Heat shock cognate 70 kDa protein

Overview
NameHeat shock cognate 70 kDa protein
Smed IDSMED30016800
Length (bp)993
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Heat shock cognate 70 kDa protein (SMED30016800) t-SNE clustered cells

Violin plots show distribution of expression levels for Heat shock cognate 70 kDa protein (SMED30016800) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Heat shock cognate 70 kDa protein (SMED30016800) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Heat shock cognate 70 kDa protein (SMED30016800) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016800

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30016800SMESG000081110.1 Contig4015_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 390.193 bits (1001), Expect = 1.339e-134
Identity = 207/268 (77.24%), Postives = 247/268 (92.16%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            KIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDVTPLSLG+ETAGGVMTVLIKRNTTIPTKQ+Q F+TYSDNQPGVLIQVYEGER MTKDNN+LGKF+LTG+PPAPRGVPQIEVT+DIDANGILNVSA+++ TG+ENKITITNDKGRLSKE I++M+ + EK+K +DE QR+K+++KN+LE+YA++MK TVED  ++ KI+D D++ I++KC+E I WLD+NQTAEK+E+E + KELE +CNPII+K+YQ
Sbjct:  109 KIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 376          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 389.037 bits (998), Expect = 7.658e-133
Identity = 207/268 (77.24%), Postives = 247/268 (92.16%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            KIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDVTPLSLG+ETAGGVMTVLIKRNTTIPTKQ+Q F+TYSDNQPGVLIQVYEGER MTKDNN+LGKF+LTG+PPAPRGVPQIEVT+DIDANGILNVSA+++ TG+ENKITITNDKGRLSKE I++M+ + EK+K +DE QR+K+++KN+LE+YA++MK TVED  ++ KI+D D++ I++KC+E I WLD+NQTAEK+E+E + KELE +CNPII+K+YQ
Sbjct:  199 KIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 466          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 389.808 bits (1000), Expect = 1.787e-131
Identity = 207/268 (77.24%), Postives = 247/268 (92.16%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            KIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDVTPLSLG+ETAGGVMTVLIKRNTTIPTKQ+Q F+TYSDNQPGVLIQVYEGER MTKDNN+LGKF+LTG+PPAPRGVPQIEVT+DIDANGILNVSA+++ TG+ENKITITNDKGRLSKE I++M+ + EK+K +DE QR+K+++KN+LE+YA++MK TVED  ++ KI+D D++ I++KC+E I WLD+NQTAEK+E+E + KELE +CNPII+K+YQ
Sbjct:  326 KIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 593          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 389.808 bits (1000), Expect = 2.776e-131
Identity = 207/268 (77.24%), Postives = 247/268 (92.16%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            KIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDVTPLSLG+ETAGGVMTVLIKRNTTIPTKQ+Q F+TYSDNQPGVLIQVYEGER MTKDNN+LGKF+LTG+PPAPRGVPQIEVT+DIDANGILNVSA+++ TG+ENKITITNDKGRLSKE I++M+ + EK+K +DE QR+K+++KN+LE+YA++MK TVED  ++ KI+D D++ I++KC+E I WLD+NQTAEK+E+E + KELE +CNPII+K+YQ
Sbjct:  345 KIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 389.808 bits (1000), Expect = 2.776e-131
Identity = 207/268 (77.24%), Postives = 247/268 (92.16%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            KIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDVTPLSLG+ETAGGVMTVLIKRNTTIPTKQ+Q F+TYSDNQPGVLIQVYEGER MTKDNN+LGKF+LTG+PPAPRGVPQIEVT+DIDANGILNVSA+++ TG+ENKITITNDKGRLSKE I++M+ + EK+K +DE QR+K+++KN+LE+YA++MK TVED  ++ KI+D D++ I++KC+E I WLD+NQTAEK+E+E + KELE +CNPII+K+YQ
Sbjct:  345 KIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Celegans
Match: hsp-1 (Heat shock 70 kDa protein A [Source:UniProtKB/Swiss-Prot;Acc:P09446])

HSP 1 Score: 371.703 bits (953), Expect = 1.105e-124
Identity = 199/268 (74.25%), Postives = 238/268 (88.81%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            K+QKLL D F+GKELNKSINPDEAVAYGAAVQAAIL GDKSEAVQDLLLLDV PLSLG+ETAGGVMT LIKRNTTIPTK +Q F+TYSDNQPGVLIQVYEGER MTKDNN+LGKF+L+G+PPAPRGVPQIEVT+DIDANGILNVSA ++ TG++NKITITNDKGRLSK+ I++M+++ EK+K DDE Q+++I AKN LE+YA+++KQT+ED  +K KIS  D+K I +KC E +KWLD NQTAEK+E+E + K+LE + NPIISK+YQ
Sbjct:  346 KVQKLLSDLFSGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKTAQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSATDKSTGKQNKITITNDKGRLSKDDIERMVNEAEKYKADDEAQKDRIGAKNGLESYAFNLKQTIEDEKLKDKISPEDKKKIEDKCDEILKWLDSNQTAEKEEFEHQQKDLEGLANPIISKLYQ 613          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Celegans
Match: hsp-1 (Heat shock 70 kDa protein A [Source:UniProtKB/Swiss-Prot;Acc:P09446])

HSP 1 Score: 371.703 bits (953), Expect = 1.105e-124
Identity = 199/268 (74.25%), Postives = 238/268 (88.81%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            K+QKLL D F+GKELNKSINPDEAVAYGAAVQAAIL GDKSEAVQDLLLLDV PLSLG+ETAGGVMT LIKRNTTIPTK +Q F+TYSDNQPGVLIQVYEGER MTKDNN+LGKF+L+G+PPAPRGVPQIEVT+DIDANGILNVSA ++ TG++NKITITNDKGRLSK+ I++M+++ EK+K DDE Q+++I AKN LE+YA+++KQT+ED  +K KIS  D+K I +KC E +KWLD NQTAEK+E+E + K+LE + NPIISK+YQ
Sbjct:  346 KVQKLLSDLFSGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKTAQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSATDKSTGKQNKITITNDKGRLSKDDIERMVNEAEKYKADDEAQKDRIGAKNGLESYAFNLKQTIEDEKLKDKISPEDKKKIEDKCDEILKWLDSNQTAEKEEFEHQQKDLEGLANPIISKLYQ 613          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Celegans
Match: F44E5.5 (pep chromosome:WBcel235:II:11759681:11761808:1 gene:WBGene00009692.1 transcript:F44E5.5.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F44E5.5)

HSP 1 Score: 300.056 bits (767), Expect = 9.024e-97
Identity = 164/268 (61.19%), Postives = 214/268 (79.85%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            KIQKLL+DFFNGKELN SINPDEAVA+GAAVQAA+L G K E ++D+LL+DV PLSLG+ETAGGVMT LI RNT IPTK  + F+TY+DNQPGV IQVYEGER MT+DN+ LG F+L+G+PPAPRGVPQIEVT+DIDANGILNVSA ++ TG+ N+ITI N+KGRL++  ID+M+ + ++F+ +D  QRE++ A+N LE YA+ +KQ +++ +  SK+S  D         ET++WLD N  AEKDE E + KEL+S+C  I++K++Q
Sbjct:  346 KIQKLLKDFFNGKELNCSINPDEAVAFGAAVQAAVLSGVKDETIKDVLLVDVAPLSLGIETAGGVMTNLIDRNTRIPTKACKTFTTYADNQPGVSIQVYEGERAMTRDNHRLGTFELSGIPPAPRGVPQIEVTFDIDANGILNVSAEDKSTGKSNRITIQNEKGRLTQSDIDRMVHEAKQFEKEDGEQRERVQARNQLEAYAFQIKQALDEYS--SKLSTEDASRAKEAVDETLRWLDSNSLAEKDEIEAKDKELKSVCQSILTKMHQ 611          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Celegans
Match: F44E5.5 (pep chromosome:WBcel235:II:11759640:11761853:1 gene:WBGene00009692.1 transcript:F44E5.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F44E5.5)

HSP 1 Score: 300.056 bits (767), Expect = 9.024e-97
Identity = 164/268 (61.19%), Postives = 214/268 (79.85%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            KIQKLL+DFFNGKELN SINPDEAVA+GAAVQAA+L G K E ++D+LL+DV PLSLG+ETAGGVMT LI RNT IPTK  + F+TY+DNQPGV IQVYEGER MT+DN+ LG F+L+G+PPAPRGVPQIEVT+DIDANGILNVSA ++ TG+ N+ITI N+KGRL++  ID+M+ + ++F+ +D  QRE++ A+N LE YA+ +KQ +++ +  SK+S  D         ET++WLD N  AEKDE E + KEL+S+C  I++K++Q
Sbjct:  346 KIQKLLKDFFNGKELNCSINPDEAVAFGAAVQAAVLSGVKDETIKDVLLVDVAPLSLGIETAGGVMTNLIDRNTRIPTKACKTFTTYADNQPGVSIQVYEGERAMTRDNHRLGTFELSGIPPAPRGVPQIEVTFDIDANGILNVSAEDKSTGKSNRITIQNEKGRLTQSDIDRMVHEAKQFEKEDGEQRERVQARNQLEAYAFQIKQALDEYS--SKLSTEDASRAKEAVDETLRWLDSNSLAEKDEIEAKDKELKSVCQSILTKMHQ 611          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Celegans
Match: F44E5.4 (pep chromosome:WBcel235:II:11757106:11759323:-1 gene:WBGene00009691.1 transcript:F44E5.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F44E5.4)

HSP 1 Score: 300.056 bits (767), Expect = 9.024e-97
Identity = 164/268 (61.19%), Postives = 214/268 (79.85%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            KIQKLL+DFFNGKELN SINPDEAVA+GAAVQAA+L G K E ++D+LL+DV PLSLG+ETAGGVMT LI RNT IPTK  + F+TY+DNQPGV IQVYEGER MT+DN+ LG F+L+G+PPAPRGVPQIEVT+DIDANGILNVSA ++ TG+ N+ITI N+KGRL++  ID+M+ + ++F+ +D  QRE++ A+N LE YA+ +KQ +++ +  SK+S  D         ET++WLD N  AEKDE E + KEL+S+C  I++K++Q
Sbjct:  346 KIQKLLKDFFNGKELNCSINPDEAVAFGAAVQAAVLSGVKDETIKDVLLVDVAPLSLGIETAGGVMTNLIDRNTRIPTKACKTFTTYADNQPGVSIQVYEGERAMTRDNHRLGTFELSGIPPAPRGVPQIEVTFDIDANGILNVSAEDKSTGKSNRITIQNEKGRLTQSDIDRMVHEAKQFEKEDGEQRERVQARNQLEAYAFQIKQALDEYS--SKLSTEDASRAKEAVDETLRWLDSNSLAEKDEIEAKDKELKSVCQSILTKMHQ 611          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0083059)

HSP 1 Score: 386.341 bits (991), Expect = 3.277e-130
Identity = 203/268 (75.75%), Postives = 245/268 (91.42%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            K+Q+LLQD FNGKELNKSINPDEAVAYGAAVQAAIL GDKS+ VQDLLLLDVTPLSLG+ETAGGVM+VLIKRNTTIPTKQ+Q F+TYSDNQPGVLIQVYEGER MTKDNN+LGKF+L+G+PPAPRGVPQIEVT+DIDANGILNV+A+ER T +ENKITITNDKGRLSKE I++M+++ EK++N+DE Q+E I AKN LE+Y ++MK T+++ N+K+KISD D+ +I++KC+ETIKWLD NQ A+K+EYE R KELE +CNPII+K+YQ
Sbjct:  345 KVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQDLLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVNEAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDANQLADKEEYEHRQKELEGVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0337053)

HSP 1 Score: 386.341 bits (991), Expect = 3.277e-130
Identity = 203/268 (75.75%), Postives = 245/268 (91.42%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            K+Q+LLQD FNGKELNKSINPDEAVAYGAAVQAAIL GDKS+ VQDLLLLDVTPLSLG+ETAGGVM+VLIKRNTTIPTKQ+Q F+TYSDNQPGVLIQVYEGER MTKDNN+LGKF+L+G+PPAPRGVPQIEVT+DIDANGILNV+A+ER T +ENKITITNDKGRLSKE I++M+++ EK++N+DE Q+E I AKN LE+Y ++MK T+++ N+K+KISD D+ +I++KC+ETIKWLD NQ A+K+EYE R KELE +CNPII+K+YQ
Sbjct:  345 KVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQDLLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVNEAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDANQLADKEEYEHRQKELEGVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0083058)

HSP 1 Score: 386.341 bits (991), Expect = 3.277e-130
Identity = 203/268 (75.75%), Postives = 245/268 (91.42%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            K+Q+LLQD FNGKELNKSINPDEAVAYGAAVQAAIL GDKS+ VQDLLLLDVTPLSLG+ETAGGVM+VLIKRNTTIPTKQ+Q F+TYSDNQPGVLIQVYEGER MTKDNN+LGKF+L+G+PPAPRGVPQIEVT+DIDANGILNV+A+ER T +ENKITITNDKGRLSKE I++M+++ EK++N+DE Q+E I AKN LE+Y ++MK T+++ N+K+KISD D+ +I++KC+ETIKWLD NQ A+K+EYE R KELE +CNPII+K+YQ
Sbjct:  345 KVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQDLLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVNEAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDANQLADKEEYEHRQKELEGVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0083060)

HSP 1 Score: 386.341 bits (991), Expect = 3.277e-130
Identity = 203/268 (75.75%), Postives = 245/268 (91.42%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            K+Q+LLQD FNGKELNKSINPDEAVAYGAAVQAAIL GDKS+ VQDLLLLDVTPLSLG+ETAGGVM+VLIKRNTTIPTKQ+Q F+TYSDNQPGVLIQVYEGER MTKDNN+LGKF+L+G+PPAPRGVPQIEVT+DIDANGILNV+A+ER T +ENKITITNDKGRLSKE I++M+++ EK++N+DE Q+E I AKN LE+Y ++MK T+++ N+K+KISD D+ +I++KC+ETIKWLD NQ A+K+EYE R KELE +CNPII+K+YQ
Sbjct:  345 KVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQDLLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVNEAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDANQLADKEEYEHRQKELEGVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0083057)

HSP 1 Score: 386.341 bits (991), Expect = 3.277e-130
Identity = 203/268 (75.75%), Postives = 245/268 (91.42%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            K+Q+LLQD FNGKELNKSINPDEAVAYGAAVQAAIL GDKS+ VQDLLLLDVTPLSLG+ETAGGVM+VLIKRNTTIPTKQ+Q F+TYSDNQPGVLIQVYEGER MTKDNN+LGKF+L+G+PPAPRGVPQIEVT+DIDANGILNV+A+ER T +ENKITITNDKGRLSKE I++M+++ EK++N+DE Q+E I AKN LE+Y ++MK T+++ N+K+KISD D+ +I++KC+ETIKWLD NQ A+K+EYE R KELE +CNPII+K+YQ
Sbjct:  345 KVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQDLLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVNEAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDANQLADKEEYEHRQKELEGVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Zebrafish
Match: hspa1b (heat shock protein family A (Hsp70) member 1B [Source:ZFIN;Acc:ZDB-GENE-060503-867])

HSP 1 Score: 395.971 bits (1016), Expect = 6.502e-134
Identity = 210/268 (78.36%), Postives = 242/268 (90.30%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            KIQKLLQDFFNG++LNKSINPDEAVAYGAAVQAAIL GD SE VQDLLLLDV PLSLG+ETAGGVMT LIKRNTTIPTKQ+Q+FSTYSDNQPGVLIQV+EGER MTKDNN+LGKFDLTG+PPAPRGVPQIEVT+DIDANGILNVSA ++ TG+ENKITITNDKGRLSKE I++M+ D EK+K +DE QREKI AKNALE+YA+SMK TVED N++ KIS+ D+K I++KC+E + WL+ NQ AEK+EYE   KELES+CNPIIS++YQ
Sbjct:  345 KIQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDTSENVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQIFSTYSDNQPGVLIQVFEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVSAADKSTGKENKITITNDKGRLSKEDIERMVQDAEKYKAEDEVQREKIAAKNALESYAFSMKNTVEDENLRGKISEQDKKKIIDKCTEVVSWLENNQLAEKEEYEHHQKELESVCNPIISRLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Zebrafish
Match: hspa8 (heat shock protein 8 [Source:NCBI gene;Acc:573376])

HSP 1 Score: 388.652 bits (997), Expect = 3.205e-131
Identity = 206/268 (76.87%), Postives = 246/268 (91.79%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            KIQKLLQD+FNGKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDVTPLSLG+ETAGGVMTVLIKRNTTIPTKQ+Q F+TYSDNQPGVLIQVYEGER MTKDNN+LGKF+LTG+PPAPRGVPQIEVT+DIDANGI+NVSA+++ TG+ENKITITNDKGRLSKE I++M+ + EK+K +D+ QR+K++AKN LE+YA++MK TVED  +K KISD D++ I++KC+E I WLD+NQTAE++E+E + KELE +CNPII+K+YQ
Sbjct:  345 KIQKLLQDYFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVEDEKLKGKISDEDKQKILDKCNEVIGWLDKNQTAEREEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Zebrafish
Match: hspa8 (heat shock protein 8 [Source:NCBI gene;Acc:573376])

HSP 1 Score: 388.267 bits (996), Expect = 7.604e-131
Identity = 206/268 (76.87%), Postives = 246/268 (91.79%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            KIQKLLQD+FNGKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDVTPLSLG+ETAGGVMTVLIKRNTTIPTKQ+Q F+TYSDNQPGVLIQVYEGER MTKDNN+LGKF+LTG+PPAPRGVPQIEVT+DIDANGI+NVSA+++ TG+ENKITITNDKGRLSKE I++M+ + EK+K +D+ QR+K++AKN LE+YA++MK TVED  +K KISD D++ I++KC+E I WLD+NQTAE++E+E + KELE +CNPII+K+YQ
Sbjct:  345 KIQKLLQDYFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVEDEKLKGKISDEDKQKILDKCNEVIGWLDKNQTAEREEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Zebrafish
Match: hspa8 (heat shock protein 8 [Source:NCBI gene;Acc:573376])

HSP 1 Score: 388.267 bits (996), Expect = 7.604e-131
Identity = 206/268 (76.87%), Postives = 246/268 (91.79%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            KIQKLLQD+FNGKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDVTPLSLG+ETAGGVMTVLIKRNTTIPTKQ+Q F+TYSDNQPGVLIQVYEGER MTKDNN+LGKF+LTG+PPAPRGVPQIEVT+DIDANGI+NVSA+++ TG+ENKITITNDKGRLSKE I++M+ + EK+K +D+ QR+K++AKN LE+YA++MK TVED  +K KISD D++ I++KC+E I WLD+NQTAE++E+E + KELE +CNPII+K+YQ
Sbjct:  345 KIQKLLQDYFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVEDEKLKGKISDEDKQKILDKCNEVIGWLDKNQTAEREEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Zebrafish
Match: hspa8 (heat shock protein 8 [Source:NCBI gene;Acc:573376])

HSP 1 Score: 388.267 bits (996), Expect = 7.604e-131
Identity = 206/268 (76.87%), Postives = 246/268 (91.79%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            KIQKLLQD+FNGKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDVTPLSLG+ETAGGVMTVLIKRNTTIPTKQ+Q F+TYSDNQPGVLIQVYEGER MTKDNN+LGKF+LTG+PPAPRGVPQIEVT+DIDANGI+NVSA+++ TG+ENKITITNDKGRLSKE I++M+ + EK+K +D+ QR+K++AKN LE+YA++MK TVED  +K KISD D++ I++KC+E I WLD+NQTAE++E+E + KELE +CNPII+K+YQ
Sbjct:  345 KIQKLLQDYFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVEDEKLKGKISDEDKQKILDKCNEVIGWLDKNQTAEREEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Xenopus
Match: ENSXETT00000025573.1 (heat shock protein family A (Hsp70) member 1B [Source:NCBI gene;Acc:100485441])

HSP 1 Score: 397.897 bits (1021), Expect = 1.656e-134
Identity = 222/294 (75.51%), Postives = 254/294 (86.39%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQXXXXXXXXXXXXXXXXXXXXXIEEVD 882
            K+QKLLQDFFNGKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDV PLSLGLETAGGVMTVLIKRNTTIPTKQ+Q F+TYSDNQPGVLIQVYEGER MTKDNN+LGKFDLTG+PPAPRGVPQIEVT+DIDANGILNVSA+++ +G++NKITITNDKGRLSKE+I++M+ + +K+K DDE QREKI AKN+LE+YA++MK TVED NIK KISD D+KSI++KC E I WL+QNQ AEK+EY  + KELE +CNPII+K+YQG   G             GP IEEVD
Sbjct:  346 KVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSSGKQNKITITNDKGRLSKEEIERMLQEADKYKADDEQQREKIAAKNSLESYAFNMKSTVEDNNIKDKISDNDKKSILDKCQEVISWLEQNQLAEKEEYTHKQKELEKLCNPIITKLYQGGMPGGMPGAGCTAEPKQGPTIEEVD 639          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Xenopus
Match: tmed10 (transmembrane emp24-like trafficking protein 10 (yeast) [Source:Xenbase;Acc:XB-GENE-968508])

HSP 1 Score: 395.201 bits (1014), Expect = 2.764e-133
Identity = 212/268 (79.10%), Postives = 244/268 (91.04%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            K+QKLLQDFFNGKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDV PLSLGLETAGGVMTVLIKRNTTIP KQ+Q F+TYSDNQPGVLIQVYEGER MTKDNN+LGKFDLTG+PPAPRGVPQIEVT+DIDANGILNVSA+++ +G++NKITITNDKGRLSKE+I++M+ + +K+K DDE QREKI AKN+LE+YA++MK TVED NIK KISD D+KSI++KC E I WL+QNQ AEK+EY  + KELE +CNPII+K+YQ
Sbjct:  346 KVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTVLIKRNTTIPIKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSSGKKNKITITNDKGRLSKEEIERMLQEADKYKADDEQQREKIAAKNSLESYAFNMKSTVEDNNIKDKISDSDKKSILDKCQEVISWLEQNQLAEKEEYTHKQKELEKLCNPIITKLYQ 613          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Xenopus
Match: wdr26 (WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-993726])

HSP 1 Score: 393.275 bits (1009), Expect = 4.161e-133
Identity = 209/268 (77.99%), Postives = 247/268 (92.16%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            KIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDVTPLSLG+ETAGGVMTVLIKRNTTIPTKQ+Q F+TYSDNQPGVLIQVYEGER MTKDNN+LGKF+LTG+PPAPRGVPQIEVT+DIDANGILNVSA+++ TG+ENKITITNDKGRLSKE I++M+ + EK+K +DE QR+K+++KN+LE+YA++MK TVED  +K KISD D++ I++KC+E I WLD+NQTAEK+E+E + KELE +CNPII+K+YQ
Sbjct:  316 KIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLKGKISDEDKQKILDKCNEVISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 583          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Xenopus
Match: wdr26 (WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-993726])

HSP 1 Score: 394.045 bits (1011), Expect = 5.694e-133
Identity = 209/268 (77.99%), Postives = 247/268 (92.16%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            KIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDVTPLSLG+ETAGGVMTVLIKRNTTIPTKQ+Q F+TYSDNQPGVLIQVYEGER MTKDNN+LGKF+LTG+PPAPRGVPQIEVT+DIDANGILNVSA+++ TG+ENKITITNDKGRLSKE I++M+ + EK+K +DE QR+K+++KN+LE+YA++MK TVED  +K KISD D++ I++KC+E I WLD+NQTAEK+E+E + KELE +CNPII+K+YQ
Sbjct:  348 KIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLKGKISDEDKQKILDKCNEVISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 615          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Xenopus
Match: wdr26 (WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-993726])

HSP 1 Score: 393.275 bits (1009), Expect = 8.553e-133
Identity = 209/268 (77.99%), Postives = 247/268 (92.16%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            KIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDVTPLSLG+ETAGGVMTVLIKRNTTIPTKQ+Q F+TYSDNQPGVLIQVYEGER MTKDNN+LGKF+LTG+PPAPRGVPQIEVT+DIDANGILNVSA+++ TG+ENKITITNDKGRLSKE I++M+ + EK+K +DE QR+K+++KN+LE+YA++MK TVED  +K KISD D++ I++KC+E I WLD+NQTAEK+E+E + KELE +CNPII+K+YQ
Sbjct:  345 KIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLKGKISDEDKQKILDKCNEVISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Mouse
Match: Hspa8 (heat shock protein 8 [Source:MGI Symbol;Acc:MGI:105384])

HSP 1 Score: 389.808 bits (1000), Expect = 1.175e-131
Identity = 207/268 (77.24%), Postives = 247/268 (92.16%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            KIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDVTPLSLG+ETAGGVMTVLIKRNTTIPTKQ+Q F+TYSDNQPGVLIQVYEGER MTKDNN+LGKF+LTG+PPAPRGVPQIEVT+DIDANGILNVSA+++ TG+ENKITITNDKGRLSKE I++M+ + EK+K +DE QR+K+++KN+LE+YA++MK TVED  ++ KI+D D++ I++KC+E I WLD+NQTAEK+E+E + KELE +CNPII+K+YQ
Sbjct:  326 KIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 593          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Mouse
Match: Hspa8 (heat shock protein 8 [Source:MGI Symbol;Acc:MGI:105384])

HSP 1 Score: 390.193 bits (1001), Expect = 1.603e-131
Identity = 207/268 (77.24%), Postives = 247/268 (92.16%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            KIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDVTPLSLG+ETAGGVMTVLIKRNTTIPTKQ+Q F+TYSDNQPGVLIQVYEGER MTKDNN+LGKF+LTG+PPAPRGVPQIEVT+DIDANGILNVSA+++ TG+ENKITITNDKGRLSKE I++M+ + EK+K +DE QR+K+++KN+LE+YA++MK TVED  ++ KI+D D++ I++KC+E I WLD+NQTAEK+E+E + KELE +CNPII+K+YQ
Sbjct:  345 KIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Mouse
Match: Hspa1l (heat shock protein 1-like [Source:MGI Symbol;Acc:MGI:96231])

HSP 1 Score: 380.948 bits (977), Expect = 4.167e-128
Identity = 199/268 (74.25%), Postives = 243/268 (90.67%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            K+QKLLQD+FNG++LNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDV PLSLGLETAGGVMTVLIKRN+TIPTKQ+Q+F+TYSDNQPGVLIQVYEGER MT+DNN+LG+FDLTG+PPAPRGVPQIEVT+DIDANGILNV+A+++ TG+ NKITITNDKGRLSKE+I++M+ + E++K +DE QREKI AKNALE+YA++MK  V D  +K KIS+ D+K I++KC+E + WL+ NQ AEKDE++ + KELE++CNPII+K+YQ
Sbjct:  347 KVQKLLQDYFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTVLIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTRDNNLLGRFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAMDKSTGKANKITITNDKGRLSKEEIERMVQEAERYKAEDEGQREKIAAKNALESYAFNMKSAVGDEGLKDKISESDKKKILDKCNEVLSWLEANQLAEKDEFDHKRKELENMCNPIITKLYQ 614          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Mouse
Match: Hspa2 (heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96243])

HSP 1 Score: 377.867 bits (969), Expect = 6.784e-127
Identity = 203/268 (75.75%), Postives = 239/268 (89.18%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            KIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDVTPLSLG+ETAGGVMT LIKRNTTIPTKQ+Q F+TYSDNQ  VL+QVYEGER MTKDNN+LGKFDLTG+PPAPRGVPQIEVT+DIDANGILNV+A ++ TG+ENKITITNDKGRLSK+ ID+M+ + E++K++DE  R+++ AKNA+E+Y Y++KQTVED  ++ KIS+ D+  I++KC E I WLD+NQ AEKDEYE + KELE +CNPIISK+YQ
Sbjct:  348 KIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRNTTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNAVESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQ 615          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Mouse
Match: Hspa2 (heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96243])

HSP 1 Score: 377.867 bits (969), Expect = 6.784e-127
Identity = 203/268 (75.75%), Postives = 239/268 (89.18%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            KIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDVTPLSLG+ETAGGVMT LIKRNTTIPTKQ+Q F+TYSDNQ  VL+QVYEGER MTKDNN+LGKFDLTG+PPAPRGVPQIEVT+DIDANGILNV+A ++ TG+ENKITITNDKGRLSK+ ID+M+ + E++K++DE  R+++ AKNA+E+Y Y++KQTVED  ++ KIS+ D+  I++KC E I WLD+NQ AEKDEYE + KELE +CNPIISK+YQ
Sbjct:  348 KIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRNTTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNAVESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQ 615          
BLAST of Heat shock cognate 70 kDa protein vs. UniProt/SwissProt
Match: sp|Q24789|HSP70_ECHGR (Heat shock cognate 70 kDa protein OS=Echinococcus granulosus OX=6210 GN=HSP70 PE=2 SV=1)

HSP 1 Score: 392.504 bits (1007), Expect = 2.098e-131
Identity = 205/268 (76.49%), Postives = 241/268 (89.93%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            K+QKLLQDFFNG+ELNKSINPDEAVAYGAAVQAAIL GDKSEAVQDLLLLDV PLSLGLETAGGVMT LIKRNTTIPTKQ+Q F+TYSDNQPGVLIQVYEGER M +DNN+LGKF+L+G+PP PRGVPQIEVT+DIDANGILNVSA+++ TG++NKITIT DKGRLSKE+I++M++D EKFK +DE QR+++ AKN LE+YA+SMK TVED  +K KI + D++ I+ KC ET+KWLD NQ AEK+EYE R KELES+CNPII+K+YQ
Sbjct:  347 KVQKLLQDFFNGRELNKSINPDEAVAYGAAVQAAILTGDKSEAVQDLLLLDVAPLSLGLETAGGVMTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMKRDNNLLGKFELSGIPPGPRGVPQIEVTFDIDANGILNVSAVDKSTGKQNKITITRDKGRLSKEEIERMVNDAEKFKQEDEKQRDRVAAKNGLESYAFSMKSTVEDEKVKEKIGESDRRRIMEKCEETVKWLDGNQQAEKEEYEHRQKELESVCNPIIAKMYQ 614          
BLAST of Heat shock cognate 70 kDa protein vs. UniProt/SwissProt
Match: sp|Q9U639|HSP7D_MANSE (Heat shock 70 kDa protein cognate 4 OS=Manduca sexta OX=7130 PE=2 SV=1)

HSP 1 Score: 390.578 bits (1002), Expect = 9.517e-131
Identity = 207/268 (77.24%), Postives = 246/268 (91.79%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            K+QKLLQDFFNGKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDVTPLSLG+ETAGGVMT LIKRNTTIPTKQ+Q F+TYSDNQPGVLIQV+EGER MTKDNN+LGKF+LTG+PPAPRGVPQIEVT+DIDANGILNVSA+E+ T +ENKITITNDKGRLSKE+I++M+++ EK++N+DE Q+E I AKNALE+Y ++MK T+ED  +K KISD D+++I++KC++TIKWLD NQ A+K+EYE + KELE ICNPII+K+YQ
Sbjct:  345 KVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILHGDKSEEVQDLLLLDVTPLSLGIETAGGVMTTLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVEKSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDEKQKETIQAKNALESYCFNMKSTMEDEKLKDKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGICNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. UniProt/SwissProt
Match: sp|P63018|HSP7C_RAT (Heat shock cognate 71 kDa protein OS=Rattus norvegicus OX=10116 GN=Hspa8 PE=1 SV=1)

HSP 1 Score: 390.193 bits (1001), Expect = 1.121e-130
Identity = 207/268 (77.24%), Postives = 247/268 (92.16%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            KIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDVTPLSLG+ETAGGVMTVLIKRNTTIPTKQ+Q F+TYSDNQPGVLIQVYEGER MTKDNN+LGKF+LTG+PPAPRGVPQIEVT+DIDANGILNVSA+++ TG+ENKITITNDKGRLSKE I++M+ + EK+K +DE QR+K+++KN+LE+YA++MK TVED  ++ KI+D D++ I++KC+E I WLD+NQTAEK+E+E + KELE +CNPII+K+YQ
Sbjct:  345 KIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. UniProt/SwissProt
Match: sp|P63017|HSP7C_MOUSE (Heat shock cognate 71 kDa protein OS=Mus musculus OX=10090 GN=Hspa8 PE=1 SV=1)

HSP 1 Score: 390.193 bits (1001), Expect = 1.121e-130
Identity = 207/268 (77.24%), Postives = 247/268 (92.16%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            KIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDVTPLSLG+ETAGGVMTVLIKRNTTIPTKQ+Q F+TYSDNQPGVLIQVYEGER MTKDNN+LGKF+LTG+PPAPRGVPQIEVT+DIDANGILNVSA+++ TG+ENKITITNDKGRLSKE I++M+ + EK+K +DE QR+K+++KN+LE+YA++MK TVED  ++ KI+D D++ I++KC+E I WLD+NQTAEK+E+E + KELE +CNPII+K+YQ
Sbjct:  345 KIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. UniProt/SwissProt
Match: sp|Q71U34|HSP7C_SAGOE (Heat shock cognate 71 kDa protein OS=Saguinus oedipus OX=9490 GN=HSPA8 PE=2 SV=1)

HSP 1 Score: 389.808 bits (1000), Expect = 1.333e-130
Identity = 207/268 (77.24%), Postives = 247/268 (92.16%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            KIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDVTPLSLG+ETAGGVMTVLIKRNTTIPTKQ+Q F+TYSDNQPGVLIQVYEGER MTKDNN+LGKF+LTG+PPAPRGVPQIEVT+DIDANGILNVSA+++ TG+ENKITITNDKGRLSKE I++M+ + EK+K +DE QR+K+++KN+LE+YA++MK TVED  ++ KI+D D++ I++KC+E I WLD+NQTAEK+E+E + KELE +CNPII+K+YQ
Sbjct:  345 KIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. TrEMBL
Match: A0A183B2D6 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS13371 PE=4 SV=1)

HSP 1 Score: 397.127 bits (1019), Expect = 3.158e-134
Identity = 207/268 (77.24%), Postives = 246/268 (91.79%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            K+QKLLQDFFNGKELNKSINPDEAVAYGAAVQAAIL GDK EAVQDLLLLDV PLSLGLETAGGVMT LIKRNTTIPTKQ+Q F+TYSDNQPGVLIQVYEGER MT+DNN+LGKF+L+G+PPAPRGVPQIEVT+DIDANGILNVSA+++ TG++NKITITNDKGRLSK++I++M+ + E++K DDE QRE++ AKNALE+YA+SMKQTVED  +KSK+S+ D+K I++KC ET +WLD NQTAEKDE+E R KELE +CNPI++K++Q
Sbjct:  109 KVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKHEAVQDLLLLDVAPLSLGLETAGGVMTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKQNKITITNDKGRLSKDEIERMVQEAERYKQDDERQRERVGAKNALESYAFSMKQTVEDEQVKSKLSESDRKLILDKCRETSEWLDANQTAEKDEFEFRQKELERVCNPIMTKLHQ 376          
BLAST of Heat shock cognate 70 kDa protein vs. TrEMBL
Match: A0A1S8WJU1 (Putative chaperone protein DnaK (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_09685 PE=3 SV=1)

HSP 1 Score: 404.831 bits (1039), Expect = 5.100e-134
Identity = 213/268 (79.48%), Postives = 246/268 (91.79%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            K+QKLLQDFFNGKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDV PLSLGLETAGGVMT LIKRNTTIPTKQ+Q F+TYSDNQPGVLIQVYEGER MT+DNN+LGKF+L+G+PPAPRGVPQIEVT+DIDANGILNVSA+++ TG++NKITITNDKGRLSK++ID+M++D EK+K DDE+QR+++ AKNALE+YAYSMKQTVED  +K KISD D+K I +KCSE I W+D NQTAEKDEYE + KELE +CNPII+K+YQ
Sbjct:  343 KVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSEVVQDLLLLDVAPLSLGLETAGGVMTTLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKQNKITITNDKGRLSKDEIDRMVADAEKYKADDEHQRDRVAAKNALESYAYSMKQTVEDEKVKDKISDSDRKLISDKCSEVISWVDGNQTAEKDEYEHKQKELEKVCNPIITKMYQ 610          
BLAST of Heat shock cognate 70 kDa protein vs. TrEMBL
Match: A0A4S2MBF8 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001273 PE=3 SV=1)

HSP 1 Score: 404.831 bits (1039), Expect = 7.068e-134
Identity = 213/268 (79.48%), Postives = 245/268 (91.42%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            K+QKLLQDFFNGKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDV PLSLGLETAGGVMT LIKRNTTIPTKQ+Q F+TYSDNQPGVLIQVYEGER MT+DNN+LGKF+L+G+PPAPRGVPQIEVT+DIDANGILNVSA+++ TG++NKITITNDKGRLSK++ID+M++D EK+K DDE+QR+++ AKNALE YAYSMKQTVED  +K KISD D+K I +KCSE I W+D NQTAEKDEYE + KELE +CNPII+K+YQ
Sbjct:  343 KVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSEVVQDLLLLDVAPLSLGLETAGGVMTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKQNKITITNDKGRLSKDEIDRMVADAEKYKADDEHQRDRVAAKNALECYAYSMKQTVEDDKVKDKISDSDRKLISDKCSEVISWVDGNQTAEKDEYEHKQKELEKVCNPIITKMYQ 610          
BLAST of Heat shock cognate 70 kDa protein vs. TrEMBL
Match: A0A074ZLZ6 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_06061 PE=3 SV=1)

HSP 1 Score: 403.675 bits (1036), Expect = 1.627e-133
Identity = 212/268 (79.10%), Postives = 245/268 (91.42%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            K+QKLLQDFFNGKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDV PLSLGLETAGGVMT LIKRNTTIPTKQ+Q F+TYSDNQPGVLIQVYEGER MT+DNN+LGKF+L+G+PPAPRGVPQIEVT+DIDANGILNVSA+++ TG++NKITITNDKGRLSK++ID+M++D EK+K DDE+QR+++ AKNALE+YAYSMKQTVED  +K KIS+ D+K I  KCSE I W+D NQTAEKDEYE + KELE +CNPII+K+YQ
Sbjct:  343 KVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSEVVQDLLLLDVAPLSLGLETAGGVMTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKQNKITITNDKGRLSKDEIDRMVADAEKYKADDEHQRDRVAAKNALESYAYSMKQTVEDEKVKDKISESDRKLISEKCSEVISWVDGNQTAEKDEYEHKQKELEKVCNPIITKMYQ 610          
BLAST of Heat shock cognate 70 kDa protein vs. TrEMBL
Match: A0A419PJF6 (Heat shock cognate 71 kDa protein OS=Clonorchis sinensis OX=79923 GN=Hspa8 PE=3 SV=1)

HSP 1 Score: 403.29 bits (1035), Expect = 3.151e-133
Identity = 211/268 (78.73%), Postives = 246/268 (91.79%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            K+QKLLQDFFNGKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDV PLSLGLETAGGVMT LIKRNTTIPTKQ+Q F+TYSDNQPGVLIQVYEGER MT+DNN+LGKF+L+G+PPAPRG+PQIEVT+DIDANGILNVSA+++ TG++NKITITNDKGRLSK++ID+M++D EK+K DDE+QR+++ AKNALE+YAYSMKQTVED  +K KIS+ D+K I +KCSE I W+D NQTAEKDEYE + KELE +CNPII+K+YQ
Sbjct:  343 KVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSEVVQDLLLLDVAPLSLGLETAGGVMTTLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGIPQIEVTFDIDANGILNVSAVDKSTGKQNKITITNDKGRLSKDEIDRMVADAEKYKADDEHQRDRVAAKNALESYAYSMKQTVEDEKVKDKISESDRKLISDKCSEVISWVDGNQTAEKDEYEHKQKELEKVCNPIITKMYQ 610          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Cavefish
Match: hspa8b (heat shock cognate 70 kDa protein-like [Source:NCBI gene;Acc:103047344])

HSP 1 Score: 394.43 bits (1012), Expect = 2.602e-133
Identity = 209/268 (77.99%), Postives = 246/268 (91.79%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            KIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDVTPLSLG+ETAGGVMT+LIKRNTTIPTKQ+Q F+TYSDNQPGVLIQVYEGER MTKDNN+LGKF+LTG+PPAPRGVPQIEVT+DIDANGI+NVSA+++ TG+ENKITITNDKGRLSKE+I++M+ D EK+K +D+ QR+K+ AKN LE+YA++MK TVED  +K KISD D++ I++KC+E I WLD+NQTAEKDE+E + KELE +CNPII+K+YQ
Sbjct:  345 KIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILAGDKSENVQDLLLLDVTPLSLGIETAGGVMTILIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEEIERMVQDAEKYKAEDDVQRDKVAAKNGLESYAFNMKSTVEDEKLKGKISDEDKQKILDKCNEVISWLDKNQTAEKDEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Cavefish
Match: hspa8 (heat shock cognate 71 kDa protein [Source:NCBI gene;Acc:103043364])

HSP 1 Score: 389.423 bits (999), Expect = 2.083e-131
Identity = 207/268 (77.24%), Postives = 246/268 (91.79%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            KIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDVTPLSLG+ETAGGVMTVLIKRNTTIPTKQ+Q F+TYSDNQPGVLIQVYEGER MTKDNN+LGKF+LTG+PPAPRGVPQIEVT+DIDANGI+NVSA ++ TG+ENKITITNDKGRLSKE I++M+ + EK+K +D+ QR+K+++KN+LE+YA++MK TVED  +K KISD D++ I++KC+E I WLD+NQTAE+DE+E + KELE +CNPII+K+YQ
Sbjct:  345 KIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAADKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSSKNSLESYAFNMKSTVEDEKLKGKISDEDKQKIMDKCNEVISWLDKNQTAERDEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Cavefish
Match: hsc70 (heat shock cognate 71 kDa protein-like [Source:NCBI gene;Acc:103045816])

HSP 1 Score: 388.652 bits (997), Expect = 5.577e-131
Identity = 208/268 (77.61%), Postives = 245/268 (91.42%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            KIQKLLQDFFNG++LNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDVTPLSLG+ETAGGVMTVLIKRNTTIPTKQ+Q F+TYSDNQPGVLIQVYEGER MTKDNNILGKF+LTG+PPAPRGVPQIEVT+DIDANGILNVSA+++ TG+ENKITITNDKGRLSKE I++M+ + ++++ +DE QREK+T+KN LE+ A++MK TVED  +K KIS  D+K+IV+KC+E I WLD+NQTAEK+EYE + KELE +CNPII+K+YQ
Sbjct:  345 KIQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNILGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEADQYRAEDEAQREKVTSKNTLESLAFNMKSTVEDEKLKDKISAEDKKTIVDKCNEVIAWLDRNQTAEKEEYEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Cavefish
Match: ENSAMXT00000004733.2 (pep primary_assembly:Astyanax_mexicanus-2.0:20:27541457:27560661:-1 gene:ENSAMXG00000004628.2 transcript:ENSAMXT00000004733.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 386.726 bits (992), Expect = 2.563e-130
Identity = 206/268 (76.87%), Postives = 246/268 (91.79%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            KIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDVTPLSLG+ETAGGVMT LIKRNTTIPTKQ+Q F+TYSDNQPGVLIQVYEGER MTKDNN+LGKF+LTG+PPAPRGVPQIEVT+DIDANGILNVSA+++ TG+ENKITITNDKGRLSKE I++M+ + EK+K +D+ QR+K+++KN+LE+YA++MK TVED  ++ KISD D++ I++KC+E I WLD+NQTAEK+EYE + +ELE +CNPII+K+YQ
Sbjct:  345 KIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSSKNSLESYAFNMKSTVEDDKLQGKISDEDKQKILDKCNEIISWLDKNQTAEKEEYEHQQQELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Cavefish
Match: hspa1b (heat shock protein family A (Hsp70) member 1B [Source:ZFIN;Acc:ZDB-GENE-060503-867])

HSP 1 Score: 376.711 bits (966), Expect = 1.567e-126
Identity = 201/268 (75.00%), Postives = 240/268 (89.55%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            KIQKLLQ+FFNG++LNKSINPDEAVAYGAAVQAAIL GD SE VQDLLLLDV PLSLG+ETAGGVMT LIKRNTTIP KQ+Q+FSTYSDNQPGVLIQVYEGER MTKDNN+LGKF+LTG+PPAPRGVPQIEVT+DIDANGILNVSAI++ TG+ENKITITNDKGRLSKE+I++M+ + +K++ +DE QREK+ AKN LE+YA+++K +VE+  +K KIS+ D+K +++KC E I WL+ NQ AEK+EYE   KELES+CNPIISK+YQ
Sbjct:  345 KIQKLLQEFFNGRDLNKSINPDEAVAYGAAVQAAILMGDTSENVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPNKQTQIFSTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIDKSTGKENKITITNDKGRLSKEEIERMVQEADKYRAEDEIQREKVAAKNNLESYAFNVKNSVEEEKLKGKISEDDKKKVIDKCKEVITWLENNQLAEKEEYEHYQKELESVCNPIISKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Sea Lamprey
Match: hspa5 (heat shock protein 5 [Source:NCBI gene;Acc:378848])

HSP 1 Score: 280.796 bits (717), Expect = 1.047e-89
Identity = 155/268 (57.84%), Postives = 213/268 (79.48%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDA-NIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIY 801
            KIQ+L+++ FNGKE ++ INPDEAVAYGAAVQA +L G+ +    DL+LLDV PL+LG+ET GGVMT LI RNT +PTK+SQ+FST +DNQP V IQV+EGER MTKDN++LGKFDLTG+PPAPRGVPQIEVT++ID NGIL VSA ++GTG +NKITITND+ RL+ E+I++M+SD E+F +DD+  +E++ A+N LE+YAYS+K  + D   +  K+SD D++++     + I WL+ +Q A+ D+++ + KELE +  PI+SK+Y
Sbjct:  375 KIQQLVKELFNGKEPSRGINPDEAVAYGAAVQAGVLSGEDNTG--DLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTAADNQPTVTIQVFEGERPMTKDNHLLGKFDLTGIPPAPRGVPQIEVTFEIDVNGILRVSAEDKGTGNKNKITITNDQNRLTPEEIERMVSDAERFADDDKRVKERVEARNELESYAYSLKNQIGDKEKLGGKLSDEDRETVEKAVEDKIAWLEGHQEADTDDFKAQKKELEEVVQPIVSKLY 640          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Sea Lamprey
Match: hspa9 (heat shock protein 9 [Source:ZFIN;Acc:ZDB-GENE-030828-12])

HSP 1 Score: 181.415 bits (459), Expect = 2.823e-52
Identity = 114/211 (54.03%), Postives = 157/211 (74.41%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVED 633
            K+Q+ +Q+ F G+  +K++NPDEAVA GAA+Q  +L GD    V D+LLLDVTPLSLG+ET GGV T LI RNTTIPTK+SQVFST +D Q  V I+V++GER M  DN  LG+F L G+PPAPRGVPQIEVT+DIDANGI++VSA ++GTGRE +I I +  G LSK++I+ M+ + EK+  +D  +++++ A N  E   + ++  +E+
Sbjct:  394 KVQQTVQEVF-GRAPSKAVNPDEAVAIGAAIQGGVLAGD----VTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVFQGEREMAGDNKNLGQFTLVGVPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGG-LSKDEIENMVKNAEKYAEEDRRRKDRVEAVNQAEGIVHDIESKMEE 598          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Yeast
Match: SSA3 (ATPase involved in protein folding and the response to stress; plays a role in SRP-dependent cotranslational protein-membrane targeting and translocation; member of the heat shock protein 70 (HSP70) family; localized to the cytoplasm; SSA3 has a paralog, SSA4, that arose from the whole genome duplication [Source:SGD;Acc:S000000171])

HSP 1 Score: 343.969 bits (881), Expect = 1.730e-114
Identity = 184/267 (68.91%), Postives = 226/267 (84.64%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIY 801
            KIQKL+ DFFNGKE N+SINPDEAVAYGAAVQAAIL GD+S   QDLLLLDV PLSLG+ETAGG+MT LI RN+TIPTK+S+ FSTY+DNQPGVLIQV+EGERT TKDNN+LGKF+L+G+PPAPRGVPQI+VT+DIDANGILNVSA+E+GTG+ NKITITNDKGRLSK+ ID+M+S+ EK++ DDE + E++ AKN LE+YA+++K T+ +A+ K K+ + D K +     ETI WLD +Q A  DEY+DR KELE I NPI++K Y
Sbjct:  343 KIQKLVSDFFNGKEPNRSINPDEAVAYGAAVQAAILTGDQSTKTQDLLLLDVAPLSLGIETAGGIMTKLIPRNSTIPTKKSETFSTYADNQPGVLIQVFEGERTRTKDNNLLGKFELSGIPPAPRGVPQIDVTFDIDANGILNVSALEKGTGKSNKITITNDKGRLSKDDIDRMVSEAEKYRADDEREAERVQAKNQLESYAFTLKNTINEASFKEKVGEDDAKRLETASQETIDWLDASQAASTDEYKDRQKELEGIANPIMTKFY 609          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Yeast
Match: SSA4 (Heat shock protein that is highly induced upon stress; plays a role in SRP-dependent cotranslational protein-membrane targeting and translocation; member of the HSP70 family; cytoplasmic protein that concentrates in nuclei upon starvation; SSA4 has a paralog, SSA3, that arose from the whole genome duplication [Source:SGD;Acc:S000000905])

HSP 1 Score: 341.273 bits (874), Expect = 1.486e-113
Identity = 181/267 (67.79%), Postives = 225/267 (84.27%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIY 801
            K+QKL+ DFFNGKE N+SINPDEAVAYGAAVQAAIL GD+S   QDLLLLDV PLSLG+ETAGG+MT LI RN+TIPTK+S+VFSTY+DNQPGVLIQV+EGERT TKDNN+LGKF+L+G+PPAPRGVPQIEVT+DIDANGILNVSA+E+GTG+ NKITITNDKGRLSKE IDKM+++ EKFK +DE + +++ AKN LE+YA+++K +V + N K K+ + D + +     + I WLD +Q A  +EY++R KELE + NPI+SK Y
Sbjct:  343 KVQKLVSDFFNGKEPNRSINPDEAVAYGAAVQAAILTGDQSSTTQDLLLLDVAPLSLGIETAGGIMTKLIPRNSTIPTKKSEVFSTYADNQPGVLIQVFEGERTRTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKSNKITITNDKGRLSKEDIDKMVAEAEKFKAEDEQEAQRVQAKNQLESYAFTLKNSVSENNFKEKVGEEDARKLEAAAQDAINWLDASQAASTEEYKERQKELEGVANPIMSKFY 609          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Yeast
Match: SSA1 (ATPase involved in protein folding and NLS-directed nuclear transport; member of HSP70 family; required for ubiquitin-dependent degradation of short-lived proteins; forms chaperone complex with Ydj1p; localized to nucleus, cytoplasm, cell wall; 98% identical to paralog Ssa2p with different functional specificity in propagation of yeast [URE3] prions, vacuolar-mediated degradations of gluconeogenesis enzymes; general targeting factor of Hsp104p to prion fibrils [Source:SGD;Acc:S000000004])

HSP 1 Score: 320.472 bits (820), Expect = 1.631e-105
Identity = 182/268 (67.91%), Postives = 228/268 (85.07%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            K+QKL+ D+FNGKE N+SINPDEAVAYGAAVQAAIL GD+S   QDLLLLDV PLSLG+ETAGGVMT LI RN+TIPTK+S++FSTY+DNQPGVLIQV+EGER  TKDNN+LGKF+L+G+PPAPRGVPQIEVT+D+D+NGILNVSA+E+GTG+ NKITITNDKGRLSKE I+KM+++ EKFK +DE + ++I +KN LE+ AYS+K T+ +A    K+   D+ ++  K  ETI WLD N TA K+E++D+LKEL+ I NPI+SK+YQ
Sbjct:  342 KVQKLVTDYFNGKEPNRSINPDEAVAYGAAVQAAILTGDESSKTQDLLLLDVAPLSLGIETAGGVMTKLIPRNSTIPTKKSEIFSTYADNQPGVLIQVFEGERAKTKDNNLLGKFELSGIPPAPRGVPQIEVTFDVDSNGILNVSAVEKGTGKSNKITITNDKGRLSKEDIEKMVAEAEKFKEEDEKESQRIASKNQLESIAYSLKNTISEAG--DKLEQADKDTVTKKAEETISWLDSNTTASKEEFDDKLKELQDIANPIMSKLYQ 607          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Yeast
Match: SSA2 (HSP70 family ATP-binding protein; involved in protein folding, vacuolar import of proteins; required for ubiquitin-dependent degradation of short-lived proteins; associated with chaperonin-containing T-complex; 98% identical to paralog Ssa1p with distinct functional specificity in propagation of yeast [URE3] prions and vacuolar-mediated degradation of gluconeogenesis enzymes; binds tRNA, has role in tRNA nuclear import during starvation [Source:SGD;Acc:S000003947])

HSP 1 Score: 319.316 bits (817), Expect = 4.280e-105
Identity = 182/268 (67.91%), Postives = 228/268 (85.07%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            K+QKL+ D+FNGKE N+SINPDEAVAYGAAVQAAIL GD+S   QDLLLLDV PLSLG+ETAGGVMT LI RN+TIPTK+S+VFSTY+DNQPGVLIQV+EGER  TKDNN+LGKF+L+G+PPAPRGVPQIEVT+D+D+NGILNVSA+E+GTG+ NKITITNDKGRLSKE I+KM+++ EKFK +DE + ++I +KN LE+ AYS+K T+ +A    K+   D+ ++  K  ETI WLD N TA K+E++D+LKEL+ + NPI+SK+YQ
Sbjct:  342 KVQKLVTDYFNGKEPNRSINPDEAVAYGAAVQAAILTGDESSKTQDLLLLDVAPLSLGIETAGGVMTKLIPRNSTIPTKKSEVFSTYADNQPGVLIQVFEGERAKTKDNNLLGKFELSGIPPAPRGVPQIEVTFDVDSNGILNVSAVEKGTGKSNKITITNDKGRLSKEDIEKMVAEAEKFKEEDEKESQRIASKNQLESIAYSLKNTISEAG--DKLEQADKDAVTKKAEETIAWLDSNTTATKEEFDDQLKELQEVANPIMSKLYQ 607          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Yeast
Match: KAR2 (ATPase involved in protein import into the ER; also acts as a chaperone to mediate protein folding in the ER and may play a role in ER export of soluble proteins; regulates the unfolded protein response via interaction with Ire1p [Source:SGD;Acc:S000003571])

HSP 1 Score: 275.018 bits (702), Expect = 1.298e-87
Identity = 147/268 (54.85%), Postives = 214/268 (79.85%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQN-QTAEKDEYEDRLKELESICNPIISKIY 801
            K+Q+LL+ +F+GK+ +K INPDEAVAYGAAVQA +L G+  E V+D++LLDV  L+LG+ET GGVMT LIKRNT IPTK+SQ+FST  DNQP V+I+VYEGER M+KDNN+LGKF+LTG+PPAPRGVPQIEVT+ +DANGIL VSA ++GTG+   ITITNDKGRL++E+ID+M+ + EKF ++D + + K+ ++N LE YA+S+K  V + ++  K+ + D++++++  ++ ++WLD N +TA  ++++++ + L  +  PI SK+Y
Sbjct:  390 KVQQLLESYFDGKKASKGINPDEAVAYGAAVQAGVLSGE--EGVEDIVLLDVNALTLGIETTGGVMTPLIKRNTAIPTKKSQIFSTAVDNQPTVMIKVYEGERAMSKDNNLLGKFELTGIPPAPRGVPQIEVTFALDANGILKVSATDKGTGKSESITITNDKGRLTQEEIDRMVEEAEKFASEDASIKAKVESRNKLENYAHSLKNQV-NGDLGEKLEEEDKETLLDAANDVLEWLDDNFETAIAEDFDEKFESLSKVAYPITSKLY 654          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Nematostella
Match: EDO37280 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG65])

HSP 1 Score: 375.17 bits (962), Expect = 3.860e-126
Identity = 197/268 (73.51%), Postives = 240/268 (89.55%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            KIQK+LQ+ F GKELNKSINPDEAVAYGAAVQAAIL GDK + V+DLLLLDV PLS+G+ETAGGVM+VLIKRN+TIPTKQ+Q F+TYSDNQPGVLIQV+EGER+MT  NN+LGKF+LTG+PPAPRGVPQIEVT+DIDANGILNVSA+++ TG+ENKITITNDKGRLSKE I++M+++  K+K +DE QR++I  KN+LE+YAYSMK TVED  +K KIS+ D+K+I++KC+E +KWLD NQTAEKDE+E   KELE +CNPII+K+YQ
Sbjct:  347 KIQKMLQELFGGKELNKSINPDEAVAYGAAVQAAILHGDKDDTVKDLLLLDVAPLSMGIETAGGVMSVLIKRNSTIPTKQTQTFTTYSDNQPGVLIQVFEGERSMTAHNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVNEASKYKEEDEKQRDRIQTKNSLESYAYSMKSTVEDDKVKDKISEEDKKAILDKCTEVLKWLDTNQTAEKDEFEYHQKELEKVCNPIITKLYQ 614          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Nematostella
Match: EDO30323 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T144])

HSP 1 Score: 359.377 bits (921), Expect = 4.218e-120
Identity = 189/268 (70.52%), Postives = 235/268 (87.69%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            KIQ LLQ+FFNGKELNKSINPDEAVAYGAAVQAAIL GDKSEA QDLLLLDV PL+LGLETAGGVMT  IKRNTTIPTKQ+Q F+TYSDNQ  VLIQVYEGER++TKDNN+LGKF+L+G+PPAPRGVPQI+VT+D+D+NGILNVSA+++ TG+ENKITITNDKGRLSKE I++M+ + EKFK  DE  RE+I +KN+LE+YA+SMK T+ED  +K K+S+ +++ ++++C  T+ WL+ NQ+AEK+E +   KELE +CNPII+K+YQ
Sbjct:  346 KIQSLLQNFFNGKELNKSINPDEAVAYGAAVQAAILHGDKSEATQDLLLLDVAPLTLGLETAGGVMTAAIKRNTTIPTKQTQTFTTYSDNQTSVLIQVYEGERSLTKDNNLLGKFELSGIPPAPRGVPQIDVTFDVDSNGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVKEAEKFKAADEAVRERIQSKNSLESYAFSMKSTMEDEKVKDKLSEDEREKVISRCKATLDWLEHNQSAEKEEIDAHQKELEGVCNPIITKLYQ 613          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Nematostella
Match: EDO44530 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV88])

HSP 1 Score: 305.834 bits (782), Expect = 1.841e-99
Identity = 170/267 (63.67%), Postives = 226/267 (84.64%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIY 801
            KIQK+L+++F+GK LNKSINPDEAVAYGAAVQAAIL GDKS+ V+D+LL+DV PLSLG+ETAG VMT LI+RN  IPTK +Q F+TYSDNQP V I+V+EGER +TK NN+LGKFDL+G+PPAPRGVPQIEVT+DIDANGILNVSA ++ TG+   ITITNDKGRLSKE+ID+MI+D EK+K++DE QREKI A+N LE+YA+ +K  + + +++ K+S  D+ ++ NK  E + WL++N  AEK+E+E++ KEL+ +C+PI++K++
Sbjct:  346 KIQKMLEEYFSGKSLNKSINPDEAVAYGAAVQAAILSGDKSDEVKDVLLVDVAPLSLGIETAGEVMTKLIERNARIPTKATQTFTTYSDNQPAVTIRVFEGERPLTKHNNLLGKFDLSGIPPAPRGVPQIEVTFDIDANGILNVSAKDKSTGKTGSITITNDKGRLSKEEIDRMINDAEKYKSEDEAQREKIAARNRLESYAFGVKSAISEPSLEGKLSQSDKDTVKNKVEEVLNWLEKNSLAEKEEFEEQEKELQRVCSPIMAKVH 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Nematostella
Match: EDO33296 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSL5])

HSP 1 Score: 271.552 bits (693), Expect = 6.062e-86
Identity = 155/268 (57.84%), Postives = 207/268 (77.24%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDA-NIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIY 801
            K+Q+L++DFF GKE ++ INPDEAVAYGAAVQA +L G+  E   +++LLDV PL+LG+ET GGVMT LI RNT IPTK+SQVFST +DNQ  V IQV+EGER MTKDN+ LGKFDL G+PPAPRGVPQIEVT++ID NGIL VSA ++GTG + KITITND+ RL+ E I++M++D EKF ++D+  +EK+ A+N LE+YAYS+K  V D   +  K+S+ D+K+I     + I W+D+NQ A  ++++   KELE +  PI+SK+Y
Sbjct:  374 KVQQLVKDFFEGKEPSRGINPDEAVAYGAAVQAGVLGGE--EDTGEVVLLDVNPLTLGIETVGGVMTKLISRNTVIPTKKSQVFSTAADNQNTVTIQVFEGERPMTKDNHPLGKFDLNGIPPAPRGVPQIEVTFEIDVNGILRVSAEDKGTGNKEKITITNDQNRLTPEDIERMVNDAEKFADEDKKTKEKVEARNELESYAYSLKNQVGDKEKLGGKLSEDDKKTITEAVEKAISWMDKNQDASVEDFKKEKKELEDVVQPIVSKLY 639          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Nematostella
Match: EDO47723 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLN7])

HSP 1 Score: 182.57 bits (462), Expect = 1.452e-52
Identity = 117/211 (55.45%), Postives = 155/211 (73.46%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVED 633
            K+Q+ +QD F G+  +K++NPDEAVA GAA+Q  +L GD    V+D+LLLDVTPLSLG+ET GGV T LI RNTTIPTK+SQVFST +D Q  V I+V++GER M  DN +LG+F L G+PPAPRGVPQ+EVT+DIDANGI+NVSA ++GTGRE +I I +  G LSK+ I+ MI + EK+   D+ ++E   A N  E   +  +  +E+
Sbjct:  353 KVQQTVQDIF-GRVPSKAVNPDEAVAIGAAIQGGVLAGD----VKDVLLLDVTPLSLGIETLGGVFTKLITRNTTIPTKKSQVFSTAADGQTQVEIKVFQGEREMAIDNKLLGQFQLVGIPPAPRGVPQVEVTFDIDANGIVNVSARDKGTGREQQIVIQSSGG-LSKDAIENMIKEAEKYAEADKQKKETTEAVNQAEGMIHDTETKMEE 557          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Medaka
Match: hsc70 (heat shock protein 70 cognate [Source:NCBI gene;Acc:100049425])

HSP 1 Score: 391.349 bits (1004), Expect = 4.604e-132
Identity = 208/268 (77.61%), Postives = 245/268 (91.42%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            KIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDVTPLSLG+ETAGGVMTVLIKRNTTIPTKQ+Q F+TYSDNQPGVLIQVYEGER MTKDNN+LGKF+LTG+PPAPRGVPQIEVT+DIDANGI+NVSA+++ TG+ENKITITNDKGRLSKE I++M+ + EK+K +D+ QR+K++AKN LE+YA++MK TVED  +  KISD D++ I++KC+E I WLD+NQTAE+DEYE + KELE +CNPII+K+YQ
Sbjct:  342 KIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVEDEKLAGKISDEDKQKILDKCNEVISWLDKNQTAERDEYEHQQKELEKVCNPIITKLYQ 609          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Medaka
Match: hsc70 (heat shock protein 70 cognate [Source:NCBI gene;Acc:100049425])

HSP 1 Score: 390.963 bits (1003), Expect = 5.022e-132
Identity = 208/268 (77.61%), Postives = 245/268 (91.42%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            KIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDVTPLSLG+ETAGGVMTVLIKRNTTIPTKQ+Q F+TYSDNQPGVLIQVYEGER MTKDNN+LGKF+LTG+PPAPRGVPQIEVT+DIDANGI+NVSA+++ TG+ENKITITNDKGRLSKE I++M+ + EK+K +D+ QR+K++AKN LE+YA++MK TVED  +  KISD D++ I++KC+E I WLD+NQTAE+DEYE + KELE +CNPII+K+YQ
Sbjct:  339 KIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVEDEKLAGKISDEDKQKILDKCNEVISWLDKNQTAERDEYEHQQKELEKVCNPIITKLYQ 606          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Medaka
Match: hsp70-3 (heat shock protein 70 [Source:NCBI gene;Acc:100125493])

HSP 1 Score: 390.578 bits (1002), Expect = 1.751e-131
Identity = 210/268 (78.36%), Postives = 245/268 (91.42%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            KIQKLLQD FNG++LNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDVTPLSLG+ETAGGVMTVLIKRNTTIPTKQ+Q F+TYSDNQPGVLIQVYEGER MTKDNNILGKF+LTG+PPAPRGVPQIEVT+DIDANGILNVSA+++ TG+ENKITITNDKGRLSKE I++M+ + E+FK +DE+QR+KITAKN+LE+ A++MK TV+D  ++ KIS  D+K+IV+KC+E I WLD+NQ AEKDEYE + KELE +CNPIISK+YQ
Sbjct:  345 KIQKLLQDLFNGRDLNKSINPDEAVAYGAAVQAAILAGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNILGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEQFKAEDESQRDKITAKNSLESLAFNMKSTVDDEKLQDKISSEDKKTIVDKCNEIIAWLDKNQMAEKDEYEHQQKELEKVCNPIISKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Medaka
Match: hsc70 (heat shock protein 70 cognate [Source:NCBI gene;Acc:100049425])

HSP 1 Score: 390.578 bits (1002), Expect = 3.152e-131
Identity = 208/268 (77.61%), Postives = 245/268 (91.42%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            KIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDVTPLSLG+ETAGGVMTVLIKRNTTIPTKQ+Q F+TYSDNQPGVLIQVYEGER MTKDNN+LGKF+LTG+PPAPRGVPQIEVT+DIDANGI+NVSA+++ TG+ENKITITNDKGRLSKE I++M+ + EK+K +D+ QR+K++AKN LE+YA++MK TVED  +  KISD D++ I++KC+E I WLD+NQTAE+DEYE + KELE +CNPII+K+YQ
Sbjct:  395 KIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVEDEKLAGKISDEDKQKILDKCNEVISWLDKNQTAERDEYEHQQKELEKVCNPIITKLYQ 662          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Medaka
Match: hsp70-3 (heat shock protein 70 [Source:NCBI gene;Acc:100125493])

HSP 1 Score: 389.037 bits (998), Expect = 4.527e-131
Identity = 210/268 (78.36%), Postives = 245/268 (91.42%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            KIQKLLQD FNG++LNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDVTPLSLG+ETAGGVMTVLIKRNTTIPTKQ+Q F+TYSDNQPGVLIQVYEGER MTKDNNILGKF+LTG+PPAPRGVPQIEVT+DIDANGILNVSA+++ TG+ENKITITNDKGRLSKE I++M+ + E+FK +DE+QR+KITAKN+LE+ A++MK TV+D  ++ KIS  D+K+IV+KC+E I WLD+NQ AEKDEYE + KELE +CNPIISK+YQ
Sbjct:  362 KIQKLLQDLFNGRDLNKSINPDEAVAYGAAVQAAILAGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNILGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEQFKAEDESQRDKITAKNSLESLAFNMKSTVDDEKLQDKISSEDKKTIVDKCNEIIAWLDKNQMAEKDEYEHQQKELEKVCNPIISKLYQ 629          
BLAST of Heat shock cognate 70 kDa protein vs. Planmine SMEST
Match: SMESG000040632.1 (SMESG000040632.1)

HSP 1 Score: 392.889 bits (1008), Expect = 7.157e-133
Identity = 205/268 (76.49%), Postives = 243/268 (90.67%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            KIQKLLQD F+GKELNKSINPDEAVAYGAAVQAAIL GDKSEAVQDLLLLDV PLSLG+ETAGGVMT LIKRNTTIPTKQ+Q F+TYSDNQPGVLIQVYEGER MT+DNN+LGKF+L+G+PPAPRGVPQ+EVT+DIDANGILNVSA+E+ TG+ENKITI+NDKGRLSK+ I++M+S+ EK+K  DE Q+E++TAKNALE+YAY MK T+ED  +K K+S+PD+K+IV+KC+E I WL+ NQTAEK+EYE   KELE +CNPI++K YQ
Sbjct:  345 KIQKLLQDLFHGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. Planmine SMEST
Match: SMESG000081110.1 (SMESG000081110.1)

HSP 1 Score: 387.882 bits (995), Expect = 1.751e-131
Identity = 228/268 (85.07%), Postives = 230/268 (85.82%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            KIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILKGDKSEAVQDLLLLDVTPLSLGLETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIE         +LN                          +   MISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ
Sbjct:  343 KIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILKGDKSEAVQDLLLLDVTPLSLGLETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIE---------LLN--------------------------EAQDMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 575          
BLAST of Heat shock cognate 70 kDa protein vs. Planmine SMEST
Match: SMESG000051815.1 (SMESG000051815.1)

HSP 1 Score: 387.111 bits (993), Expect = 1.210e-130
Identity = 204/268 (76.12%), Postives = 241/268 (89.93%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            KIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAIL GDKSEAVQDLLLLDV PLSLG+ETAGGVMT LIKRNTTIPTKQ+Q+F+TYSDNQPGVLIQVYEGER MTKDNN+LGKF+L G+PPAPRGVPQIEVT+DIDANGILNVSA+E+GTG+ENKITITNDKGRLSK+ I++M+++ EK+K +DE+Q+E+I AKN+LE+Y+Y MK TVED  +K KIS+ D+K I+ KC E I WL++NQ A KDE++   KELE +CNPI++K+YQ
Sbjct:  344 KIQKLLQDLFNGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNEAEKYKKEDEDQKERIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQ 611          
BLAST of Heat shock cognate 70 kDa protein vs. Planmine SMEST
Match: SMESG000051570.1 (SMESG000051570.1)

HSP 1 Score: 383.645 bits (984), Expect = 3.033e-129
Identity = 203/268 (75.75%), Postives = 240/268 (89.55%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            KIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAIL GDKSEAVQDLLLLDV PLSLG+ETAGGVMT LIKRNTTIPTKQ+Q+F+TYSDNQPGVLIQVYEGER MTKDNN+LGKF+L G+PPAPRGVPQIEVT+DIDANGILNVSA+E+GTG+ENKITITNDKGRLSK+ I++M+++ EK+K +DE Q+++I  KN+LE+YAY MK TVED  +K KIS+ D+K I++KC E I WL++NQ A K+E+E   KELE +CNPI++K+YQ
Sbjct:  344 KIQKLLQDLFNGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNEAEKYKKEDEEQKDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 611          
BLAST of Heat shock cognate 70 kDa protein vs. Planmine SMEST
Match: SMESG000051567.1 (SMESG000051567.1)

HSP 1 Score: 383.645 bits (984), Expect = 3.033e-129
Identity = 203/268 (75.75%), Postives = 240/268 (89.55%), Query Frame = 1
Query:    1 KIQKLLQDFFNGKELNKSINPDEXXXXXXXXXXXILKGDKSEAVQDXXXXXXXXXXXXXETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYEGERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERGTGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALETYAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYEDRLKELESICNPIISKIYQ 804
            KIQKLLQD FNGKELNKSINPDEAVAYGAAVQAAIL GDKSEAVQDLLLLDV PLSLG+ETAGGVMT LIKRNTTIPTKQ+Q+F+TYSDNQPGVLIQVYEGER MTKDNN+LGKF+L G+PPAPRGVPQIEVT+DIDANGILNVSA+E+GTG+ENKITITNDKGRLSK+ I++M+++ EK+K +DE Q+++I  KN+LE+YAY MK TVED  +K KIS+ D+K I++KC E I WL++NQ A K+E+E   KELE +CNPI++K+YQ
Sbjct:  344 KIQKLLQDLFNGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNEAEKYKKEDEEQKDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 611          
The following BLAST results are available for this feature:
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HSPA81.339e-13477.24heat shock protein family A (Hsp70) member 8 [Sour... [more]
HSPA87.658e-13377.24heat shock protein family A (Hsp70) member 8 [Sour... [more]
HSPA81.787e-13177.24heat shock protein family A (Hsp70) member 8 [Sour... [more]
HSPA82.776e-13177.24heat shock protein family A (Hsp70) member 8 [Sour... [more]
HSPA82.776e-13177.24heat shock protein family A (Hsp70) member 8 [Sour... [more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hsp-11.105e-12474.25Heat shock 70 kDa protein A [Source:UniProtKB/Swi... [more]
hsp-11.105e-12474.25Heat shock 70 kDa protein A [Source:UniProtKB/Swi... [more]
F44E5.59.024e-9761.19pep chromosome:WBcel235:II:11759681:11761808:1 gen... [more]
F44E5.59.024e-9761.19pep chromosome:WBcel235:II:11759640:11761853:1 gen... [more]
F44E5.49.024e-9761.19pep chromosome:WBcel235:II:11757106:11759323:-1 ge... [more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hsc70-43.277e-13075.75gene:FBgn0266599 transcript:FBtr0083059[more]
Hsc70-43.277e-13075.75gene:FBgn0266599 transcript:FBtr0337053[more]
Hsc70-43.277e-13075.75gene:FBgn0266599 transcript:FBtr0083058[more]
Hsc70-43.277e-13075.75gene:FBgn0266599 transcript:FBtr0083060[more]
Hsc70-43.277e-13075.75gene:FBgn0266599 transcript:FBtr0083057[more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspa1b6.502e-13478.36heat shock protein family A (Hsp70) member 1B [Sou... [more]
hspa83.205e-13176.87heat shock protein 8 [Source:NCBI gene;Acc:573376][more]
hspa87.604e-13176.87heat shock protein 8 [Source:NCBI gene;Acc:573376][more]
hspa87.604e-13176.87heat shock protein 8 [Source:NCBI gene;Acc:573376][more]
hspa87.604e-13176.87heat shock protein 8 [Source:NCBI gene;Acc:573376][more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000025573.11.656e-13475.51heat shock protein family A (Hsp70) member 1B [Sou... [more]
tmed102.764e-13379.10transmembrane emp24-like trafficking protein 10 (y... [more]
wdr264.161e-13377.99WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-99... [more]
wdr265.694e-13377.99WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-99... [more]
wdr268.553e-13377.99WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-99... [more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hspa81.175e-13177.24heat shock protein 8 [Source:MGI Symbol;Acc:MGI:10... [more]
Hspa81.603e-13177.24heat shock protein 8 [Source:MGI Symbol;Acc:MGI:10... [more]
Hspa1l4.167e-12874.25heat shock protein 1-like [Source:MGI Symbol;Acc:M... [more]
Hspa26.784e-12775.75heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96... [more]
Hspa26.784e-12775.75heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96... [more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q24789|HSP70_ECHGR2.098e-13176.49Heat shock cognate 70 kDa protein OS=Echinococcus ... [more]
sp|Q9U639|HSP7D_MANSE9.517e-13177.24Heat shock 70 kDa protein cognate 4 OS=Manduca sex... [more]
sp|P63018|HSP7C_RAT1.121e-13077.24Heat shock cognate 71 kDa protein OS=Rattus norveg... [more]
sp|P63017|HSP7C_MOUSE1.121e-13077.24Heat shock cognate 71 kDa protein OS=Mus musculus ... [more]
sp|Q71U34|HSP7C_SAGOE1.333e-13077.24Heat shock cognate 71 kDa protein OS=Saguinus oedi... [more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183B2D63.158e-13477.24Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A1S8WJU15.100e-13479.48Putative chaperone protein DnaK (Fragment) OS=Opis... [more]
A0A4S2MBF87.068e-13479.48Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A074ZLZ61.627e-13379.10Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A419PJF63.151e-13378.73Heat shock cognate 71 kDa protein OS=Clonorchis si... [more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspa8b2.602e-13377.99heat shock cognate 70 kDa protein-like [Source:NCB... [more]
hspa82.083e-13177.24heat shock cognate 71 kDa protein [Source:NCBI gen... [more]
hsc705.577e-13177.61heat shock cognate 71 kDa protein-like [Source:NCB... [more]
ENSAMXT00000004733.22.563e-13076.87pep primary_assembly:Astyanax_mexicanus-2.0:20:275... [more]
hspa1b1.567e-12675.00heat shock protein family A (Hsp70) member 1B [Sou... [more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
hspa51.047e-8957.84heat shock protein 5 [Source:NCBI gene;Acc:378848][more]
hspa92.823e-5254.03heat shock protein 9 [Source:ZFIN;Acc:ZDB-GENE-030... [more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SSA31.730e-11468.91ATPase involved in protein folding and the respons... [more]
SSA41.486e-11367.79Heat shock protein that is highly induced upon str... [more]
SSA11.631e-10567.91ATPase involved in protein folding and NLS-directe... [more]
SSA24.280e-10567.91HSP70 family ATP-binding protein; involved in prot... [more]
KAR21.298e-8754.85ATPase involved in protein import into the ER; als... [more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO372803.860e-12673.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303234.218e-12070.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO445301.841e-9963.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO332966.062e-8657.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477231.452e-5255.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hsc704.604e-13277.61heat shock protein 70 cognate [Source:NCBI gene;Ac... [more]
hsc705.022e-13277.61heat shock protein 70 cognate [Source:NCBI gene;Ac... [more]
hsp70-31.751e-13178.36heat shock protein 70 [Source:NCBI gene;Acc:100125... [more]
hsc703.152e-13177.61heat shock protein 70 cognate [Source:NCBI gene;Ac... [more]
hsp70-34.527e-13178.36heat shock protein 70 [Source:NCBI gene;Acc:100125... [more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000040632.17.157e-13376.49SMESG000040632.1[more]
SMESG000081110.11.751e-13185.07SMESG000081110.1[more]
SMESG000051815.11.210e-13076.12SMESG000051815.1[more]
SMESG000051570.13.033e-12975.75SMESG000051570.1[more]
SMESG000051567.13.033e-12975.75SMESG000051567.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016800 ID=SMED30016800|Name=Heat shock cognate 70 kDa protein|organism=Schmidtea mediterranea sexual|type=transcript|length=993bp
AAAATTCAGAAATTATTACAAGATTTTTTCAATGGAAAAGAATTGAATAA
ATCTATAAATCCGGATGAGGCGGTTGCCTACGGTGCTGCTGTGCAAGCGG
CAATTTTGAAAGGAGACAAATCCGAAGCTGTTCAAGATCTCTTATTGCTT
GATGTAACTCCTTTATCGTTGGGTTTGGAAACCGCTGGTGGCGTGATGAC
TGTTTTGATTAAACGAAATACAACCATTCCTACAAAACAATCTCAAGTAT
TTTCAACATATTCGGATAATCAACCAGGAGTTTTAATTCAGGTTTATGAA
GGTGAAAGAACAATGACGAAGGATAATAATATACTTGGGAAATTTGATTT
AACTGGACTTCCCCCTGCACCCAGAGGAGTACCTCAAATCGAAGTAACTT
ATGACATAGACGCCAATGGTATTTTAAATGTATCAGCTATTGAACGAGGC
ACAGGACGTGAAAATAAAATAACAATAACCAATGATAAAGGAAGACTAAG
TAAAGAACAAATAGATAAGATGATTTCGGATGGAGAAAAATTTAAAAATG
ATGACGAGAATCAAAGAGAAAAGATAACTGCTAAAAATGCCCTTGAAACT
TATGCATATTCAATGAAACAAACAGTCGAAGATGCCAATATTAAATCTAA
AATATCAGACCCTGATCAGAAGTCAATTGTTAATAAATGTTCGGAAACTA
TAAAATGGTTAGATCAAAATCAAACTGCAGAAAAAGATGAATATGAAGAT
CGCCTTAAAGAATTGGAGTCTATCTGTAATCCCATTATTTCAAAAATATA
CCAAGGTTCACCTTGTGGACCAGGTGGATGTCCAAACACAAATAAACCAG
GAGGCGGTGGTCCAAAAATTGAAGAAGTTGATTAAAAATTTCATTCAAAC
GTGATTTTGGTTTTGAATTTATTAGATAACTGTCTTTTTTATTTTAATAA
ATTTAAGTTAAAATTATTTAATAATAATAAATATATTAACGCT
back to top

protein sequence of SMED30016800-orf-1

>SMED30016800-orf-1 ID=SMED30016800-orf-1|Name=SMED30016800-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=295bp
KIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILKGDKSEAVQDLLLL
DVTPLSLGLETAGGVMTVLIKRNTTIPTKQSQVFSTYSDNQPGVLIQVYE
GERTMTKDNNILGKFDLTGLPPAPRGVPQIEVTYDIDANGILNVSAIERG
TGRENKITITNDKGRLSKEQIDKMISDGEKFKNDDENQREKITAKNALET
YAYSMKQTVEDANIKSKISDPDQKSIVNKCSETIKWLDQNQTAEKDEYED
RLKELESICNPIISKIYQGSPCGPGGCPNTNKPGGGGPKIEEVD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR043129ATPase_NBD
IPR013126Hsp_70_fam
IPR029047HSP70_peptide-bd_sf
IPR029048HSP70_C_sf
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0005524ATP binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 238..258
NoneNo IPR availablePRINTSPR00301HEATSHOCK70coord: 19..39
score: 80.13
coord: 127..143
score: 80.54
coord: 46..65
score: 83.09
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 1..21
e-value: 1.9E-9
score: 38.6
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 22..34
e-value: 1.9E-9
score: 38.6
NoneNo IPR availablePANTHERPTHR19375:SF407HEAT SHOCK COGNATE 71 KDA PROTEIN-RELATEDcoord: 1..276
IPR029047Heat shock protein 70kD, peptide-binding domain superfamilyGENE3DG3DSA:2.60.34.10coord: 36..165
e-value: 2.8E-63
score: 213.3
IPR029047Heat shock protein 70kD, peptide-binding domain superfamilySUPERFAMILYSSF100920Heat shock protein 70kD (HSP70), peptide-binding domaincoord: 43..199
IPR029048Heat shock protein 70kD, C-terminal domain superfamilyGENE3DG3DSA:1.20.1270.10coord: 166..269
e-value: 4.2E-37
score: 128.4
IPR029048Heat shock protein 70kD, C-terminal domain superfamilySUPERFAMILYSSF100934Heat shock protein 70kD (HSP70), C-terminal subdomaincoord: 194..274
IPR013126Heat shock protein 70 familyPFAMPF00012HSP70coord: 1..268
e-value: 4.8E-89
score: 299.2
IPR013126Heat shock protein 70 familyPANTHERPTHR19375HEAT SHOCK PROTEIN 70KDAcoord: 1..276
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 2..37