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. TrEMBL
Match: A0A3Q0KSH1 (Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 315.464 bits (807), Expect = 5.287e-100
Identity = 169/397 (42.57%), Postives = 248/397 (62.47%), Query Frame = 3
Query:  114 WIFIQLLFI---VANFQAESINPRNDSKIPSPIILIPGDGGSRAYSNVDYRIFTTKVLVWVNFEYMVFPSLLRNVFKLEYNTTNHKTSNMKGSDVFFPGWGDTETIEELDEKLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFRKAPNENQKMLDDLKILIEDTYRKSGNERVVIXXXXXXXXXXXXFFKQMTMSWKKQYIRAFLSVSGPLGGAVKAVTLETSGESLGS-PRSPIYFREMQRSFPSTSFLLPKPEIFG-KEPFIITPTRNYSSYDYEDLFKDMSMPYGSTMYNDTKNLVDGTETPEGIDELYCIHSYGLPTTKQLTFK-------AFPDGQPQFTTGDGDYTVNIQSLKICEKWKNVNYFTIKGADHMQIVSTPEFMLKLKQIL 1268
            W  I   F    VA+ Q+E            PI++IPGDGG +AYS +     +   LVW++  Y + P  L   F L Y+    K+ +   ++V+FPGWG+T +IE LD   H +T Y   ++++L +D ++V N T+RGAP+DFRKAPNEN+   D L  LIE+TY+  GN  VV+LGHSLG+ Y +YF K M  SWK  YI+ F+S+S PLGG+VKA+ +E SG++ G   RSP+ FR +QR+ PS +FLLP   ++   EP IITPT NYS++DYE  F+D++   G  M +D+K+++D  E P  IDE+YCIH   L TT ++ +         FPD  P    G+GD TV+++SL++C++W  + YF + GA+H+ I+  P F+  ++QI+
Sbjct:    6 WTCIICFFFSIHVAHIQSEKY----------PIVIIPGDGGCQAYSKLKNST-SPPFLVWIDLRYFLEPGKLNQYFGLVYDPVTRKSRDPDIAEVYFPGWGETWSIENLDSYKHSRTEYCGPMIESLRLDPFFVSNWTIRGAPFDFRKAPNENEGFNDKLMRLIEETYQNGGNRSVVLLGHSLGAKYGMYFLKSMKKSWKNTYIKTFVSLSAPLGGSVKALKIEASGDNFGVFLRSPLSFRPVQRTLPSLAFLLPDSRLWSPTEPLIITPTTNYSAHDYERFFRDVNYSIGFQMMSDSKSIIDTLEKPSDIDEIYCIHGANLSTTDKMIYSPPNFFHGGFPDQVPTLIPGNGDGTVSLRSLEVCKRWPGIKYFVLPGAEHVNIMGDPRFIDIIRQIV 391          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. TrEMBL
Match: A0A3R7ERF1 (Group XV phospholipase A2 OS=Clonorchis sinensis OX=79923 GN=PLA2G15 PE=4 SV=1)

HSP 1 Score: 321.627 bits (823), Expect = 2.829e-99
Identity = 171/369 (46.34%), Postives = 237/369 (64.23%), Query Frame = 3
Query:  198 PIILIPGDGGSRAYSNVDYRIFTTKVLVWVNFEYMVFPSLLRNVFKLEYNTTNHKTSNMKGSDVFFPGWGDTETIEELDEKLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFRKAPNENQKMLDDLKILIEDTYRKSGNERVVIXXXXXXXXXXXXFFKQMTMSWKKQYIRAFLSVSGPLGGAVKAVTLETSGESLG-SPRSPIYFREMQRSFPSTSFLLPKPEIFG-KEPFIITPTRNYSSYDYEDLFKDMSMPYGSTMYNDTKNLVDGTETPEGIDELYCIHSYGLPTTKQLTF-------KAFPDGQPQFTTGDGDYTVNIQSLKICEKWKNVNYFTIKGADHMQIVSTPEFMLKLKQILYRQ 1277
            PIIL+PGDGGS+AY N      T   L+WVN  Y   P  L    +++Y+    + S+    DV FPGWGDT +IE LD   H  T Y  +L+++L  D +YV NKT+RG P+DFRKAPNEN   L DL++LIE+TY  +G+ RVV+LGHSLG++Y L F    + +WK++YI+ FLSVSGP GG+VKA  +E SG++ G   RS I FR +QRS PST+FLLP P ++   EP IITP  NYS++DY+  F+D+  P G  ++ +TK  VDG E P GID+LYCIH   + TT Q+ +       K FPD  P    G+GD TV+++SL++C  W+   Y T++GA+H++IV     +  + ++   Q
Sbjct:  281 PIILVPGDGGSQAYCNPKGNGGT--FLIWVNLRYFFAPGTLYEYIRIKYDPKTGEVSDSDLCDVTFPGWGDTWSIENLDTYRHSGTVYLEHLINSLRQDPFYVSNKTLRGTPFDFRKAPNENPDFLRDLRLLIEETYSVTGSRRVVLLGHSLGAVYCLAFLNAQSDTWKRKYIKTFLSVSGPYGGSVKAFKIEASGDNFGFILRSSISFRPIQRSMPSTAFLLPDPRLWSPSEPIIITPKVNYSAHDYQKFFEDIGFPQGYELFKNTKPSVDGFEGPTGIDDLYCIHGTKVGTTYQMVYPERSFFHKGFPDQYPTLIPGEGDGTVHLRSLQLCRFWQGAKYITLEGAEHLRIVGDDRLIKLIHEVAGSQ 647          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. TrEMBL
Match: C1LE78 (1-O-acylceramide synthase OS=Schistosoma japonicum OX=6182 GN=EWB00_008274 PE=2 SV=1)

HSP 1 Score: 312.383 bits (799), Expect = 8.935e-99
Identity = 164/366 (44.81%), Postives = 232/366 (63.39%), Query Frame = 3
Query:  198 PIILIPGDGGSRAYSNVDYRIFTTKVLVWVNFEYMVFPSLLRNVFKLEYNTTNHKTSNMKGSDVFFPGWGDTETIEELDEKLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFRKAPNENQKMLDDLKILIEDTYRKSGNERVVIXXXXXXXXXXXXFFKQMTMSWKKQYIRAFLSVSGPLGGAVKAVTLETSGESLGS-PRSPIYFREMQRSFPSTSFLLPKPEIFG-KEPFIITPTRNYSSYDYEDLFKDMSMPYGSTMYNDTKNLVDGTETPEGIDELYCIHSYGLPTTKQLTF-------KAFPDGQPQFTTGDGDYTVNIQSLKICEKWKNVNYFTIKGADHMQIVSTPEFMLKLKQIL 1268
            P+++IPGDGG +AY  +     +   LVW++  Y + P  L   F L Y+     + N   SDV FPGWG+T +IE LD   H +T Y   ++D+L +D ++V N T+RGAP+DFRKAPNEN    D L  LIE+TYR  GN  VV+LGHSLG+ Y+++F K M  SWK  YI+ F+S+S PLGG+VKA+ +E SG++ G   RSP+ FR +QR+ PS +FLLP   ++   EP I+TPT NYS++DYE  F+D++   G  M  D+K ++D  E P  IDE+YCIH   L TT QL +         FPD  P    G+GD TV+++SL++C+ W  V Y  + GA+H+ I+  P F+  ++QI+
Sbjct:   30 PVVIIPGDGGCQAYCKLKNST-SPPFLVWIDLRYFLEPGKLSEYFGLIYDPITRTSRNPDNSDVLFPGWGETWSIENLDSYKHGRTEYCGPMIDSLRLDPFFVSNWTIRGAPFDFRKAPNENNDFNDKLMHLIEETYRNGGNRPVVLLGHSLGAKYAMHFLKSMKKSWKNMYIKTFVSLSAPLGGSVKALKIEASGDNFGVFLRSPLSFRPVQRTLPSLAFLLPDSRLWSPTEPIIMTPTTNYSAHDYERFFRDINYSIGFQMMLDSKPVIDTFEKPSDIDEIYCIHGANLSTTDQLIYSPANFFHSGFPDQVPTMVPGNGDGTVSLRSLEVCKHWSGVKYHILPGAEHVNIMGDPRFIDLIRQIV 394          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Cavefish
Match: pla2g15 (phospholipase A2, group XV [Source:ZFIN;Acc:ZDB-GENE-030131-6948])

HSP 1 Score: 192.586 bits (488), Expect = 5.810e-56
Identity = 132/400 (33.00%), Postives = 216/400 (54.00%), Query Frame = 3
Query:  129 LLFIVANFQAESINPRNDSKIPSPIILIPGDGGSRAYSNVD---------YRIFTTKVLVWVNFEYMVFPSL--LRNVFKLEYNTTNHKTSNMKGSDVFFPGWGDTETIEELDEKLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFRKAPNENQKMLDDLKILIEDTYRKSGNERVVIXXXXXXXXXXXXFFKQMTMSWKKQYIRAFLSVSGPLGGAVKAVTLETSGESLGSPR-SPIYFREMQRSFPSTSFLLPKPEIFGKEPFII-TPTRNYSSYDYEDLFKDMSMPYGSTMYNDTKNLVDGTETPEGIDELYCIHSYGLPTTKQLTFKAFPDGQP-QFTTGDGDYTVNIQSLKICEKWKN-----VNYFTIKGADHMQIVSTPEFMLKLKQILY 1271
            LL   +    +  +P+  S  P P++LIPGD G++  + +D         Y+       +W+N E +V  ++    +  +L YN+T H T    G DV  PG+G T  +E LD        YF  +V  +V D  Y R++ VRGAPYD+RKAPNEN++    L+ +IE+   K G   VV++ HS+G++Y+LYF      +WK +YI+AF+S+  P  G  K + +  SG++   P  SP+  R  QR+  ST++L P    +  +  ++ TP  NY+  DY+  FKD++   G +M  DT+ LV   E P G+  ++C++  G+PT +   +  FPD +P +   G+GD TVN+ S   C++WK+     V    + G +H+ ++     +  +K +L+
Sbjct:   22 LLCFASCVPLKCSDPKRCSGRP-PVVLIPGDLGNQLEAKLDKPSVVHYICYKKTDEYFTLWLNLELLVPVAIDCWIDNMRLIYNSTTHLTEAPPGVDVQVPGFGQTFGLEYLDPSKRSVGIYFFTIVQAMV-DWGYTRDEDVRGAPYDWRKAPNENKQYFLKLQQMIEEMAEKYGGP-VVLIAHSMGNMYTLYFLNHQPQAWKDKYIKAFVSLGPPWAGVAKTLRVMASGDNNRIPVISPLKIRTQQRTAVSTAWLFPYAHTWPSDMVLVSTPKANYTVSDYQRFFKDLNYKDGWSMREDTEPLVSALEAP-GV-AVHCLYGTGIPTAQSYIYGTFPDAEPTKVVNGEGDGTVNVLSAVQCKRWKSQQKQPVQLLELPGNEHVAMLLNITTVSYIKSVLF 416          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Cavefish
Match: lcat (lecithin-cholesterol acyltransferase [Source:NCBI gene;Acc:103041308])

HSP 1 Score: 188.734 bits (478), Expect = 3.219e-54
Identity = 141/393 (35.88%), Postives = 216/393 (54.96%), Query Frame = 3
Query:  171 PRNDSKIPS-----PIILIPGDGGSRAYSNVD---------YRIFTTKVLVWVNFEYMVFP---SLLRNVFKLEYNTTNHKTSNMKGSDVFFPGWGDTETIEELDE-KLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFRKAPNENQKMLDDLKILIEDTYRKSGNERVVIXXXXXXXXXXXXFFKQMTMSWKKQYIRAFLSVSGPLGGAVKAVTLETSGESLGSPR-SPIYFREMQRSFPSTSFLLPKPEIFGKEP-FIITPTRNYSSYDYEDLFKDMSMPYGSTMYNDTKNLVDGTETPEGIDELYCIHSYGLPTTKQLTF-KAFPDGQP-QFTTGDGDYTVNIQSLKICEKW-----KNVNYFTIKGADHMQIVSTPEFMLKLKQIL 1268
            P    ++PS     P+I++PG+ G+R  + +D         Y+       +W++   M  P       +  ++ YN T  KTSN  G +V  PG+G T T+E LD  KL     YF  ++ +LV +  YVRN+TVR APYD+R APNE  +    LK L+E+ + +   + V +LGHS+GS Y LYF  Q + +WK ++I++F+S+  P GGAVK + +  SG++ G P  S I  RE QR   +  +++P  E + KE  FI TP  NY++ DY+  F D+    G  M+ DT+NL  G  TP G+ E+YC +  GLPT     + + FP+  P  F   DGD TV+ +S+++C++W     + V     KG  H+ IV     +  +++IL
Sbjct:   32 PTAKPRVPSNSTLPPLIIVPGNLGNRLEAKIDKPSLVHWLCYKKSEDWFPLWIDLN-MFMPIGVDCWIDNMRIVYNRTTRKTSNAPGVEVRAPGFGQTYTVEFLDNNKL---AGYFHTMLQHLV-NMGYVRNETVRAAPYDWRIAPNEQDEYFSQLKRLVEEMHDEY-KQPVHLLGHSMGSNYILYFLNQQSQAWKDRFIKSFISLGAPWGGAVKPLRVLASGDNDGIPLVSNIKIREEQRMTTTNPWMIPSEEAWYKEHVFISTPFFNYTNQDYQRFFTDIHFEDGWHMWEDTRNLTAGLPTP-GV-EVYCFYGVGLPTPVTYIYDEEFPNSDPIDFVYDDGDDTVDSRSMRMCQRWIGKQEQPVYVTEFKGLPHLDIVFNHNVLTTIQEIL 416          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Sea Lamprey
Match: pla2g15 (phospholipase A2, group XV [Source:ZFIN;Acc:ZDB-GENE-030131-6948])

HSP 1 Score: 171.785 bits (434), Expect = 1.249e-48
Identity = 127/385 (32.99%), Postives = 211/385 (54.81%), Query Frame = 3
Query:  192 PSPIILIPGDGGSRAYSNVD-----YRIFTTKV----LVWVNFEYMVFPSLLR---NVFKLEYNTTNHKTSNMKGSDVFFPGWGDTETIEELDEKLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFRKAPNENQKMLDDLKILIEDTYRKSGNERVVIXXXXXXXXXXXXFFKQMTMSWKKQYIRAFLSVSGPLGGAVKAVTLETS--GESLGSPR-SPIYFREMQRSFPSTSFLLPKPEIFGKEPFII-TPTRNYSSYDYEDLFKDMSMPYGSTMYNDTKNLVDGTETPEGIDELYCIHSYGLPTTKQLTF-KAFPDGQP-QFTTGDGDYTVNIQSLKICEKWKN-----VNYFTIKGADHMQIVSTPEFMLKLKQILYRQ 1277
            P  +  +PGD G++  + +D     + + T K      +W+N E +V P ++    +  +LEYN T   TS+  G  V  P +G T  +E LD       +YF  LV+ +     Y RN+ +RGAPYD+RKAPNEN + L +LK +IE+ Y    +  VV++ HS+G+ Y  YF  Q + +WK ++I +F+++  P GGA K + + TS  G++ G P  S +  R  QR+  STS+LLP    +  +  ++ TP RNY++ DY D + D+  P G  M  DT++ + G   P G+  ++C++  G+ T     + K+FPD  P +  T DGD TV++ S  +C +W       V    + GA+H+ ++S  + +  +K +++ +
Sbjct:   49 PPTLSSVPGDLGNQLEARLDKPAVVHYLCTKKTDYYFTLWLNLELLV-PLVIDCWIDNMRLEYNLTTRATSSPNGVQVRVPDFGKTFPVEFLDPSNVSVGSYFHTLVEAME-GWGYKRNQDIRGAPYDWRKAPNENGEYLTNLKNMIEEMYATYWSP-VVLVAHSMGNPYMRYFLGQQSQAWKDKFIHSFVALGPPWGGAAKTLRVLTSGTGDNNGIPVISTLKIRAQQRTAVSTSWLLPYNTSWPPDKVLVSTPKRNYTNRDYRDFYNDIGYPEGWLMRQDTESYLYGQPLP-GV-PVHCLYGTGVATPDSFVYDKSFPDHDPTRVITADGDGTVSLASALLCREWAGRQPQPVLLRELPGAEHVSMLSRADLIQYIKGVIFNR 428          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Nematostella
Match: EDO33966 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQQ2])

HSP 1 Score: 191.045 bits (484), Expect = 7.902e-56
Identity = 125/382 (32.72%), Postives = 202/382 (52.88%), Query Frame = 3
Query:  183 SKIPSPIILIPGDGGSRAYSNVD---------YRIFTTKVLVWVNFEYMV--FPSLLRNVFKLEYNTTNHKTSNMKGSDVFFPGWGDTETIEELDEKLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFRKAPNENQKMLDDLKILIEDTYRKSGNERVVIXXXXXXXXXXXXFFKQMTMSWKKQYIRAFLSVSGPLGGAVKAVTLETSGESLGSPR-SPIYFREMQRSFPSTSFLLPKPEIF-GKEPFIITPTRNYSSYDYEDLFKDMSMPYGSTMYNDTKNLVDGTETPEGIDELYCIHSYGLPTTKQLTFKA--FPDGQPQFTTGDGDYTVNIQSLKICEKWKNVNYFTI-----KGADHMQIVSTPEFMLKLKQIL 1268
            ++I +P++++PG GGS+  + ++         +  ++    +W+   +++  F     +  +L Y+       N  G +   PG+GDT TIE LD++  I   YF+ LV  +V    Y R K +R APYDFR AP+        L+ LIEDTY ++G ++V +L HSLG  Y+L F  Q + +WK +YI+ ++++SG  GG  + V L  SG++ G P  +P+  R  QR+  S +F+LP  E++   E  + TP R Y+  D+ED F+D+  P G  +  + +NL            L+C+H  G+ T +  T+    FPD QP    GDGD TVN +SL+ C  W N   + +      G +H  I+S  +    +K I+
Sbjct:   30 AQIKNPVVIVPGTGGSQIEAKLNKPTTKHWYCHNTWSDYFTLWLQESFLLPMFIDCWVDNMRLVYDPATKTVHNSPGVETRVPGFGDTNTIEYLDKRNLI--AYFAPLVKAMV-SWGYERGKNLRAAPYDFRYAPDSQADYYIRLRQLIEDTYTQNGEKQVTLLSHSLGCPYTLVFLNQQSTAWKDKYIKQWVALSGVWGGTTQLVRLFASGDAFGIPLVNPLTVRVEQRTCSSNNFMLPSRELWRSDEVLVTTPDRKYTVRDFEDYFRDVGYPDGIPVRRNLENLTAPLLQHAPNVTLHCLHGSGVDTEESYTYGKGEFPDEQPTIRNGDGDGTVNARSLRACATWVNRQGYDVVVKDYAGVNHNGILSDAKAQAYIKSIV 408          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Nematostella
Match: EDO47377 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMN6])

HSP 1 Score: 171.014 bits (432), Expect = 1.983e-48
Identity = 121/393 (30.79%), Postives = 207/393 (52.67%), Query Frame = 3
Query:  126 QLLFIVANFQAESINPRNDSKIPSPIILIPGDGGSRAYSNVDYRIFTTKVL--------VWVNFEYMVFPSLL---RNVFKLEYNTTNHKTSNMKGSDVFFPGWGDTETIEELDEKLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFRKAPNENQKMLDDLKILIEDTYRKSGNERVVIXXXXXXXXXXXXFFKQMTMSWKKQYIRAFLSVSGPLGGAVKAVTLETSGESLGSPR---SPIYFREMQRSFPSTSFLLPKPEIFG-KEPFIITPTRNYSSYDYEDLFKDMSMPYGSTMYNDTKNLVD--GTETPEGIDELYCIHSYGLPTTKQLTFK--AFPDGQPQFTTGDGDYTVNIQSLKICEKWKNVNYFTI-----KGADHMQIVS 1232
             +LF ++     S+  +   K   PI+L+PGDGGSR  + ++       V         +W++ E ++ P ++    +  +L Y+  + + ++  G  +  P +G T ++  LD  +     YF+ L+D LV    Y ++K +R AP+DFR AP+   +     + L+E  + + G E V+++ HSLG  Y+ YF  ++   WK +Y+ A++++ G  GGA K   + +SG +LG P    +P+  R   R++ ST+FLLP  + +  KEP I TP +NYS  ++E+   D++ P G T+    K LV    ++ P  +  LYC++  G+PT +   FK   FPD  P+   GDGD TVN +SL+ C +++      +       A+HM I+ 
Sbjct:    6 SILFTLSYLLLASLVSKTYCK--PPILLVPGDGGSRLDAKLNKTTAPHYVCKRINDWFHIWLSLEELL-PEVIDCWSDDMRLVYDEKHKRMTSPPGVQIRVPDFGKTSSVAYLDPTIDHPGEYFAPLIDALV-SIGYTKDKNLRAAPFDFRYAPDSAGEFYAYFQALVEQMFMEGGGEPVLVVSHSLGVPYTKYFLDRIHQEWKDKYLHAWVTIGGAWGGAAKLFRIISSGTNLGFPDFILNPLKMRVGLRTYESTTFLLPSEKFWDVKEPVIFTPKKNYSLSNFEEFLDDLNFPLGKTI----KGLVPPVWSDHPPNV-TLYCLYGTGVPTPRTFEFKEGQFPDTYPKTNFGDGDGTVNRKSLEGCFQYEKTQKRPVVTRQFPKAEHMAIIG 389          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Medaka
Match: lcat (lecithin-cholesterol acyltransferase [Source:NCBI gene;Acc:101172491])

HSP 1 Score: 194.512 bits (493), Expect = 1.893e-56
Identity = 139/380 (36.58%), Postives = 213/380 (56.05%), Query Frame = 3
Query:  195 SPIILIPGDGGSRAYSNVDYRIFTTKVL---------VWVNFEYMVFP----SLLRNVFKLEYNTTNHKTSNMKGSDVFFPGWGDTETIEELDEKLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFRKAPNENQKMLDDLKILIEDTYRKSGNERVVIXXXXXXXXXXXXFFKQMTMSWKKQYIRAFLSVSGPLGGAVKAVTLETSGESLGSPR-SPIYFREMQRSFPSTSFLLPKPEIFGKEP-FIITPTRNYSSYDYEDLFKDMSMPYGSTMYNDTKNLVDGTETPEGIDELYCIHSYGLPT-TKQLTFKAFPDGQP-QFTTGDGDYTVNIQSLKICEKW-----KNVNYFTIKGADHMQIVSTPEFMLKLKQIL 1268
            SP+I++PG  G+R  + +D       +          +W++   M  P      + N+ +L YN T  ++SN  G  V  PG+G+T TIE LD   +    YF ++V++LV +  YVRN+TVRGAPYD+R APNEN +    L+ L+E+ Y +   + V +LGHS+G  Y LYF      +WK  YIR F+S+  P GGAVK + + TSG + G P  S I  RE QR   +  ++LP  + + K+  FI TP+ NY++ DY+ LF D+    G  M+ DTKNL  G   P G+ E++C++  GLPT    +  + FP+  P  +   DGD TV+  S+ +C++W     K V+    +G  H+ +V   + + +++QIL
Sbjct:   45 SPLIIVPGSLGNRLEAKIDKPALVHWMCFKKSDHWFPIWIDLN-MFMPIGVDCWIDNI-RLVYNKTTRRSSNSPGVQVRVPGFGETYTIEFLD--YNNLAGYFHSMVEHLV-NVGYVRNETVRGAPYDWRLAPNENSEYFIRLQELVEEMYNQY-QKPVYLLGHSMGGHYVLYFLNNQPQAWKDTYIRGFISLGAPWGGAVKVLRVMTSGNNDGIPMLSNIKLREEQRMMTTNPWMLPSEDAWPKDHVFISTPSVNYTNQDYKRLFTDIDFENGWHMWEDTKNLT-GALHPPGV-EVWCMYGVGLPTPVTHIYDEDFPNADPVDYVYADGDDTVDSFSMSLCKRWEGQQEKPVHVTEYRGLAHLDMVFHEKVLHQIQQIL 416          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Medaka
Match: pla2g15 (phospholipase A2 group XV [Source:NCBI gene;Acc:101172239])

HSP 1 Score: 177.563 bits (449), Expect = 2.556e-50
Identity = 124/378 (32.80%), Postives = 209/378 (55.29%), Query Frame = 3
Query:  198 PIILIPGDGGSRAYSNVD---------YRIFTTKVLVWVNFEYMV---FPSLLRNVFKLEYNTTNHKTSNMKGSDVFFPGWGDTETIEELDEKLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFRKAPNENQKMLDDLKILIEDTYRKSGNERVVIXXXXXXXXXXXXFFKQMTMSWKKQYIRAFLSVSGPLGGAVKAVTLETSGESLGSPR-SPIYFREMQRSFPSTSFLLPKPEIFGKEPFII-TPTRNYSSYDYEDLFKDMSMPYGSTMYNDTKNLVDGTETPEGIDELYCIHSYGLPTTKQLTFK-AFPDGQPQFTTGDGDYTVNIQSLKICEKW-----KNVNYFTIKGADHMQIVSTPEFMLKLKQILY 1271
            P++LIPGD G++  + ++         Y+   +   +W+N E +V       + N+ +L YN T   +    G  V  PG+G T ++E LD        YF ++V ++V +  Y R+  VRGAPYD+RKAPNEN++    L+ +IE+   K+G   VV++ HS+G++Y+LYF  Q   +WK +YI+AF+ +  P  G  K + +  SG++   P  SP+  R  QR+  ST++LLP    + K+  +I TP+ NY+  DY  L+KD+    G  M  DT+ LV     P    E++C++  G+ T++   +   FPD +P    GDGD TVN++S   C++W     + V    ++G +H+ +++    +  +K++L+
Sbjct:   45 PVVLIPGDLGNQLEARLNKPSVVHYICYKKTDSFFTLWLNLELLVPFAIDCWIDNI-RLIYNRTTRTSEAPPGVFVRVPGFGKTFSLEYLDPSKQSVGMYFFSIVQSMV-EWGYTRDDDVRGAPYDWRKAPNENKEYFLKLQQMIEEMAEKAGGP-VVLIAHSMGNMYTLYFLNQQPQAWKDKYIKAFICLGPPWAGVAKTLRVIASGDNNRIPVISPLKIRTQQRTAVSTNWLLPYAHSWSKDQVLIRTPSVNYTVQDYRRLYKDIGFDDGWLMRQDTEPLVSDLLPPNV--EVHCLYGSGINTSEAFHYSNNFPDEEPTVVNGDGDGTVNLRSAIQCKRWVGQQKQPVFLKELRGNEHVDMLTNYTTVAYIKKVLF 417          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Planmine SMEST
Match: SMESG000037748.1 (SMESG000037748.1)

HSP 1 Score: 828.55 bits (2139), Expect = 0.000e+0
Identity = 416/417 (99.76%), Postives = 416/417 (99.76%), Query Frame = 3
Query:   96 MKALKDWIFIQLLFIVANFQAESINPRNDSKIPSPIILIPGDGGSRAYSNVDYRIFTTKVLVWVNFEYMVFPSLLRNVFKLEYNTTNHKTSNMKGSDVFFPGWGDTETIEELDEKLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFRKAPNENQKMLDDLKILIEDTYRKSGNERVVIXXXXXXXXXXXXFFKQMTMSWKKQYIRAFLSVSGPLGGAVKAVTLETSGESLGSPRSPIYFREMQRSFPSTSFLLPKPEIFGKEPFIITPTRNYSSYDYEDLFKDMSMPYGSTMYNDTKNLVDGTETPEGIDELYCIHSYGLPTTKQLTFKAFPDGQPQFTTGDGDYTVNIQSLKICEKWKNVNYFTIKGADHMQIVSTPEFMLKLKQILYRQPNGKFPIIPPRFDGNDRIRVQIF 1346
            MKALKDWIFIQLLFIVANFQAESINPRNDSKIPSPIILIPGDGGSRAYSNVDYRIFTTKVLVWVNFEYMVFPSLLRNVFKLEYNTTNHKTSNMKGSDVFFPGWGDTETIEELDEKLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFRKAPNENQKMLDDLKILIEDTYRKSGNERVVILGHSLGSLYSLYFFKQMTMSWKKQYIRAFLSVSGPLGGAVKAVTLETSGESLGSPRSPIYFREMQRSFPSTSFLLPKPEIFGKEPFIITPTRNYSSYDYEDLFKDMSMPYGSTMYNDTKNLVDGTETPEGIDELYCIHSYGLPTTKQLTFKAFPDGQPQFTTGDGDYTVNIQSLKICEKWKNVNYFTIKGADHMQIVSTPEFMLKLKQILYRQPNGKFPIIPPRFD NDRIRVQIF
Sbjct:    1 MKALKDWIFIQLLFIVANFQAESINPRNDSKIPSPIILIPGDGGSRAYSNVDYRIFTTKVLVWVNFEYMVFPSLLRNVFKLEYNTTNHKTSNMKGSDVFFPGWGDTETIEELDEKLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFRKAPNENQKMLDDLKILIEDTYRKSGNERVVILGHSLGSLYSLYFFKQMTMSWKKQYIRAFLSVSGPLGGAVKAVTLETSGESLGSPRSPIYFREMQRSFPSTSFLLPKPEIFGKEPFIITPTRNYSSYDYEDLFKDMSMPYGSTMYNDTKNLVDGTETPEGIDELYCIHSYGLPTTKQLTFKAFPDGQPQFTTGDGDYTVNIQSLKICEKWKNVNYFTIKGADHMQIVSTPEFMLKLKQILYRQPNGKFPIIPPRFDRNDRIRVQIF 417          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Planmine SMEST
Match: SMESG000037748.1 (SMESG000037748.1)

HSP 1 Score: 781.171 bits (2016), Expect = 0.000e+0
Identity = 399/417 (95.68%), Postives = 399/417 (95.68%), Query Frame = 3
Query:   96 MKALKDWIFIQLLFIVANFQAESINPRNDSKIPSPIILIPGDGGSRAYSNVDYRIFTTKVLVWVNFEYMVFPSLLRNVFKLEYNTTNHKTSNMKGSDVFFPGWGDTETIEELDEKLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFRKAPNENQKMLDDLKILIEDTYRKSGNERVVIXXXXXXXXXXXXFFKQMTMSWKKQYIRAFLSVSGPLGGAVKAVTLETSGESLGSPRSPIYFREMQRSFPSTSFLLPKPEIFGKEPFIITPTRNYSSYDYEDLFKDMSMPYGSTMYNDTKNLVDGTETPEGIDELYCIHSYGLPTTKQLTFKAFPDGQPQFTTGDGDYTVNIQSLKICEKWKNVNYFTIKGADHMQIVSTPEFMLKLKQILYRQPNGKFPIIPPRFDGNDRIRVQIF 1346
            MKALKDWIFIQLLFIVANFQAESINPRNDSKIPSPIILIPGDGGSRAYSNVDYRIFTTKVLVWVNFEYMVFPSLLRNVFKLEYNTTNHKTSNMKGSDVFFPGWGDTETIEELDEKLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFRKAPNENQKMLDDLKILIEDTYRKSGNERVVILGHSLGSLYSLYFFKQMTMSWKKQYIRAFLSVSGPLGGAVKAVTLETSGESLGSPRSPIYFREMQRSFPSTSFLLPKPEIFGKEPFIITPTRNYSSYDYEDLFKDMSMPYGSTMYNDTKNLVDGTETPEGIDELYCIHSYGLPTTKQLTFKAFPDGQPQFTTGDGDYTVNIQS                 ADHMQIVSTPEFMLKLKQILYRQPNGKFPIIPPRFD NDRIRVQIF
Sbjct:    1 MKALKDWIFIQLLFIVANFQAESINPRNDSKIPSPIILIPGDGGSRAYSNVDYRIFTTKVLVWVNFEYMVFPSLLRNVFKLEYNTTNHKTSNMKGSDVFFPGWGDTETIEELDEKLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFRKAPNENQKMLDDLKILIEDTYRKSGNERVVILGHSLGSLYSLYFFKQMTMSWKKQYIRAFLSVSGPLGGAVKAVTLETSGESLGSPRSPIYFREMQRSFPSTSFLLPKPEIFGKEPFIITPTRNYSSYDYEDLFKDMSMPYGSTMYNDTKNLVDGTETPEGIDELYCIHSYGLPTTKQLTFKAFPDGQPQFTTGDGDYTVNIQS-----------------ADHMQIVSTPEFMLKLKQILYRQPNGKFPIIPPRFDRNDRIRVQIF 400          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Planmine SMEST
Match: SMESG000037740.1 (SMESG000037740.1)

HSP 1 Score: 444.121 bits (1141), Expect = 3.479e-154
Identity = 229/396 (57.83%), Postives = 291/396 (73.48%), Query Frame = 3
Query:   96 MKALKDWIFIQLLFIVANFQAESINPRNDSKIPSPIILIPGDGGSRAYSNVDYRIFTTKVLVWVNFEYMVFPSLLRNVFKLEYNTTNHKTSNMKGSDVFFPGWGDTETIEELDEKLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFRKAPNENQKMLDDLKILIEDTYRKSGNERVVIXXXXXXXXXXXXFFKQMTMSWKKQYIRAFLSVSGPLGGAVKAVTLETSGESLGSPRSPIYFREMQRSFPSTSFLLPKPEIFGKEPFIITPTRNYSSYDYEDLFKDMSMPYGSTMYNDTKNLVDGTETPEGIDELYCIHSYGLPTTKQLTFKAFPDGQPQFTTGDGDYTVNIQSLKICEKWKNVNYFTIKGADHMQIVSTPEFMLKLKQILYRQPN 1283
            M +L+ + F  LL  V +  A +         PS I+L+PGDGGSR Y  +D  +F    LVWVN+ YM+FP L  +  KL+Y+   HKTSN   + +  PGWG TE IEELD+  H  TTYF N V++LV DK+YVRNKTVRGAPYDFR+APNEN +   +L+ LIE+TY+ SGN RVV+LGHSLGSLYSLYF K MT SWKK+Y+RAF+S S PLGG++KAV L+TSG SLGSPR  I FR+MQRSFP+++FL+ +PEIFG EP +ITP RNYS+ DYE  F DMS P G  MY DTKNLV+G ETPEG+DE+YCI+S GLPT +Q+  ++FP+G+P    GDGD TVNI+SL+IC+ WKNV++ TI+   HM+IV T EF+  +K ILY++ N
Sbjct:    1 MISLEIFTFTLLLVGVPDVTARAA--------PSSIVLVPGDGGSRIYQEIDCYLFKFNDLVWVNYVYMLFPCLFTSRMKLQYDPKTHKTSNWNNNTILVPGWGSTEMIEELDQWRHPSTTYFYNFVNSLVKDKFYVRNKTVRGAPYDFRRAPNENTEFFVNLEELIEETYKLSGNRRVVLLGHSLGSLYSLYFLKLMTNSWKKKYLRAFISASSPLGGSMKAVKLQTSGTSLGSPRKSIMFRKMQRSFPTSAFLMIRPEIFGNEPIVITPKRNYSASDYEAFFADMSYPDGFMMYEDTKNLVNGFETPEGVDEIYCIYSNGLPTIRQIKLESFPNGEPSLIYGDGDGTVNIKSLQICKNWKNVHHSTIENVAHMEIVGTQEFIDLVKTILYKKYN 388          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Planmine SMEST
Match: SMESG000037734.1 (SMESG000037734.1)

HSP 1 Score: 337.035 bits (863), Expect = 3.403e-112
Identity = 171/361 (47.37%), Postives = 245/361 (67.87%), Query Frame = 3
Query:  192 PSPIILIPGDGGSRAYSNVDYRIFTTKVLVWVNFEYMVFPSLLRNVFKLEYNTTNHKTSNMKGSDVFFPGWGDTETIEELDEKLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFRKAPNENQKMLDDLKILIEDTYRKSGNERVVIXXXXXXXXXXXXFFKQMTMSWKKQYIRAFLSVSGPLGGAVKAVTLETSGESLGSPRSPIYFREMQRSFPSTSFLLPKPEIFGKEPFIITPTRNYSSYDYEDLFKDMSMPYGSTMYNDTKNLVDGTETPEGIDELYCIHSYGLPTTKQLTFKAFPDGQPQFTTGDGDYTVNIQSLKICEKWKNVNYFTIKGADHMQIVSTPEFMLKLKQILYR 1274
            PSP++LIPGDGGSR Y+  +   F   +  WVN+ Y+VFP +L  + KL+Y+   +KT++  G  +F PGWG T+TIE+LD   H ++TYF +LV  L+   YY RN+T+RGAPYDFRKAPNE      +L+ LIE+T+  SGN++VV+L HSLG LYS YF +  +++WK +Y++AF+SVSGP GG+V A+ L+T+G S G P  P  +R++QRSFPST FLLP PE F   P I T  R+YS+ DY+DLFKDM+   G +M+ + K+L++  ++P G+ ++YC+H  G  T +      F   +P  T G GD  VN+ SL+IC+ WKNV+Y  I+GA+H  I+   EF+  L ++L+ 
Sbjct:   30 PSPLVLIPGDGGSRLYAYKEKSFFKDPIKFWVNYYYIVFPKILTRIAKLKYDPKTNKTTDADGFTIFVPGWGSTKTIEQLDIIAHNKSTYFGSLVKLLLKTTYYKRNQTLRGAPYDFRKAPNEMSIFFKNLQKLIEETFVNSGNKKVVLLSHSLGCLYSFYFLQTASLNWKMKYLKAFVSVSGPFGGSVDALLLDTTGISFGGPAQPTDYRDLQRSFPSTHFLLPNPEYFKTMPLIKTQNRHYSANDYKDLFKDMNFTLGYSMHENVKSLINPKDSPLGV-KVYCLHGMGYQTVESYFISNFDQNKPNKTFGLGDGKVNLMSLEICKNWKNVSYNAIQGANHGNILENAEFLTILNKVLFE 389          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Planmine SMEST
Match: SMESG000037742.1 (SMESG000037742.1)

HSP 1 Score: 273.863 bits (699), Expect = 4.308e-89
Identity = 141/265 (53.21%), Postives = 195/265 (73.58%), Query Frame = 3
Query:  180 DSKIPSPIILIPGDGGSRAYSNVDYRIFTTKVLVWVNFEYMVFPSLLRNVFKLEYNTTNHKTSNMKGSDVFFPGWGDTETIEELDEKLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFRKAPNENQKMLDDLKILIEDTYRKSGNERVVIXXXXXXXXXXXXFFKQMTMSWKKQYIRAFLSVSGPLGGAVKAVTLETSGESLGSPRSPIYFREMQRSFPSTSFLLPKPEIFGKEPFIITPTRNYSSYDYEDLFKDMSMPYGS 974
            +S+  SPI+L+PG+GGSRAY+     +   + L+W+N+ Y++FP  L  +FKL YN     T ++  +++ FPGWG TE IE L      +  YF +LV+ LV   YYVRNKTVRGAPYDFR+APNEN+    +LK LIE+T+  SGN +VV+LGHSLGSLYSLYF K+M +SWK++++R+FLSV+GP  GAV+A+  ET G S   P++  YFRE++R+FPS +FLLPKPE+FGK+P +++  R+YS+YDY+ LFKDM M YG+
Sbjct:    8 NSQTFSPIVLVPGNGGSRAYNYQKNDLICKEDLIWINYYYLLFPKKLNRIFKLIYNPITRSTGDLPNTNISFPGWGSTENIETLGYLAVGRMKYFESLVEQLVKIPYYVRNKTVRGAPYDFRRAPNENKDFFTNLKKLIEETFMNSGNTKVVLLGHSLGSLYSLYFLKKMDISWKRKFLRSFLSVNGPFAGAVQALYSETHGISYILPKNAKYFRELERTFPSIAFLLPKPEVFGKDPLVVSSKRSYSAYDYKKLFKDMDMEYGN 272          
The following BLAST results are available for this feature:
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLA2G151.172e-5935.37phospholipase A2 group XV [Source:HGNC Symbol;Acc:... [more]
LCAT1.567e-3829.02lecithin-cholesterol acyltransferase [Source:HGNC ... [more]
PLA2G154.742e-3235.47phospholipase A2 group XV [Source:HGNC Symbol;Acc:... [more]
PLA2G158.961e-2833.98phospholipase A2 group XV [Source:HGNC Symbol;Acc:... [more]
LCAT5.816e-2730.57lecithin-cholesterol acyltransferase [Source:HGNC ... [more]
back to top
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
M05B5.41.527e-5333.68pep chromosome:WBcel235:I:7188465:7190581:1 gene:W... [more]
back to top
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG316831.100e-5834.73gene:FBgn0051683 transcript:FBtr0330662[more]
CG316831.100e-5834.73gene:FBgn0051683 transcript:FBtr0081365[more]
CG188581.385e-5834.73gene:FBgn0042175 transcript:FBtr0332971[more]
CG188581.385e-5834.73gene:FBgn0042175 transcript:FBtr0081364[more]
back to top
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lcat1.721e-5636.80lecithin-cholesterol acyltransferase [Source:ZFIN;... [more]
pla2g153.126e-5633.25phospholipase A2, group XV [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fam53c2.734e-5435.61family with sequence similarity 53 member C [Sourc... [more]
PLA2G152.320e-5033.42phospholipase A2 group XV [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Pla2g151.355e-5734.57phospholipase A2, group XV [Source:MGI Symbol;Acc:... [more]
Lcat1.837e-4430.26lecithin cholesterol acyltransferase [Source:MGI S... [more]
Pla2g156.539e-1029.93phospholipase A2, group XV [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8NCC3|PAG15_HUMAN5.630e-5935.37Phospholipase A2 group XV OS=Homo sapiens OX=9606 ... [more]
sp|Q675A5|PAG15_RAT5.630e-5734.47Phospholipase A2 group XV OS=Rattus norvegicus OX=... [more]
sp|Q6XPZ3|PAG15_CANLF6.680e-5734.31Phospholipase A2 group XV OS=Canis lupus familiari... [more]
sp|Q8VEB4|PAG15_MOUSE9.480e-5734.57Phospholipase A2 group XV OS=Mus musculus OX=10090... [more]
sp|Q8WMP9|PAG15_BOVIN3.456e-5334.48Phospholipase A2 group XV OS=Bos taurus OX=9913 GN... [more]
back to top
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LKD54.527e-10344.59Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A074Z6F71.313e-10247.27Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A3Q0KSH15.287e-10042.57Phosphatidylcholine-sterol acyltransferase (Lecith... [more]
A0A3R7ERF12.829e-9946.34Group XV phospholipase A2 OS=Clonorchis sinensis O... [more]
C1LE788.935e-9944.811-O-acylceramide synthase OS=Schistosoma japonicum... [more]
back to top
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pla2g155.810e-5633.00phospholipase A2, group XV [Source:ZFIN;Acc:ZDB-GE... [more]
lcat3.219e-5435.88lecithin-cholesterol acyltransferase [Source:NCBI ... [more]
back to top
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pla2g151.249e-4832.99phospholipase A2, group XV [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO339667.902e-5632.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO473771.983e-4830.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lcat1.893e-5636.58lecithin-cholesterol acyltransferase [Source:NCBI ... [more]
pla2g152.556e-5032.80phospholipase A2 group XV [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000037748.10.000e+099.76SMESG000037748.1[more]
SMESG000037748.10.000e+095.68SMESG000037748.1[more]
SMESG000037740.13.479e-15457.83SMESG000037740.1[more]
SMESG000037734.13.403e-11247.37SMESG000037734.1[more]
SMESG000037742.14.308e-8953.21SMESG000037742.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016801 ID=SMED30016801|Name=Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A|organism=Schmidtea mediterranea sexual|type=transcript|length=1451bp
AGCAGATTATTTTGATTGGTTGTTGCAACTCTTCATTATAAATCCATTGT
AATTTCATTAATTCTTATCCAGTTTGTATTGATTATCCAAGTTTCATGAA
AGCTCTAAAGGATTGGATTTTTATTCAACTACTTTTCATTGTAGCAAATT
TCCAAGCCGAATCGATAAATCCTCGAAATGATTCGAAAATTCCAAGCCCG
ATTATTCTGATACCCGGCGATGGAGGATCGAGAGCATATTCAAATGTCGA
TTATCGGATATTCACCACGAAGGTTTTAGTTTGGGTCAATTTTGAGTATA
TGGTGTTCCCTTCACTGTTGAGAAATGTTTTCAAATTAGAATATAATACA
ACGAATCATAAAACTTCAAATATGAAAGGTTCCGACGTGTTTTTCCCTGG
TTGGGGAGACACTGAAACGATTGAAGAACTCGATGAAAAACTTCACATTC
AAACGACCTATTTTTCGAATCTCGTAGATAATTTGGTGATTGATAAGTAT
TACGTCCGCAACAAAACAGTGCGTGGAGCTCCATATGATTTCCGGAAGGC
GCCAAATGAAAATCAGAAAATGTTGGATGATTTAAAGATTTTAATTGAAG
ATACGTATCGAAAATCTGGAAATGAACGAGTGGTTATTCTAGGGCACAGC
CTAGGGTCATTATATTCTTTATATTTTTTCAAACAAATGACTATGTCTTG
GAAAAAGCAATACATAAGAGCTTTTCTCTCTGTTTCCGGACCTCTAGGAG
GTGCAGTTAAAGCTGTTACTTTAGAGACTAGTGGAGAATCTTTGGGATCA
CCAAGAAGTCCAATATATTTTAGAGAAATGCAAAGATCATTTCCAAGCAC
TTCATTTTTGTTACCAAAGCCTGAAATATTTGGAAAGGAACCTTTTATTA
TCACACCGACAAGAAATTATTCATCGTACGATTATGAAGATCTGTTCAAA
GACATGTCAATGCCATATGGATCCACTATGTACAATGATACCAAAAACCT
AGTCGATGGTACAGAAACCCCAGAAGGTATAGATGAACTGTATTGTATTC
ATTCATATGGACTTCCTACAACAAAGCAGTTAACATTCAAAGCATTTCCA
GATGGCCAGCCACAATTTACAACTGGTGATGGGGATTACACTGTCAATAT
CCAAAGTTTGAAAATATGTGAAAAATGGAAAAATGTAAACTATTTCACTA
TCAAAGGTGCTGATCATATGCAAATTGTCAGTACGCCAGAGTTCATGCTG
AAACTTAAACAGATTCTCTACCGACAACCCAACGGAAAATTCCCAATAAT
TCCTCCACGTTTTGATGGTAACGATCGAATCCGTGTTCAAATCTTTTAAA
GTGATTCTAAATCACTTTTATTTTTAACAGTCAATTTTCTTTATTTTATG
GACTTATTCATAAACTATGAATAATAAAGGTTTTTGTATTTTAAAAAAAA
A
back to top

protein sequence of SMED30016801-orf-1

>SMED30016801-orf-1 ID=SMED30016801-orf-1|Name=SMED30016801-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=418bp
MKALKDWIFIQLLFIVANFQAESINPRNDSKIPSPIILIPGDGGSRAYSN
VDYRIFTTKVLVWVNFEYMVFPSLLRNVFKLEYNTTNHKTSNMKGSDVFF
PGWGDTETIEELDEKLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFR
KAPNENQKMLDDLKILIEDTYRKSGNERVVILGHSLGSLYSLYFFKQMTM
SWKKQYIRAFLSVSGPLGGAVKAVTLETSGESLGSPRSPIYFREMQRSFP
STSFLLPKPEIFGKEPFIITPTRNYSSYDYEDLFKDMSMPYGSTMYNDTK
NLVDGTETPEGIDELYCIHSYGLPTTKQLTFKAFPDGQPQFTTGDGDYTV
NIQSLKICEKWKNVNYFTIKGADHMQIVSTPEFMLKLKQILYRQPNGKFP
IIPPRFDGNDRIRVQIF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
PLANA:0007528glial cell
Vocabulary: INTERPRO
TermDefinition
IPR003386LACT/PDAT_acylTrfase
IPR029058AB_hydrolase
Vocabulary: molecular function
TermDefinition
GO:0008374O-acyltransferase activity
GO:0016740transferase activity
GO:0016746transferase activity, transferring acyl groups
Vocabulary: biological process
TermDefinition
GO:0006629lipid metabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003386Lecithin:cholesterol/phospholipid:diacylglycerol acyltransferasePFAMPF02450LCATcoord: 62..273
e-value: 9.9E-40
score: 136.9
NoneNo IPR availablePANTHERPTHR11440LECITHIN-CHOLESTEROL ACYLTRANSFERASE-RELATEDcoord: 30..387
NoneNo IPR availablePANTHERPTHR11440:SF35BCDNA.GH02384coord: 30..387
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..23
score: 0.617
IPR029058Alpha/Beta hydrolase foldSUPERFAMILYSSF53474alpha/beta-Hydrolasescoord: 34..386