SMED30016797

Overview
NameSMED30016797
Smed IDSMED30016797
Length (bp)678
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30016797 (SMED30016797) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30016797 (SMED30016797) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30016797 (SMED30016797) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30016797 (SMED30016797) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016797

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30016797SMESG000072479.1 SmedASXL_073039SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30016797SMESG000072479.1 dd_Smed_v6_38695_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30016797 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000867:94545..98000 -3344
v31.000867:97598..102697 -1584
v31.000867:102294..112331 -1520
v31.000867:103497..116311 -1449
v31.000867:104261..104924 +1194
v31.000867:115895..124362 -1193
Homology
BLAST of SMED30016797 vs. Planmine SMEST
Match: SMESG000072479.1 (SMESG000072479.1)

HSP 1 Score: 369.007 bits (946), Expect = 1.397e-117
Identity = 181/192 (94.27%), Postives = 185/192 (96.35%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDKRFRVAITPRSSFLKYLQSEFINCHITPILNTTKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYILSDSFVKSKMIIYIIW 576
            ANISYTVTITP+SSNL FLQNP ITCKIVP+P +NSSQIDFFL+NIKSQFYTRK LTIQI  EKSLVNS ICAVCGNVANMNATQCYILLDKRFRVAITPRSSFLKYLQSEFINCHITPILNTTKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYILSDSFVKSKMIIYIIW
Sbjct: 2197 ANISYTVTITPRSSNLYFLQNPKITCKIVPLPQTNSSQIDFFLTNIKSQFYTRKDLTIQIVSEKSLVNSEICAVCGNVANMNATQCYILLDKRFRVAITPRSSFLKYLQSEFINCHITPILNTTKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYILSDSFVKSKMIIYIIW 2388          

HSP 2 Score: 247.669 bits (631), Expect = 2.497e-75
Identity = 129/181 (71.27%), Postives = 143/181 (79.01%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYILSD 537
            ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILL    + V ITPRSS L +LQ+  I C I P+  T +  ++FFL  I    Y + DL I++  +  LVN  +CAVCGN   MN ++CYIL D
Sbjct: 2107 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLANISYTVTITPRSSNLYFLQNPKITCKIVPLPQTNSSQIDFFLTNIKSQFYTRKDLTIQIVSEKSLVNSEICAVCGNVANMNATQCYILLD 2287          

HSP 3 Score: 231.491 bits (589), Expect = 1.170e-69
Identity = 119/179 (66.48%), Postives = 139/179 (77.65%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPI-LNTTKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            ANISYTVTI PQSSNLNFLQ P ITCKIVP+PPSNSSQIDFFL+NIKSQFYTRKALTIQIAPEKSLVNS ICAVCGNVANMNATQCYIL+    + V ITP+SS L +LQ+  I C I P+  + +  ++FFL  I    Y + DL I+++ +  LVN  +CAVCGN   MN ++CYIL
Sbjct: 1837 ANISYTVTIEPQSSNLNFLQTPKITCKIVPLPPSNSSQIDFFLTNIKSQFYTRKALTIQIAPEKSLVNSKICAVCGNVANMNATQCYILITNISYTVTITPQSSNLNFLQNPEITCKIVPLPPSNSSQIDFFLTNIKSEFYTRKDLTIQIAPEKSLVNSEICAVCGNVANMNATQCYIL 2015          

HSP 4 Score: 229.565 bits (584), Expect = 6.168e-69
Identity = 118/178 (66.29%), Postives = 137/178 (76.97%), Query Frame = 1
Query:    4 NISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPI-LNTTKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            NISYTVTITPQSSNLNFLQNP ITCKIVP+PPSNSSQIDFFL+NIKS+FYTRK LTIQIAPEKSLVNS ICAVCGNVANMNATQCYIL+    + V ITP+SS L +LQ++ I C I P+       ++FFL  I    Y + DL I++  +  LVN  +CAVCGN   MN ++CYIL
Sbjct: 1928 NISYTVTITPQSSNLNFLQNPEITCKIVPLPPSNSSQIDFFLTNIKSEFYTRKDLTIQIAPEKSLVNSEICAVCGNVANMNATQCYILIANISYTVTITPQSSSLNFLQNQTITCKIVPLPPKPFSQIDFFLTNIKSEFYTRKDLTIQIVSEKSLVNSEICAVCGNVANMNATQCYIL 2105          

HSP 5 Score: 217.238 bits (552), Expect = 1.078e-64
Identity = 114/179 (63.69%), Postives = 133/179 (74.30%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITP-ILNTTKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            ANISYTVTITPQSSNL+FL+NP ITCKIVP+PP + SQIDFFL+NIKS+FYTRKALTIQI PEKSLVNSHICAVCGNVANMNATQCYIL+    + V I PRSS L +LQ++ I C I P        ++FFL  +    Y + DL I +   I LVN  +C VCGN   MN ++CYIL
Sbjct: 1657 ANISYTVTITPQSSNLSFLKNPEITCKIVPLPPKSFSQIDFFLTNIKSEFYTRKALTIQILPEKSLVNSHICAVCGNVANMNATQCYILIANISYTVTIFPRSSNLYFLQTQAITCKIVPKPPKPISQIDFFLTNLKPNFYYRKDLTILIVPKISLVNSQICVVCGNLTNMNATKCYIL 1835          

HSP 6 Score: 213.001 bits (541), Expect = 3.202e-63
Identity = 113/179 (63.13%), Postives = 134/179 (74.86%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPI-LNTTKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            ANISYTVTITPQSS+LNFLQN TITCKIVP+PP   SQIDFFL+NIKS+FYTRK LTIQI  EKSLVNS ICAVCGNVANMNATQCYIL+    + V ITP+SS L +LQ+  I C I PI  + +  ++FFL  I    Y +  L I+++ +  LVN  +CAVCGN   MN ++CYIL
Sbjct: 2017 ANISYTVTITPQSSSLNFLQNQTITCKIVPLPPKPFSQIDFFLTNIKSEFYTRKDLTIQIVSEKSLVNSEICAVCGNVANMNATQCYILIANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYIL 2195          

HSP 7 Score: 207.223 bits (526), Expect = 3.243e-61
Identity = 107/179 (59.78%), Postives = 133/179 (74.30%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPI-LNTTKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            AN SYTVTITPQS++LNFLQ   ITCKIVP+PP+NSSQIDFFL++IKS+FY+RK LTI I PEKSLVN+HICAVCGNVANMNATQCY L+    + V ITP+S+ L +L+ + I C I P+ L     +EFFL  +    Y + DL I +  +  LVNR +CAVCGN  +MN ++CY L
Sbjct: 1477 ANTSYTVTITPQSTDLNFLQYQAITCKIVPLPPTNSSQIDFFLTDIKSEFYSRKDLTILIMPEKSLVNNHICAVCGNVANMNATQCYNLISNISYTVTITPQSAKLDFLRYQVITCKIVPVPLIIISKIEFFLTNLNSLFYSRKDLTILIMPEKSLVNRQICAVCGNVAKMNATQCYNL 1655          

HSP 8 Score: 190.66 bits (483), Expect = 2.069e-55
Identity = 95/179 (53.07%), Postives = 128/179 (71.51%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            ANISYTVTITPQSS LNFL N  I C+IVP+PP+NSSQI F+L+N+ S+ Y+RK LTI+IA  +SL+N+ ICAVCGN+A MNATQCY L+    + V ITP+SS L +L +E INC I P+  T +  + F+L  +    Y +  L I+++ +  L+N ++CAVCGN   MN ++CY L
Sbjct:  742 ANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTLIANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTL 920          

HSP 9 Score: 189.504 bits (480), Expect = 5.593e-55
Identity = 94/181 (51.93%), Postives = 128/181 (70.72%), Query Frame = 1
Query:    4 NISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDKR----FRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            NISYTVTITPQSS LNFL N  I C+IVP+PP+NSSQI F+L+N+ S+ Y+RK LTI+IA  +SL+N+ ICAVCGN+A MNATQCY L+ +     + V ITP+SS L +L +E INC I P+  T +  + F+L  +    Y +  L I+++ +  L+N ++CAVCGN   MN ++CY L
Sbjct: 1151 NISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTLISEHANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTL 1331          

HSP 10 Score: 188.734 bits (478), Expect = 8.471e-55
Identity = 94/178 (52.81%), Postives = 127/178 (71.35%), Query Frame = 1
Query:    4 NISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            NISYTVTITPQSS LNFL N  I C+IVP+PP+NSSQI F+L+N+ S+ Y+RK LTI+IA  +SL+N+ ICAVCGN+A MNATQCY L+    + V ITP+SS L +L +E INC I P+  T +  + F+L  +    Y +  L I+++ +  L+N ++CAVCGN   MN ++CY L
Sbjct:  152 NISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTLIANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTL 329          

HSP 11 Score: 188.734 bits (478), Expect = 9.151e-55
Identity = 94/182 (51.65%), Postives = 128/182 (70.33%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDKR----FRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            ANISYTVTITPQSS LNFL N  I C+IVP+PP+NSSQI F+L+N+  + Y+RK LTI+IA  +SL+N+ ICAVCGN+A MNATQCY L+ +     + V ITP+SS L +L +E INC I P+  T +  + F+L  +    Y +  L I+++ +  L+N ++CAVCGN   MN ++CY L
Sbjct:  649 ANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNVESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTLISEHANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTL 830          

HSP 12 Score: 188.734 bits (478), Expect = 9.982e-55
Identity = 97/179 (54.19%), Postives = 127/179 (70.95%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILL-DKRFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            ANISYTVTITPQSS LNFL N  I C+IVP+PP+NSSQI F+L+N+ S+ Y+RK LTI+IA  +SL+N+ ICAVCGN+A MNATQCY L+ +  + V ITP+S+ L +LQ + I C I P+  T +  ++FFL  I    Y + DL I +  +  LVN  +CAVCGN   MN ++CY L
Sbjct: 1387 ANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTLIANTSYTVTITPQSTDLNFLQYQAITCKIVPLPPTNSSQIDFFLTDIKSEFYSRKDLTILIMPEKSLVNNHICAVCGNVANMNATQCYNL 1565          

HSP 13 Score: 187.963 bits (476), Expect = 1.587e-54
Identity = 94/178 (52.81%), Postives = 127/178 (71.35%), Query Frame = 1
Query:    4 NISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            NISYTVTITPQSS LNFL N  I C+IVP+PP+NSSQI F+L+N+ S+ Y+RK LTI+IA  +SL+N+ ICAVCGN+A MNATQCY L+    + V ITP+SS L +L +E INC I P+  T +  + F+L  +    Y +  L I+++ +  L+N ++CAVCGN   MN ++CY L
Sbjct:  560 NISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTLIANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNVESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTL 737          

HSP 14 Score: 181.415 bits (459), Expect = 3.781e-52
Identity = 98/179 (54.75%), Postives = 122/179 (68.16%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPI-LNTTKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            ANISYTVTI P+SSNL FLQ   ITCKIVP PP   SQIDFFL+N+K  FY RK LTI I P+ SLVNS IC VCGN+ NMNAT+CYIL+    + V I P+SS L +LQ+  I C I P+  + +  ++FFL  I    Y +  L I+++ +  LVN  +CAVCGN   MN ++CYIL
Sbjct: 1747 ANISYTVTIFPRSSNLYFLQTQAITCKIVPKPPKPISQIDFFLTNLKPNFYYRKDLTILIVPKISLVNSQICVVCGNLTNMNATKCYILIANISYTVTIEPQSSNLNFLQTPKITCKIVPLPPSNSSQIDFFLTNIKSQFYTRKALTIQIAPEKSLVNSKICAVCGNVANMNATQCYIL 1925          

HSP 15 Score: 174.481 bits (441), Expect = 8.013e-50
Identity = 96/179 (53.63%), Postives = 123/179 (68.72%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPI-LNTTKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            +NISYTVTITPQS+ L+FL+   ITCKIVP+P    S+I+FFL+N+ S FY+RK LTI I PEKSLVN  ICAVCGNVA MNATQCY L+    + V ITP+SS L +L++  I C I P+   +   ++FFL  I    Y +  L I++  +  LVN  +CAVCGN   MN ++CYIL
Sbjct: 1567 SNISYTVTITPQSAKLDFLRYQVITCKIVPVPLIIISKIEFFLTNLNSLFYSRKDLTILIMPEKSLVNRQICAVCGNVAKMNATQCYNLIANISYTVTITPQSSNLSFLKNPEITCKIVPLPPKSFSQIDFFLTNIKSEFYTRKALTIQILPEKSLVNSHICAVCGNVANMNATQCYIL 1745          

HSP 16 Score: 166.777 bits (421), Expect = 4.900e-47
Identity = 85/160 (53.12%), Postives = 114/160 (71.25%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRT 474
            ANISYTVTITPQSS LNFL N  I C+IVP+PP+NSSQI F+L+N+ S+ Y+RK LTI+IA  +SL+N+ ICAVCGN+A MNATQCY L+    + V ITP+SS L +L +E INC I P+  T +  + F+L  +    Y +  L I+++ +  L+N T
Sbjct:  241 ANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTLIANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINAT 400          

HSP 17 Score: 166.777 bits (421), Expect = 4.900e-47
Identity = 85/160 (53.12%), Postives = 114/160 (71.25%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRT 474
            ANISYTVTITPQSS LNFL N  I C+IVP+PP+NSSQI F+L+N+ S+ Y+RK LTI+IA  +SL+N+ ICAVCGN+A MNATQCY L+    + V ITP+SS L +L +E INC I P+  T +  + F+L  +    Y +  L I+++ +  L+N T
Sbjct:  832 ANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTLIANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINAT 991          

HSP 18 Score: 164.851 bits (416), Expect = 2.004e-46
Identity = 84/159 (52.83%), Postives = 113/159 (71.07%), Query Frame = 1
Query:    4 NISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRT 474
            NISYTVTITPQSS LNFL N  I C+IVP+PP+NSSQI F+L+N+ S+ Y+RK LTI+IA  +SL+N+ ICAVCGN+A MNATQCY L+    + V ITP+SS L +L +E INC I P+  T +  + F+L  +    Y +  L I+++ +  L+N T
Sbjct:  401 NISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTLIANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINAT 559          

HSP 19 Score: 164.851 bits (416), Expect = 2.004e-46
Identity = 84/159 (52.83%), Postives = 113/159 (71.07%), Query Frame = 1
Query:    4 NISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRT 474
            NISYTVTITPQSS LNFL N  I C+IVP+PP+NSSQI F+L+N+ S+ Y+RK LTI+IA  +SL+N+ ICAVCGN+A MNATQCY L+    + V ITP+SS L +L +E INC I P+  T +  + F+L  +    Y +  L I+++ +  L+N T
Sbjct:  992 NISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTLIANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINAT 1150          

HSP 20 Score: 160.999 bits (406), Expect = 3.870e-45
Identity = 94/233 (40.34%), Postives = 127/233 (54.51%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITP-----------------------------------RSSF-------------------LKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            ANISYTVTITPQSS LNFL N  I C+IVP+PP+NSSQI F+L+N+ S+ Y+RK LTI+IA  +SL+N+ ICAVCGN+A MNATQCY L+    + V I P                                   +S F                   L +L +E INC I P+  T +  + F+L  +    Y +  L I+++ +  L+N ++CAVCGN   MN ++CY L
Sbjct: 1243 ANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTLIANISYTVIIKPQLNTFHYLRNKVIICQIVPLPPTNISQIAFYLTNFKSEFYSRKANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTL 1475          

HSP 21 Score: 148.673 bits (374), Expect = 9.000e-41
Identity = 79/178 (44.38%), Postives = 111/178 (62.36%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDKRFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            ANISYTVTITPQSS LNFL N  I C+IVP+PP+NSSQI F+L+N+ S+ Y+RK LTI+IA  +SL+N+                     +  + V ITP+SS L +L +E INC I P+  T +  + F+L  +    Y +  L I+++ +  L+N ++CAVCGN   MN ++CY L
Sbjct:  331 ANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINA--------------------TNISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTL 488          

HSP 22 Score: 148.673 bits (374), Expect = 9.000e-41
Identity = 79/178 (44.38%), Postives = 111/178 (62.36%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDKRFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            ANISYTVTITPQSS LNFL N  I C+IVP+PP+NSSQI F+L+N+ S+ Y+RK LTI+IA  +SL+N+                     +  + V ITP+SS L +L +E INC I P+  T +  + F+L  +    Y +  L I+++ +  L+N ++CAVCGN   MN ++CY L
Sbjct:  490 ANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINA--------------------TNISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTL 647          

HSP 23 Score: 148.673 bits (374), Expect = 9.000e-41
Identity = 79/178 (44.38%), Postives = 111/178 (62.36%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDKRFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            ANISYTVTITPQSS LNFL N  I C+IVP+PP+NSSQI F+L+N+ S+ Y+RK LTI+IA  +SL+N+                     +  + V ITP+SS L +L +E INC I P+  T +  + F+L  +    Y +  L I+++ +  L+N ++CAVCGN   MN ++CY L
Sbjct:  922 ANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINA--------------------TNISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTL 1079          

HSP 24 Score: 148.673 bits (374), Expect = 9.000e-41
Identity = 79/178 (44.38%), Postives = 111/178 (62.36%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDKRFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            ANISYTVTITPQSS LNFL N  I C+IVP+PP+NSSQI F+L+N+ S+ Y+RK LTI+IA  +SL+N+                     +  + V ITP+SS L +L +E INC I P+  T +  + F+L  +    Y +  L I+++ +  L+N ++CAVCGN   MN ++CY L
Sbjct: 1081 ANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINA--------------------TNISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTL 1238          

HSP 25 Score: 146.747 bits (369), Expect = 3.674e-40
Identity = 78/177 (44.07%), Postives = 110/177 (62.15%), Query Frame = 1
Query:    4 NISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDKRFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            NISYTVTITPQSS LNFL N  I C+IVP+PP+NSSQI F+L+N+ S+ Y+RK LTI+IA  +SL+N+                     +  + V ITP+SS L +L +E INC I P+  T +  + F+L  +    Y +  L I+++ +  L+N ++CAVCGN   MN ++CY L
Sbjct:   83 NISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINA--------------------TNISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTL 239          

HSP 26 Score: 120.168 bits (300), Expect = 6.949e-31
Identity = 66/159 (41.51%), Postives = 96/159 (60.38%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDKRFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRT 474
            ANISYT+ +TPQSS LNFL N  I C+IVP+PP+NSSQI F+L+N+ S+ Y+RK LTI+IA  +SL+N+                     +  + V ITP+SS L +L +E INC I P+  T +  + F+L  +    Y +  L I+++ +  L+N T
Sbjct:   13 ANISYTLLLTPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINA--------------------TNISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINAT 151          

HSP 27 Score: 55.8398 bits (133), Expect = 7.658e-9
Identity = 29/82 (35.37%), Postives = 48/82 (58.54%), Query Frame = 1
Query:  241 MNATQCYILLDK---RFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRT 474
            MNATQCY L++     + + +TP+SS L +L +E INC I P+  T +  + F+L  +    Y +  L I+++ +  L+N T
Sbjct:    1 MNATQCYTLIEHANISYTLLLTPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINAT 82          
BLAST of SMED30016797 vs. Planmine SMEST
Match: SMESG000072479.1 (SMESG000072479.1)

HSP 1 Score: 368.237 bits (944), Expect = 2.528e-117
Identity = 181/192 (94.27%), Postives = 185/192 (96.35%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDKRFRVAITPRSSFLKYLQSEFINCHITPILNTTKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYILSDSFVKSKMIIYIIW 576
            ANISYTVTITP+SSNL FLQNP ITCKIVP+P +NSSQIDFFL+NIKSQFYTRK LTIQI  EKSLVNS ICAVCGNVANMNATQCYILLDKRFRVAITPRSSFLKYLQSEFINCHITPILNTTKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYILSDSFVKSKMIIYIIW
Sbjct: 2071 ANISYTVTITPRSSNLYFLQNPKITCKIVPLPQTNSSQIDFFLTNIKSQFYTRKDLTIQIVSEKSLVNSEICAVCGNVANMNATQCYILLDKRFRVAITPRSSFLKYLQSEFINCHITPILNTTKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYILSDSFVKSKMIIYIIW 2262          

HSP 2 Score: 247.284 bits (630), Expect = 3.627e-75
Identity = 129/181 (71.27%), Postives = 143/181 (79.01%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYILSD 537
            ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILL    + V ITPRSS L +LQ+  I C I P+  T +  ++FFL  I    Y + DL I++  +  LVN  +CAVCGN   MN ++CYIL D
Sbjct: 1981 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLANISYTVTITPRSSNLYFLQNPKITCKIVPLPQTNSSQIDFFLTNIKSQFYTRKDLTIQIVSEKSLVNSEICAVCGNVANMNATQCYILLD 2161          

HSP 3 Score: 231.106 bits (588), Expect = 1.651e-69
Identity = 119/179 (66.48%), Postives = 139/179 (77.65%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPI-LNTTKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            ANISYTVTI PQSSNLNFLQ P ITCKIVP+PPSNSSQIDFFL+NIKSQFYTRKALTIQIAPEKSLVNS ICAVCGNVANMNATQCYIL+    + V ITP+SS L +LQ+  I C I P+  + +  ++FFL  I    Y + DL I+++ +  LVN  +CAVCGN   MN ++CYIL
Sbjct: 1711 ANISYTVTIEPQSSNLNFLQTPKITCKIVPLPPSNSSQIDFFLTNIKSQFYTRKALTIQIAPEKSLVNSKICAVCGNVANMNATQCYILITNISYTVTITPQSSNLNFLQNPEITCKIVPLPPSNSSQIDFFLTNIKSEFYTRKDLTIQIAPEKSLVNSEICAVCGNVANMNATQCYIL 1889          

HSP 4 Score: 228.794 bits (582), Expect = 9.045e-69
Identity = 118/178 (66.29%), Postives = 137/178 (76.97%), Query Frame = 1
Query:    4 NISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPI-LNTTKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            NISYTVTITPQSSNLNFLQNP ITCKIVP+PPSNSSQIDFFL+NIKS+FYTRK LTIQIAPEKSLVNS ICAVCGNVANMNATQCYIL+    + V ITP+SS L +LQ++ I C I P+       ++FFL  I    Y + DL I++  +  LVN  +CAVCGN   MN ++CYIL
Sbjct: 1802 NISYTVTITPQSSNLNFLQNPEITCKIVPLPPSNSSQIDFFLTNIKSEFYTRKDLTIQIAPEKSLVNSEICAVCGNVANMNATQCYILIANISYTVTITPQSSSLNFLQNQTITCKIVPLPPKPFSQIDFFLTNIKSEFYTRKDLTIQIVSEKSLVNSEICAVCGNVANMNATQCYIL 1979          

HSP 5 Score: 216.853 bits (551), Expect = 1.408e-64
Identity = 114/179 (63.69%), Postives = 133/179 (74.30%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITP-ILNTTKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            ANISYTVTITPQSSNL+FL+NP ITCKIVP+PP + SQIDFFL+NIKS+FYTRKALTIQI PEKSLVNSHICAVCGNVANMNATQCYIL+    + V I PRSS L +LQ++ I C I P        ++FFL  +    Y + DL I +   I LVN  +C VCGN   MN ++CYIL
Sbjct: 1531 ANISYTVTITPQSSNLSFLKNPEITCKIVPLPPKSFSQIDFFLTNIKSEFYTRKALTIQILPEKSLVNSHICAVCGNVANMNATQCYILIANISYTVTIFPRSSNLYFLQTQAITCKIVPKPPKPISQIDFFLTNLKPNFYYRKDLTILIVPKISLVNSQICVVCGNLTNMNATKCYIL 1709          

HSP 6 Score: 212.616 bits (540), Expect = 4.346e-63
Identity = 113/179 (63.13%), Postives = 134/179 (74.86%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPI-LNTTKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            ANISYTVTITPQSS+LNFLQN TITCKIVP+PP   SQIDFFL+NIKS+FYTRK LTIQI  EKSLVNS ICAVCGNVANMNATQCYIL+    + V ITP+SS L +LQ+  I C I PI  + +  ++FFL  I    Y +  L I+++ +  LVN  +CAVCGN   MN ++CYIL
Sbjct: 1891 ANISYTVTITPQSSSLNFLQNQTITCKIVPLPPKPFSQIDFFLTNIKSEFYTRKDLTIQIVSEKSLVNSEICAVCGNVANMNATQCYILIANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYIL 2069          

HSP 7 Score: 206.838 bits (525), Expect = 4.153e-61
Identity = 107/179 (59.78%), Postives = 133/179 (74.30%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPI-LNTTKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            AN SYTVTITPQS++LNFLQ   ITCKIVP+PP+NSSQIDFFL++IKS+FY+RK LTI I PEKSLVN+HICAVCGNVANMNATQCY L+    + V ITP+S+ L +L+ + I C I P+ L     +EFFL  +    Y + DL I +  +  LVNR +CAVCGN  +MN ++CY L
Sbjct: 1351 ANTSYTVTITPQSTDLNFLQYQAITCKIVPLPPTNSSQIDFFLTDIKSEFYSRKDLTILIMPEKSLVNNHICAVCGNVANMNATQCYNLISNISYTVTITPQSAKLDFLRYQVITCKIVPVPLIIISKIEFFLTNLNSLFYSRKDLTILIMPEKSLVNRQICAVCGNVAKMNATQCYNL 1529          

HSP 8 Score: 190.274 bits (482), Expect = 2.727e-55
Identity = 95/179 (53.07%), Postives = 128/179 (71.51%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            ANISYTVTITPQSS LNFL N  I C+IVP+PP+NSSQI F+L+N+ S+ Y+RK LTI+IA  +SL+N+ ICAVCGN+A MNATQCY L+    + V ITP+SS L +L +E INC I P+  T +  + F+L  +    Y +  L I+++ +  L+N ++CAVCGN   MN ++CY L
Sbjct:  106 ANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTLIANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTL 284          

HSP 9 Score: 190.274 bits (482), Expect = 2.727e-55
Identity = 95/179 (53.07%), Postives = 128/179 (71.51%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            ANISYTVTITPQSS LNFL N  I C+IVP+PP+NSSQI F+L+N+ S+ Y+RK LTI+IA  +SL+N+ ICAVCGN+A MNATQCY L+    + V ITP+SS L +L +E INC I P+  T +  + F+L  +    Y +  L I+++ +  L+N ++CAVCGN   MN ++CY L
Sbjct:  196 ANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTLIANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTL 374          

HSP 10 Score: 190.274 bits (482), Expect = 2.727e-55
Identity = 95/179 (53.07%), Postives = 128/179 (71.51%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            ANISYTVTITPQSS LNFL N  I C+IVP+PP+NSSQI F+L+N+ S+ Y+RK LTI+IA  +SL+N+ ICAVCGN+A MNATQCY L+    + V ITP+SS L +L +E INC I P+  T +  + F+L  +    Y +  L I+++ +  L+N ++CAVCGN   MN ++CY L
Sbjct:  286 ANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTLIANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTL 464          

HSP 11 Score: 188.348 bits (477), Expect = 1.328e-54
Identity = 97/179 (54.19%), Postives = 127/179 (70.95%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILL-DKRFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            ANISYTVTITPQSS LNFL N  I C+IVP+PP+NSSQI F+L+N+ S+ Y+RK LTI+IA  +SL+N+ ICAVCGN+A MNATQCY L+ +  + V ITP+S+ L +LQ + I C I P+  T +  ++FFL  I    Y + DL I +  +  LVN  +CAVCGN   MN ++CY L
Sbjct: 1261 ANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTLIANTSYTVTITPQSTDLNFLQYQAITCKIVPLPPTNSSQIDFFLTDIKSEFYSRKDLTILIMPEKSLVNNHICAVCGNVANMNATQCYNL 1439          

HSP 12 Score: 186.422 bits (472), Expect = 6.107e-54
Identity = 92/182 (50.55%), Postives = 128/182 (70.33%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDKR----FRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            ANISYT+ +TPQSS LNFL N  I C+IVP+PP+NSSQI F+L+N+ S+ Y+RK LTI+IA  +SL+N+ ICAVCGN+A MNATQCY L+ +     + V ITP+SS L +L +E INC I P+  T +  + F+L  +    Y +  L I+++ +  L+N ++CAVCGN   MN ++CY L
Sbjct:   13 ANISYTLLLTPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTLIGEHANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTL 194          

HSP 13 Score: 181.03 bits (458), Expect = 4.703e-52
Identity = 98/179 (54.75%), Postives = 122/179 (68.16%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPI-LNTTKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            ANISYTVTI P+SSNL FLQ   ITCKIVP PP   SQIDFFL+N+K  FY RK LTI I P+ SLVNS IC VCGN+ NMNAT+CYIL+    + V I P+SS L +LQ+  I C I P+  + +  ++FFL  I    Y +  L I+++ +  LVN  +CAVCGN   MN ++CYIL
Sbjct: 1621 ANISYTVTIFPRSSNLYFLQTQAITCKIVPKPPKPISQIDFFLTNLKPNFYYRKDLTILIVPKISLVNSQICVVCGNLTNMNATKCYILIANISYTVTIEPQSSNLNFLQTPKITCKIVPLPPSNSSQIDFFLTNIKSQFYTRKALTIQIAPEKSLVNSKICAVCGNVANMNATQCYIL 1799          

HSP 14 Score: 174.481 bits (441), Expect = 9.497e-50
Identity = 96/179 (53.63%), Postives = 123/179 (68.72%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPI-LNTTKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            +NISYTVTITPQS+ L+FL+   ITCKIVP+P    S+I+FFL+N+ S FY+RK LTI I PEKSLVN  ICAVCGNVA MNATQCY L+    + V ITP+SS L +L++  I C I P+   +   ++FFL  I    Y +  L I++  +  LVN  +CAVCGN   MN ++CYIL
Sbjct: 1441 SNISYTVTITPQSAKLDFLRYQVITCKIVPVPLIIISKIEFFLTNLNSLFYSRKDLTILIMPEKSLVNRQICAVCGNVAKMNATQCYNLIANISYTVTITPQSSNLSFLKNPEITCKIVPLPPKSFSQIDFFLTNIKSEFYTRKALTIQILPEKSLVNSHICAVCGNVANMNATQCYIL 1619          

HSP 15 Score: 166.777 bits (421), Expect = 4.348e-47
Identity = 88/179 (49.16%), Postives = 120/179 (67.04%), Query Frame = 1
Query:    4 NISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPILNTT-KNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYILS 534
            NISYTVTITPQSS LNFL N  I C+IVP+PP+NSSQI F+L+N+ S+ Y+RK LTI+IA  +SL+N+ ICAVCGN+A MNATQCY L+    + V I P+ +   YL+++ I C I P+  T    + F+L       Y +  L I +      ++  VCA+CGN   MN+SRC++L+
Sbjct: 1082 NISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTLIANISYTVIIKPQLNTFHYLRNKVIICQIVPLPPTNISQIAFYLTNFKSEFYSRKGLSIFIIPIRSYIHTNVCAICGNLTYMNSSRCFVLT 1260          

HSP 16 Score: 166.392 bits (420), Expect = 6.334e-47
Identity = 85/160 (53.12%), Postives = 114/160 (71.25%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRT 474
            ANISYTVTITPQSS LNFL N  I C+IVP+PP+NSSQI F+L+N+ S+ Y+RK LTI+IA  +SL+N+ ICAVCGN+A MNATQCY L+    + V ITP+SS L +L +E INC I P+  T +  + F+L  +    Y +  L I+++ +  L+N T
Sbjct:  376 ANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTLIANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINAT 535          

HSP 17 Score: 164.466 bits (415), Expect = 2.615e-46
Identity = 84/159 (52.83%), Postives = 113/159 (71.07%), Query Frame = 1
Query:    4 NISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRT 474
            NISYTVTITPQSS LNFL N  I C+IVP+PP+NSSQI F+L+N+ S+ Y+RK LTI+IA  +SL+N+ ICAVCGN+A MNATQCY L+    + V ITP+SS L +L +E INC I P+  T +  + F+L  +    Y +  L I+++ +  L+N T
Sbjct:  536 NISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTLIANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINAT 694          

HSP 18 Score: 164.466 bits (415), Expect = 2.615e-46
Identity = 84/159 (52.83%), Postives = 113/159 (71.07%), Query Frame = 1
Query:    4 NISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRT 474
            NISYTVTITPQSS LNFL N  I C+IVP+PP+NSSQI F+L+N+ S+ Y+RK LTI+IA  +SL+N+ ICAVCGN+A MNATQCY L+    + V ITP+SS L +L +E INC I P+  T +  + F+L  +    Y +  L I+++ +  L+N T
Sbjct:  695 NISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTLIANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINAT 853          

HSP 19 Score: 164.466 bits (415), Expect = 2.615e-46
Identity = 84/159 (52.83%), Postives = 113/159 (71.07%), Query Frame = 1
Query:    4 NISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRT 474
            NISYTVTITPQSS LNFL N  I C+IVP+PP+NSSQI F+L+N+ S+ Y+RK LTI+IA  +SL+N+ ICAVCGN+A MNATQCY L+    + V ITP+SS L +L +E INC I P+  T +  + F+L  +    Y +  L I+++ +  L+N T
Sbjct:  854 NISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTLIANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINAT 1012          

HSP 20 Score: 162.925 bits (411), Expect = 9.615e-46
Identity = 79/179 (44.13%), Postives = 124/179 (69.27%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYIL-LDKRFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            ANISYTV I PQ +  ++L+N  I C+IVP+PP+N SQI F+L+N KS+FY+RK L+I I P +S +++++CA+CGN+  MN+++C++L  +  + V ITP+SS L +L +E INC I P+  T +  + F+L  +    Y +  L I+++ +  L+N ++CAVCGN   MN ++CY L
Sbjct: 1171 ANISYTVIIKPQLNTFHYLRNKVIICQIVPLPPTNISQIAFYLTNFKSEFYSRKGLSIFIIPIRSYIHTNVCAICGNLTYMNSSRCFVLTANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTL 1349          

HSP 21 Score: 148.288 bits (373), Expect = 1.152e-40
Identity = 79/178 (44.38%), Postives = 111/178 (62.36%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDKRFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            ANISYTVTITPQSS LNFL N  I C+IVP+PP+NSSQI F+L+N+ S+ Y+RK LTI+IA  +SL+N+                     +  + V ITP+SS L +L +E INC I P+  T +  + F+L  +    Y +  L I+++ +  L+N ++CAVCGN   MN ++CY L
Sbjct:  466 ANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINA--------------------TNISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTL 623          

HSP 22 Score: 148.288 bits (373), Expect = 1.152e-40
Identity = 79/178 (44.38%), Postives = 111/178 (62.36%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDKRFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            ANISYTVTITPQSS LNFL N  I C+IVP+PP+NSSQI F+L+N+ S+ Y+RK LTI+IA  +SL+N+                     +  + V ITP+SS L +L +E INC I P+  T +  + F+L  +    Y +  L I+++ +  L+N ++CAVCGN   MN ++CY L
Sbjct:  625 ANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINA--------------------TNISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTL 782          

HSP 23 Score: 148.288 bits (373), Expect = 1.152e-40
Identity = 79/178 (44.38%), Postives = 111/178 (62.36%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDKRFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            ANISYTVTITPQSS LNFL N  I C+IVP+PP+NSSQI F+L+N+ S+ Y+RK LTI+IA  +SL+N+                     +  + V ITP+SS L +L +E INC I P+  T +  + F+L  +    Y +  L I+++ +  L+N ++CAVCGN   MN ++CY L
Sbjct:  784 ANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINA--------------------TNISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTL 941          

HSP 24 Score: 124.405 bits (311), Expect = 2.539e-32
Identity = 69/159 (43.40%), Postives = 97/159 (61.01%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDKRFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRT 474
            ANISYTVTITPQSS LNFL N  I C+IVP+PP+NSSQI F+L+N+ S+ Y+RK LTI+IA  +SL+N+                     +  + V ITP+SS L +L +E INC I P+  T +  + F+L  +    Y +  L I+++ +  L+N T
Sbjct:  943 ANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINA--------------------TNISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINAT 1081          

HSP 25 Score: 79.7221 bits (195), Expect = 6.365e-17
Identity = 39/101 (38.61%), Postives = 62/101 (61.39%), Query Frame = 1
Query:  241 MNATQCYILLDK---RFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            MNATQCY L++     + + +TP+SS L +L +E INC I P+  T +  + F+L  +    Y +  L I+++ +  L+N ++CAVCGN   MN ++CY L
Sbjct:    1 MNATQCYTLIEHANISYTLLLTPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTL 101          
BLAST of SMED30016797 vs. Planmine SMEST
Match: SMESG000072479.1 (SMESG000072479.1)

HSP 1 Score: 246.514 bits (628), Expect = 6.452e-75
Identity = 128/184 (69.57%), Postives = 144/184 (78.26%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYILSDSFV 546
            ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILL    + V ITPRSS L +LQ+  I C I P+  T +  ++FFL  I    Y + DL I++  +  LVN  +CAVCGN   MN ++CYIL   ++
Sbjct: 2290 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLANISYTVTITPRSSNLYFLQNPKITCKIVPLPQTNSSQIDFFLTNIKSQFYTRKDLTIQIVSEKSLVNSEICAVCGNVANMNATQCYILLGMYI 2473          

HSP 2 Score: 231.491 bits (589), Expect = 1.128e-69
Identity = 119/179 (66.48%), Postives = 139/179 (77.65%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPI-LNTTKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            ANISYTVTI PQSSNLNFLQ P ITCKIVP+PPSNSSQIDFFL+NIKSQFYTRKALTIQIAPEKSLVNS ICAVCGNVANMNATQCYIL+    + V ITP+SS L +LQ+  I C I P+  + +  ++FFL  I    Y + DL I+++ +  LVN  +CAVCGN   MN ++CYIL
Sbjct: 2020 ANISYTVTIEPQSSNLNFLQTPKITCKIVPLPPSNSSQIDFFLTNIKSQFYTRKALTIQIAPEKSLVNSKICAVCGNVANMNATQCYILITNISYTVTITPQSSNLNFLQNPEITCKIVPLPPSNSSQIDFFLTNIKSEFYTRKDLTIQIAPEKSLVNSEICAVCGNVANMNATQCYIL 2198          

HSP 3 Score: 229.565 bits (584), Expect = 6.003e-69
Identity = 118/178 (66.29%), Postives = 137/178 (76.97%), Query Frame = 1
Query:    4 NISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPI-LNTTKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            NISYTVTITPQSSNLNFLQNP ITCKIVP+PPSNSSQIDFFL+NIKS+FYTRK LTIQIAPEKSLVNS ICAVCGNVANMNATQCYIL+    + V ITP+SS L +LQ++ I C I P+       ++FFL  I    Y + DL I++  +  LVN  +CAVCGN   MN ++CYIL
Sbjct: 2111 NISYTVTITPQSSNLNFLQNPEITCKIVPLPPSNSSQIDFFLTNIKSEFYTRKDLTIQIAPEKSLVNSEICAVCGNVANMNATQCYILIANISYTVTITPQSSSLNFLQNQTITCKIVPLPPKPFSQIDFFLTNIKSEFYTRKDLTIQIVSEKSLVNSEICAVCGNVANMNATQCYIL 2288          

HSP 4 Score: 217.238 bits (552), Expect = 1.070e-64
Identity = 114/179 (63.69%), Postives = 133/179 (74.30%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITP-ILNTTKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            ANISYTVTITPQSSNL+FL+NP ITCKIVP+PP + SQIDFFL+NIKS+FYTRKALTIQI PEKSLVNSHICAVCGNVANMNATQCYIL+    + V I PRSS L +LQ++ I C I P        ++FFL  +    Y + DL I +   I LVN  +C VCGN   MN ++CYIL
Sbjct: 1750 ANISYTVTITPQSSNLSFLKNPEITCKIVPLPPKSFSQIDFFLTNIKSEFYTRKALTIQILPEKSLVNSHICAVCGNVANMNATQCYILIANISYTVTIFPRSSNLYFLQTQAITCKIVPKPPKPISQIDFFLTNLKPNFYYRKDLTILIVPKISLVNSQICVVCGNLTNMNATKCYIL 1928          

HSP 5 Score: 213.001 bits (541), Expect = 3.117e-63
Identity = 113/179 (63.13%), Postives = 134/179 (74.86%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPI-LNTTKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            ANISYTVTITPQSS+LNFLQN TITCKIVP+PP   SQIDFFL+NIKS+FYTRK LTIQI  EKSLVNS ICAVCGNVANMNATQCYIL+    + V ITP+SS L +LQ+  I C I PI  + +  ++FFL  I    Y +  L I+++ +  LVN  +CAVCGN   MN ++CYIL
Sbjct: 2200 ANISYTVTITPQSSSLNFLQNQTITCKIVPLPPKPFSQIDFFLTNIKSEFYTRKDLTIQIVSEKSLVNSEICAVCGNVANMNATQCYILIANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYIL 2378          

HSP 6 Score: 210.69 bits (535), Expect = 2.302e-62
Identity = 107/179 (59.78%), Postives = 134/179 (74.86%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPI-LNTTKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            ANISYTVTITPQS N++FL+NP ITCKIVP+PP   SQI+FFL+NIKS+FYTRK L+IQI PEKSLVNSHICA+CGNVANMNATQCYIL+    + V I P+SS L +LQ+  I C I P+  + +  ++FFL  I    Y +  L I+++ +  LVN  +CAVCGN   MN ++CYIL
Sbjct: 1930 ANISYTVTITPQSMNMSFLKNPEITCKIVPLPPKAFSQIEFFLTNIKSEFYTRKNLSIQILPEKSLVNSHICAICGNVANMNATQCYILIANISYTVTIEPQSSNLNFLQTPKITCKIVPLPPSNSSQIDFFLTNIKSQFYTRKALTIQIAPEKSLVNSKICAVCGNVANMNATQCYIL 2108          

HSP 7 Score: 207.223 bits (526), Expect = 3.186e-61
Identity = 107/179 (59.78%), Postives = 133/179 (74.30%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPI-LNTTKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            AN SYTVTITPQS++LNFLQ   ITCKIVP+PP+NSSQIDFFL++IKS+FY+RK LTI I PEKSLVN+HICAVCGNVANMNATQCY L+    + V ITP+S+ L +L+ + I C I P+ L     +EFFL  +    Y + DL I +  +  LVNR +CAVCGN  +MN ++CY L
Sbjct: 1570 ANTSYTVTITPQSTDLNFLQYQAITCKIVPLPPTNSSQIDFFLTDIKSEFYSRKDLTILIMPEKSLVNNHICAVCGNVANMNATQCYNLISNISYTVTITPQSAKLDFLRYQVITCKIVPVPLIIISKIEFFLTNLNSLFYSRKDLTILIMPEKSLVNRQICAVCGNVAKMNATQCYNL 1748          

HSP 8 Score: 190.66 bits (483), Expect = 1.846e-55
Identity = 95/179 (53.07%), Postives = 128/179 (71.51%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            ANISYTVTITPQSS LNFL N  I C+IVP+PP+NSSQI F+L+N+ S+ Y+RK LTI+IA  +SL+N+ ICAVCGN+A MNATQCY L+    + V ITP+SS L +L +E INC I P+  T +  + F+L  +    Y +  L I+++ +  L+N ++CAVCGN   MN ++CY L
Sbjct:  103 ANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTLIANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTL 281          

HSP 9 Score: 190.66 bits (483), Expect = 1.846e-55
Identity = 95/179 (53.07%), Postives = 128/179 (71.51%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            ANISYTVTITPQSS LNFL N  I C+IVP+PP+NSSQI F+L+N+ S+ Y+RK LTI+IA  +SL+N+ ICAVCGN+A MNATQCY L+    + V ITP+SS L +L +E INC I P+  T +  + F+L  +    Y +  L I+++ +  L+N ++CAVCGN   MN ++CY L
Sbjct:  193 ANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTLIANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTL 371          

HSP 10 Score: 190.66 bits (483), Expect = 1.846e-55
Identity = 95/179 (53.07%), Postives = 128/179 (71.51%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            ANISYTVTITPQSS LNFL N  I C+IVP+PP+NSSQI F+L+N+ S+ Y+RK LTI+IA  +SL+N+ ICAVCGN+A MNATQCY L+    + V ITP+SS L +L +E INC I P+  T +  + F+L  +    Y +  L I+++ +  L+N ++CAVCGN   MN ++CY L
Sbjct:  532 ANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTLIANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTL 710          

HSP 11 Score: 190.66 bits (483), Expect = 1.846e-55
Identity = 95/179 (53.07%), Postives = 128/179 (71.51%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            ANISYTVTITPQSS LNFL N  I C+IVP+PP+NSSQI F+L+N+ S+ Y+RK LTI+IA  +SL+N+ ICAVCGN+A MNATQCY L+    + V ITP+SS L +L +E INC I P+  T +  + F+L  +    Y +  L I+++ +  L+N ++CAVCGN   MN ++CY L
Sbjct:  871 ANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTLIANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTL 1049          

HSP 12 Score: 190.66 bits (483), Expect = 1.846e-55
Identity = 95/179 (53.07%), Postives = 128/179 (71.51%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            ANISYTVTITPQSS LNFL N  I C+IVP+PP+NSSQI F+L+N+ S+ Y+RK LTI+IA  +SL+N+ ICAVCGN+A MNATQCY L+    + V ITP+SS L +L +E INC I P+  T +  + F+L  +    Y +  L I+++ +  L+N ++CAVCGN   MN ++CY L
Sbjct:  961 ANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTLIANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTL 1139          

HSP 13 Score: 190.66 bits (483), Expect = 1.846e-55
Identity = 95/179 (53.07%), Postives = 128/179 (71.51%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            ANISYTVTITPQSS LNFL N  I C+IVP+PP+NSSQI F+L+N+ S+ Y+RK LTI+IA  +SL+N+ ICAVCGN+A MNATQCY L+    + V ITP+SS L +L +E INC I P+  T +  + F+L  +    Y +  L I+++ +  L+N ++CAVCGN   MN ++CY L
Sbjct: 1051 ANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTLIANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTL 1229          

HSP 14 Score: 189.119 bits (479), Expect = 7.486e-55
Identity = 94/178 (52.81%), Postives = 127/178 (71.35%), Query Frame = 1
Query:    4 NISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            NISYTVTITPQSS LNFL N  I C+IVP+PP+NSSQI F+L+N+ S+ Y+RK LTI+IA  +SL+N+ ICAVCGN+A MNATQCY L+    + V ITP+SS L +L +E INC I P+  T +  + F+L  +    Y +  L I+++ +  L+N ++CAVCGN   MN ++CY L
Sbjct:  443 NISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTLIANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTL 620          

HSP 15 Score: 189.119 bits (479), Expect = 7.486e-55
Identity = 94/178 (52.81%), Postives = 127/178 (71.35%), Query Frame = 1
Query:    4 NISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            NISYTVTITPQSS LNFL N  I C+IVP+PP+NSSQI F+L+N+ S+ Y+RK LTI+IA  +SL+N+ ICAVCGN+A MNATQCY L+    + V ITP+SS L +L +E INC I P+  T +  + F+L  +    Y +  L I+++ +  L+N ++CAVCGN   MN ++CY L
Sbjct:  782 NISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTLIANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTL 959          

HSP 16 Score: 188.734 bits (478), Expect = 9.715e-55
Identity = 97/179 (54.19%), Postives = 127/179 (70.95%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILL-DKRFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            ANISYTVTITPQSS LNFL N  I C+IVP+PP+NSSQI F+L+N+ S+ Y+RK LTI+IA  +SL+N+ ICAVCGN+A MNATQCY L+ +  + V ITP+S+ L +LQ + I C I P+  T +  ++FFL  I    Y + DL I +  +  LVN  +CAVCGN   MN ++CY L
Sbjct: 1480 ANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTLIANTSYTVTITPQSTDLNFLQYQAITCKIVPLPPTNSSQIDFFLTDIKSEFYSRKDLTILIMPEKSLVNNHICAVCGNVANMNATQCYNL 1658          

HSP 17 Score: 186.422 bits (472), Expect = 6.445e-54
Identity = 92/179 (51.40%), Postives = 127/179 (70.95%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            ANISYT+ +TPQSS LNFL N  I C+IVP+PP+NSSQI F+L+N+ S+ Y+RK LTI+IA  +SL+N+ ICAVCGN+A MNATQCY L+    + V ITP+SS L +L +E INC I P+  T +  + F+L  +    Y +  L I+++ +  L+N ++CAVCGN   MN ++CY L
Sbjct:   13 ANISYTLLLTPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTLIANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTL 191          

HSP 18 Score: 176.407 bits (446), Expect = 1.870e-50
Identity = 96/179 (53.63%), Postives = 120/179 (67.04%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPI-LNTTKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            ANISYTVTI P+SSNL FLQ   ITCKIVP PP   SQIDFFL+N+K  FY RK LTI I P+ SLVNS IC VCGN+ NMNAT+CYIL+    + V ITP+S  + +L++  I C I P+       +EFFL  I    Y + +L I++  +  LVN  +CA+CGN   MN ++CYIL
Sbjct: 1840 ANISYTVTIFPRSSNLYFLQTQAITCKIVPKPPKPISQIDFFLTNLKPNFYYRKDLTILIVPKISLVNSQICVVCGNLTNMNATKCYILIANISYTVTITPQSMNMSFLKNPEITCKIVPLPPKAFSQIEFFLTNIKSEFYTRKNLSIQILPEKSLVNSHICAICGNVANMNATQCYIL 2018          

HSP 19 Score: 174.481 bits (441), Expect = 8.106e-50
Identity = 96/179 (53.63%), Postives = 123/179 (68.72%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPI-LNTTKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            +NISYTVTITPQS+ L+FL+   ITCKIVP+P    S+I+FFL+N+ S FY+RK LTI I PEKSLVN  ICAVCGNVA MNATQCY L+    + V ITP+SS L +L++  I C I P+   +   ++FFL  I    Y +  L I++  +  LVN  +CAVCGN   MN ++CYIL
Sbjct: 1660 SNISYTVTITPQSAKLDFLRYQVITCKIVPVPLIIISKIEFFLTNLNSLFYSRKDLTILIMPEKSLVNRQICAVCGNVAKMNATQCYNLIANISYTVTITPQSSNLSFLKNPEITCKIVPLPPKSFSQIDFFLTNIKSEFYTRKALTIQILPEKSLVNSHICAVCGNVANMNATQCYIL 1838          

HSP 20 Score: 167.162 bits (422), Expect = 3.403e-47
Identity = 88/179 (49.16%), Postives = 120/179 (67.04%), Query Frame = 1
Query:    4 NISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPILNTT-KNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYILS 534
            NISYTVTITPQSS LNFL N  I C+IVP+PP+NSSQI F+L+N+ S+ Y+RK LTI+IA  +SL+N+ ICAVCGN+A MNATQCY L+    + V I P+ +   YL+++ I C I P+  T    + F+L       Y +  L I +      ++  VCA+CGN   MN+SRC++L+
Sbjct: 1301 NISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTLIANISYTVIIKPQLNTFHYLRNKVIICQIVPLPPTNISQIAFYLTNFKSEFYSRKGLSIFIIPIRSYIHTNVCAICGNLTYMNSSRCFVLT 1479          

HSP 21 Score: 166.777 bits (421), Expect = 3.933e-47
Identity = 85/160 (53.12%), Postives = 114/160 (71.25%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRT 474
            ANISYTVTITPQSS LNFL N  I C+IVP+PP+NSSQI F+L+N+ S+ Y+RK LTI+IA  +SL+N+ ICAVCGN+A MNATQCY L+    + V ITP+SS L +L +E INC I P+  T +  + F+L  +    Y +  L I+++ +  L+N T
Sbjct:  283 ANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTLIANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINAT 442          

HSP 22 Score: 166.777 bits (421), Expect = 3.933e-47
Identity = 85/160 (53.12%), Postives = 114/160 (71.25%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRT 474
            ANISYTVTITPQSS LNFL N  I C+IVP+PP+NSSQI F+L+N+ S+ Y+RK LTI+IA  +SL+N+ ICAVCGN+A MNATQCY L+    + V ITP+SS L +L +E INC I P+  T +  + F+L  +    Y +  L I+++ +  L+N T
Sbjct: 1141 ANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTLIANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINAT 1300          

HSP 23 Score: 166.007 bits (419), Expect = 7.362e-47
Identity = 85/160 (53.12%), Postives = 114/160 (71.25%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDK-RFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRT 474
            ANISYTVTITPQSS LNFL N  I C+IVP+PP+NSSQI F+L+N+ S+ Y+RK LTI+IA  +SL+N+ ICAVCGN+A MNATQCY L+    + V ITP+SS L +L +E INC I P+  T +  + F+L  +    Y +  L I+++ +  L+N T
Sbjct:  622 ANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTLIANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNVESYSRKGLTIEIAHNESLINAT 781          

HSP 24 Score: 162.925 bits (411), Expect = 8.051e-46
Identity = 79/179 (44.13%), Postives = 124/179 (69.27%), Query Frame = 1
Query:    1 ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYIL-LDKRFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            ANISYTV I PQ +  ++L+N  I C+IVP+PP+N SQI F+L+N KS+FY+RK L+I I P +S +++++CA+CGN+  MN+++C++L  +  + V ITP+SS L +L +E INC I P+  T +  + F+L  +    Y +  L I+++ +  L+N ++CAVCGN   MN ++CY L
Sbjct: 1390 ANISYTVIIKPQLNTFHYLRNKVIICQIVPLPPTNISQIAFYLTNFKSEFYSRKGLSIFIIPIRSYIHTNVCAICGNLTYMNSSRCFVLTANISYTVTITPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTL 1568          

HSP 25 Score: 80.1073 bits (196), Expect = 4.814e-17
Identity = 39/101 (38.61%), Postives = 62/101 (61.39%), Query Frame = 1
Query:  241 MNATQCYILLDK---RFRVAITPRSSFLKYLQSEFINCHITPILNT-TKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYIL 531
            MNATQCY L++     + + +TP+SS L +L +E INC I P+  T +  + F+L  +    Y +  L I+++ +  L+N ++CAVCGN   MN ++CY L
Sbjct:    1 MNATQCYTLIEHANISYTLLLTPQSSRLNFLHNEAINCQIVPLPPTNSSQIAFYLTNLNSESYSRKGLTIEIAHNESLINASICAVCGNLAYMNATQCYTL 101          
BLAST of SMED30016797 vs. Planmine SMEST
Match: SMESG000004613.1 (SMESG000004613.1)

HSP 1 Score: 79.337 bits (194), Expect = 8.024e-17
Identity = 58/198 (29.29%), Postives = 99/198 (50.00%), Query Frame = 1
Query:    7 ISYTVTITPQSSNLNFLQNP-TITCKIVPIPPSNSSQIDFFLSNIK-----SQFYTRKA-LTIQIAPEKSLVNSHICAVCGN-VANMNATQCYILLDKRFRVAITPRSSFLKYLQSEFINCHITPILNTTKNVEFFLVGIPRTKYRKFD-LIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYILSDSFVKSKMIIYII 573
            I  TVTITP  S++     P T+ C++ PI      ++ + L +I+     S++YT  +   I I        S IC  CG+        +C+   +    V I P    L++++S+ I C+  P       ++F ++ +    Y K D LII +  D  L+ R VCA+CGN  +MN ++CY+L  S  +S+++ Y++
Sbjct:  716 IDVTVTITPTESDVYLTDVPFTVQCQVSPI------ELLYILPDIRFLEINSEYYTNISNRDIIIGEFNQTDYSPICFKCGHQYMPQYDIKCFNSYEDDVNVTIVPLVDELRFMESQVIKCYFWPHFTKASLIQFRMISLQMEYYTKTDDLIILIKKDSSLIGRNVCAICGNITKMNGTKCYVLIGS-PESQIVYYVL 906          
BLAST of SMED30016797 vs. Planmine SMEST
Match: SMESG000016214.1 (SMESG000016214.1)

HSP 1 Score: 79.337 bits (194), Expect = 8.488e-17
Identity = 51/152 (33.55%), Postives = 76/152 (50.00%), Query Frame = 1
Query:  124 FLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCG-NVANMNATQCYILLDKRFRVAITPRSSFLKYLQSEFINCHITPILNTTKNVEFFLVGIPRTKYR-KFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYILSDSFVKSKMIIYII 573
            FLS   +Q+  +    I I      V   IC VCG +    N ++C+        V I P    + YL    I C I P  +    V FF++GIP++ Y+   DL I+++ D  L+N+ +C +CGN   MN SRCY L+ S  +S+   Y+I
Sbjct: 1519 FLSINSTQYVYKAFRLILIGGVDYDVKDIICVVCGHDYLPFNVSRCFSPYMGDINVTILPLEWEIYYLMPHTITCKIVPQFSNYSKVSFFVIGIPKSSYKVSSDLTIRINSDKTLINKDICVICGNRPTMNKSRCYRLA-SDDESRCFDYVI 1669          

HSP 2 Score: 64.6994 bits (156), Expect = 7.853e-12
Identity = 38/84 (45.24%), Postives = 51/84 (60.71%), Query Frame = 1
Query:   19 VTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNI-KSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYIL 267
            VTI P    + +L   TITCKIVP   SN S++ FF+  I KS +     LTI+I  +K+L+N  IC +CGN   MN ++CY L
Sbjct: 1574 VTILPLEWEIYYLMPHTITCKIVP-QFSNYSKVSFFVIGIPKSSYKVSSDLTIRINSDKTLINKDICVICGNRPTMNKSRCYRL 1656          

HSP 3 Score: 61.6178 bits (148), Expect = 9.065e-11
Identity = 52/183 (28.42%), Postives = 85/183 (46.45%), Query Frame = 1
Query:    4 NISYTVTITPQSSNLNFLQNP-TITCKIVPIPPSNSSQIDFFLSNIKSQFYTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDKRFRVAITPRSSFLKYLQSEF-INCHITP--ILNTTKNVEFFLVGIPRTKYRKFDLIIKVSLDIKLVNRTVCAVCGNTLQMNNSRCYILSDS 540
            N + +VTI PQ +++ F + P  + C+++P    N  + D FL     Q       +++I   +S+++  IC  CGN    NAT+CY L  +   ++I P S    Y      + C + P  I    +N+E        T + K D  + ++L  K V   +C +CGN L    S CY   D+
Sbjct:  430 NQNVSVTIGPQKTSVFFRKTPLDVFCQVIPSDLINFME-DIFLEGDDPQLIRIDGRSLRI---ESVIHQKICFYCGNKVIKNATKCYELYTQDVIISIEPSSPPYYYKGQRIQVTCIVKPPDIFQKVQNIEIIW---HNTSFNK-DTDLSLTLTGKYVGDIICVLCGNILIYLESMCYEYLDT 604          
The following BLAST results are available for this feature:
BLAST of SMED30016797 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016797 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016797 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016797 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016797 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016797 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016797 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016797 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016797 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016797 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016797 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016797 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016797 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016797 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072479.11.397e-11794.27SMESG000072479.1[more]
SMESG000072479.12.528e-11794.27SMESG000072479.1[more]
SMESG000072479.16.452e-7569.57SMESG000072479.1[more]
SMESG000004613.18.024e-1729.29SMESG000004613.1[more]
SMESG000016214.18.488e-1733.55SMESG000016214.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016797 ID=SMED30016797|Name=SMED30016797|organism=Schmidtea mediterranea sexual|type=transcript|length=678bp
GCTAACATCTCATATACTGTTACTATTACTCCTCAGTCAAGTAATCTGAA
CTTTCTACAAAATCCAACGATAACCTGTAAAATCGTACCTATACCTCCAT
CAAATAGTTCTCAAATAGATTTTTTCTTGTCGAATATAAAATCTCAATTT
TATACAAGAAAGGCTTTGACTATTCAAATCGCGCCTGAGAAATCATTGGT
AAATAGTCACATTTGTGCAGTTTGTGGAAATGTAGCAAATATGAACGCAA
CGCAATGCTATATCTTGTTAGACAAGCGTTTTAGGGTTGCCATTACTCCC
CGTTCGAGTTTTCTTAAATATTTGCAAAGTGAATTCATTAATTGTCACAT
TACACCTATTTTGAATACTACTAAAAATGTCGAATTTTTTCTTGTCGGAA
TCCCGAGAACTAAATATAGAAAATTCGACTTGATAATAAAGGTCTCCCTT
GATATAAAATTGGTCAACCGGACCGTATGCGCAGTTTGTGGAAATACCTT
ACAAATGAATAATTCAAGGTGTTATATACTATCAGATAGTTTCGTGAAAT
CAAAAATGATCATTTATATTATTTGGTTTTTAGCTTTCAACTTCTTTATG
TTGTTTTTATTTCTAATTGTAATGTTTTTCAAGACACTGTGAACAGATTT
GTTTGTAATAAAATGTATTCTAATTAAA
back to top

protein sequence of SMED30016797-orf-1

>SMED30016797-orf-1 ID=SMED30016797-orf-1|Name=SMED30016797-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=214bp
ANISYTVTITPQSSNLNFLQNPTITCKIVPIPPSNSSQIDFFLSNIKSQF
YTRKALTIQIAPEKSLVNSHICAVCGNVANMNATQCYILLDKRFRVAITP
RSSFLKYLQSEFINCHITPILNTTKNVEFFLVGIPRTKYRKFDLIIKVSL
DIKLVNRTVCAVCGNTLQMNNSRCYILSDSFVKSKMIIYIIWFLAFNFFM
LFLFLIVMFFKTL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 188..210