G_PROTEIN_RECEP_F1_2 domain-containing protein

Overview
NameG_PROTEIN_RECEP_F1_2 domain-containing protein
Smed IDSMED30016794
Length (bp)858
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30016794) t-SNE clustered cells

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30016794) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30016794) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30016794) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016794

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30016794h1SMcG0012277 dd_Smed_v4_16725_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30016794h1SMcG0012277 dd_Smed_v4_16725_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30016794h1SMcG0012277 dd_Smed_v4_16725_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30016794h1SMcG0012277 dd_Smed_v6_16725_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Category 2 cellSMED30016794h1SMcG0012277 dd_Smed_v4_16725_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30016794h1SMcG0012277 SMED30016794smed_20140614PMID:27163480
Saberi et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30016794h1SMcG0012277 SMED30032025smed_20140614PMID:27163480
Saberi et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: NPY1R (neuropeptide Y receptor Y1 [Source:HGNC Symbol;Acc:HGNC:7956])

HSP 1 Score: 48.9062 bits (115), Expect = 5.380e-6
Identity = 53/190 (27.89%), Postives = 85/190 (44.74%), Query Frame = 1
Query:  142 HRDYYSCGEDDFRQKTNKLVYTIISIVFQYFVPILIVSXXXXXXXXXXXXXXXNSAINTKQIKENKSKYESINSGKFSAXXXXXXXXXXXTNMLLANLSILFALSWLPLNIVNLYMAVKEHNFNFTISTGDKKSSFSIPSTNFSNNLYDTNSNDSYSNFIQAVCLMLVLASACINPILYGWLNDNFRKVL 711
            ++D Y C  D F   +++L YT + +V QYF P+  + I Y +IY+R+K R      N    K   +KY S  + +               N++L ++ + FA+ WLPL I N        ++N  I          I + N               N +  +C +  + S C+NPI YG+LN NF++ L
Sbjct:  192 YKDKYVCF-DQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRR------NNMMDKMRDNKYRSSETKR--------------INIMLLSIVVAFAVCWLPLTIFNTVF-----DWNHQI----------IATCN--------------HNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDL 331          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: PRLHR (prolactin releasing hormone receptor [Source:HGNC Symbol;Acc:HGNC:4464])

HSP 1 Score: 48.521 bits (114), Expect = 7.007e-6
Identity = 20/47 (42.55%), Postives = 32/47 (68.09%), Query Frame = 1
Query:  586 DTNSNDSYS-NFIQAVCLMLVLASACINPILYGWLNDNFRKVLPKML 723
            D ++ D Y+   +Q +C  L ++SAC NP +Y WL+D+FR+ L K+L
Sbjct:  304 DPHAIDPYAFGLVQLLCHWLAMSSACYNPFIYAWLHDSFREELRKLL 350          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: PRLHR (prolactin releasing hormone receptor [Source:HGNC Symbol;Acc:HGNC:4464])

HSP 1 Score: 48.521 bits (114), Expect = 7.007e-6
Identity = 20/47 (42.55%), Postives = 32/47 (68.09%), Query Frame = 1
Query:  586 DTNSNDSYS-NFIQAVCLMLVLASACINPILYGWLNDNFRKVLPKML 723
            D ++ D Y+   +Q +C  L ++SAC NP +Y WL+D+FR+ L K+L
Sbjct:  304 DPHAIDPYAFGLVQLLCHWLAMSSACYNPFIYAWLHDSFREELRKLL 350          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: NPFR (gene:FBgn0037408 transcript:FBtr0308318)

HSP 1 Score: 78.9518 bits (193), Expect = 3.249e-16
Identity = 66/194 (34.02%), Postives = 96/194 (49.48%), Query Frame = 1
Query:  169 DDFRQKTNKLVYTIISIVFQYFVPILIVSXXXXXXXXXXXXXXXNSAINTKQIKENKSKYESINSGKFSAXXXXXXXXXXXTNMLLANLSILFALSWLPLNIVNLYMAVKEHNFNFTISTGDKKSSFSIPSTNFSNNLYDTNSNDSYSNFIQAVCLMLVLASACINPILYGWLNDNFRKVLPKMLKCSSDSKTS 750
            +D+  +  +  Y+I S+  QY VPILIVS+AY  IY ++K R+   A+      +  S    +  G+          R +RTN LL +++I+F +SWLPLN  NLY               D + S   P T      Y             A+C M+ ++SAC NP+LYGWLNDNFRK   ++L   SD+  +
Sbjct:  250 EDWPSRNGRFYYSIFSLCVQYLVPILIVSVAYFGIYNKLKSRITVVAV------QASSAQRKVERGR----------RMKRTNCLLISIAIIFGVSWLPLNFFNLY--------------ADMERS---PVTQSMLVRY-------------AICHMIGMSSACSNPLLYGWLNDNFRKEFQELLCRCSDTNVA 397          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: NPFR (gene:FBgn0037408 transcript:FBtr0078590)

HSP 1 Score: 78.9518 bits (193), Expect = 3.477e-16
Identity = 66/194 (34.02%), Postives = 96/194 (49.48%), Query Frame = 1
Query:  169 DDFRQKTNKLVYTIISIVFQYFVPILIVSXXXXXXXXXXXXXXXNSAINTKQIKENKSKYESINSGKFSAXXXXXXXXXXXTNMLLANLSILFALSWLPLNIVNLYMAVKEHNFNFTISTGDKKSSFSIPSTNFSNNLYDTNSNDSYSNFIQAVCLMLVLASACINPILYGWLNDNFRKVLPKMLKCSSDSKTS 750
            +D+  +  +  Y+I S+  QY VPILIVS+AY  IY ++K R+   A+      +  S    +  G+          R +RTN LL +++I+F +SWLPLN  NLY               D + S   P T      Y             A+C M+ ++SAC NP+LYGWLNDNFRK   ++L   SD+  +
Sbjct:  250 EDWPSRNGRFYYSIFSLCVQYLVPILIVSVAYFGIYNKLKSRITVVAV------QASSAQRKVERGR----------RMKRTNCLLISIAIIFGVSWLPLNFFNLY--------------ADMERS---PVTQSMLVRY-------------AICHMIGMSSACSNPLLYGWLNDNFRKEFQELLCRCSDTNVA 397          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: NPFR (gene:FBgn0037408 transcript:FBtr0308316)

HSP 1 Score: 75.8702 bits (185), Expect = 2.994e-15
Identity = 67/216 (31.02%), Postives = 100/216 (46.30%), Query Frame = 1
Query:  169 DDFRQKTNKLVYTIISIVFQYFVPILIVSXXXXXXXXXXXXXXXNSAINTKQIKENKSKYESINSGKFSAXXXXXXXXXXXTNMLLANLSILFALSWLPLNIVNLYMAVKEHNFNFTISTGDKKSSFSIPSTNFSNNLYDTNSNDSYSNFIQAVCLMLVLASACINPILYGWLNDNFRKVLPKMLKCSSDSKTSKQTKMEMENKSVMSIIVNPNSA 816
            +D+  +  +  Y+I S+  QY VPILIVS+AY  IY ++K R+   A+      +  S    +  G+          R +RTN LL +++I+F +SWLPLN  NLY               D + S   P T      Y             A+C M+ ++SAC NP+LYGWLNDNFR        C+  +   ++ K+  E       ++ P  A
Sbjct:  250 EDWPSRNGRFYYSIFSLCVQYLVPILIVSVAYFGIYNKLKSRITVVAV------QASSAQRKVERGR----------RMKRTNCLLISIAIIFGVSWLPLNFFNLY--------------ADMERS---PVTQSMLVRY-------------AICHMIGMSSACSNPLLYGWLNDNFR--------CNVQAAARRRRKLGAELSKGELKLLGPGGA 411          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: NPFR (gene:FBgn0037408 transcript:FBtr0308317)

HSP 1 Score: 75.8702 bits (185), Expect = 2.998e-15
Identity = 67/216 (31.02%), Postives = 100/216 (46.30%), Query Frame = 1
Query:  169 DDFRQKTNKLVYTIISIVFQYFVPILIVSXXXXXXXXXXXXXXXNSAINTKQIKENKSKYESINSGKFSAXXXXXXXXXXXTNMLLANLSILFALSWLPLNIVNLYMAVKEHNFNFTISTGDKKSSFSIPSTNFSNNLYDTNSNDSYSNFIQAVCLMLVLASACINPILYGWLNDNFRKVLPKMLKCSSDSKTSKQTKMEMENKSVMSIIVNPNSA 816
            +D+  +  +  Y+I S+  QY VPILIVS+AY  IY ++K R+   A+      +  S    +  G+          R +RTN LL +++I+F +SWLPLN  NLY               D + S   P T      Y             A+C M+ ++SAC NP+LYGWLNDNFR        C+  +   ++ K+  E       ++ P  A
Sbjct:  250 EDWPSRNGRFYYSIFSLCVQYLVPILIVSVAYFGIYNKLKSRITVVAV------QASSAQRKVERGR----------RMKRTNCLLISIAIIFGVSWLPLNFFNLY--------------ADMERS---PVTQSMLVRY-------------AICHMIGMSSACSNPLLYGWLNDNFR--------CNVQAAARRRRKLGAELSKGELKLLGPGGA 411          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: npy1r (neuropeptide Y receptor Y1 [Source:ZFIN;Acc:ZDB-GENE-080221-1])

HSP 1 Score: 56.6102 bits (135), Expect = 8.494e-9
Identity = 67/268 (25.00%), Postives = 119/268 (44.40%), Query Frame = 1
Query:    1 MKQNKVIIYPTRSAVQSL-EAVXXXXXXXXXXXXMASPLLLFSRV------------YKDHRDYYSCGEDDFRQKTNKLVYTIISIVFQYFVPILIVSXXXXXXXXXXXXXXXNSAINTKQIKENKSKYESINSGKFSAXXXXXXXXXXXTNMLLANLSILFALSWLPLNIVNLYMAVKEHNFNFTISTGDKKSSFSIPSTNFSNNLYDTNSNDSYSNFIQAVCLMLVLASACINPILYGWLNDNFRKVLPKMLKCSSDSKTSKQTKM 765
            ++++++I++P R    SL  A L +   W ++ + A+P LLFSRV             + +R    C E+ +  +  KL YT   +V QY  P+  +      + +  + +  N+ +  ++I+ENK  Y S  S +               N++L ++ + FA+ WLPLN+ N   AV + N                         ++   N ++ N + ++C +  + S CINPI YG+LN NF++ L     C   S    +  M
Sbjct:  142 IERHQLILHP-RGWRPSLNHACLGISLTWALAVLTATPFLLFSRVTDAPLKQLPSVFQEQYRGKVVCVEE-WPSREIKLTYTTGMLVLQYITPLTFI--FICYLKIYTRLQRRNNMM--ERIRENK--YRSSESKRI--------------NIMLFSIVVAFAVCWLPLNVFN---AVIDWN-------------------------HEVAMNCTH-NLLFSLCHLTAMCSVCINPIFYGFLNRNFQRDLRAFRLCKIVSTRENEYDM 358          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: npy1r (neuropeptide Y receptor Y1 [Source:ZFIN;Acc:ZDB-GENE-080221-1])

HSP 1 Score: 56.6102 bits (135), Expect = 8.494e-9
Identity = 67/268 (25.00%), Postives = 119/268 (44.40%), Query Frame = 1
Query:    1 MKQNKVIIYPTRSAVQSL-EAVXXXXXXXXXXXXMASPLLLFSRV------------YKDHRDYYSCGEDDFRQKTNKLVYTIISIVFQYFVPILIVSXXXXXXXXXXXXXXXNSAINTKQIKENKSKYESINSGKFSAXXXXXXXXXXXTNMLLANLSILFALSWLPLNIVNLYMAVKEHNFNFTISTGDKKSSFSIPSTNFSNNLYDTNSNDSYSNFIQAVCLMLVLASACINPILYGWLNDNFRKVLPKMLKCSSDSKTSKQTKM 765
            ++++++I++P R    SL  A L +   W ++ + A+P LLFSRV             + +R    C E+ +  +  KL YT   +V QY  P+  +      + +  + +  N+ +  ++I+ENK  Y S  S +               N++L ++ + FA+ WLPLN+ N   AV + N                         ++   N ++ N + ++C +  + S CINPI YG+LN NF++ L     C   S    +  M
Sbjct:  142 IERHQLILHP-RGWRPSLNHACLGISLTWALAVLTATPFLLFSRVTDAPLKQLPSVFQEQYRGKVVCVEE-WPSREIKLTYTTGMLVLQYITPLTFI--FICYLKIYTRLQRRNNMM--ERIRENK--YRSSESKRI--------------NIMLFSIVVAFAVCWLPLNVFN---AVIDWN-------------------------HEVAMNCTH-NLLFSLCHLTAMCSVCINPIFYGFLNRNFQRDLRAFRLCKIVSTRENEYDM 358          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: npy1r (neuropeptide Y receptor Y1 [Source:ZFIN;Acc:ZDB-GENE-080221-1])

HSP 1 Score: 56.6102 bits (135), Expect = 9.578e-9
Identity = 67/268 (25.00%), Postives = 119/268 (44.40%), Query Frame = 1
Query:    1 MKQNKVIIYPTRSAVQSL-EAVXXXXXXXXXXXXMASPLLLFSRV------------YKDHRDYYSCGEDDFRQKTNKLVYTIISIVFQYFVPILIVSXXXXXXXXXXXXXXXNSAINTKQIKENKSKYESINSGKFSAXXXXXXXXXXXTNMLLANLSILFALSWLPLNIVNLYMAVKEHNFNFTISTGDKKSSFSIPSTNFSNNLYDTNSNDSYSNFIQAVCLMLVLASACINPILYGWLNDNFRKVLPKMLKCSSDSKTSKQTKM 765
            ++++++I++P R    SL  A L +   W ++ + A+P LLFSRV             + +R    C E+ +  +  KL YT   +V QY  P+  +      + +  + +  N+ +  ++I+ENK  Y S  S +               N++L ++ + FA+ WLPLN+ N   AV + N                         ++   N ++ N + ++C +  + S CINPI YG+LN NF++ L     C   S    +  M
Sbjct:  120 IERHQLILHP-RGWRPSLNHACLGISLTWALAVLTATPFLLFSRVTDAPLKQLPSVFQEQYRGKVVCVEE-WPSREIKLTYTTGMLVLQYITPLTFI--FICYLKIYTRLQRRNNMM--ERIRENK--YRSSESKRI--------------NIMLFSIVVAFAVCWLPLNVFN---AVIDWN-------------------------HEVAMNCTH-NLLFSLCHLTAMCSVCINPIFYGFLNRNFQRDLRAFRLCKIVSTRENEYDM 336          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: npy1r (neuropeptide Y receptor Y1 [Source:ZFIN;Acc:ZDB-GENE-080221-1])

HSP 1 Score: 55.8398 bits (133), Expect = 1.573e-8
Identity = 66/268 (24.63%), Postives = 119/268 (44.40%), Query Frame = 1
Query:    1 MKQNKVIIYPTRSAVQSL-EAVXXXXXXXXXXXXMASPLLLFSRV------------YKDHRDYYSCGEDDFRQKTNKLVYTIISIVFQYFVPILIVSXXXXXXXXXXXXXXXNSAINTKQIKENKSKYESINSGKFSAXXXXXXXXXXXTNMLLANLSILFALSWLPLNIVNLYMAVKEHNFNFTISTGDKKSSFSIPSTNFSNNLYDTNSNDSYSNFIQAVCLMLVLASACINPILYGWLNDNFRKVLPKMLKCSSDSKTSKQTKM 765
            ++++++I++P R    SL  A L +   W ++ + A+P LLFSRV             + +R    C E+ +  +  KL YT   +V QY  P+  +      + +  + +  N+ +  ++I+ENK  Y S  S +               N++L ++ + FA+ WLPLN+ N   AV + N                         ++   N ++ N + ++C +  + S CINP+ YG+LN NF++ L     C   S    +  M
Sbjct:  117 IERHQLILHP-RGWRPSLNHACLGISLTWALAVLTATPFLLFSRVTDAPLKQLPSVFQEQYRGKVVCVEE-WPSREIKLTYTTGMLVLQYITPLTFI--FICYLKIYTRLQRRNNMM--ERIRENK--YRSSESKRI--------------NIMLFSIVVAFAVCWLPLNVFN---AVIDWN-------------------------HEVAMNCTH-NLLFSLCHLTAMCSVCINPVFYGFLNRNFQRDLRAFRLCKIVSTRENEYDM 333          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: npy1r (neuropeptide Y receptor Y1 [Source:ZFIN;Acc:ZDB-GENE-080221-1])

HSP 1 Score: 55.8398 bits (133), Expect = 1.573e-8
Identity = 66/268 (24.63%), Postives = 119/268 (44.40%), Query Frame = 1
Query:    1 MKQNKVIIYPTRSAVQSL-EAVXXXXXXXXXXXXMASPLLLFSRV------------YKDHRDYYSCGEDDFRQKTNKLVYTIISIVFQYFVPILIVSXXXXXXXXXXXXXXXNSAINTKQIKENKSKYESINSGKFSAXXXXXXXXXXXTNMLLANLSILFALSWLPLNIVNLYMAVKEHNFNFTISTGDKKSSFSIPSTNFSNNLYDTNSNDSYSNFIQAVCLMLVLASACINPILYGWLNDNFRKVLPKMLKCSSDSKTSKQTKM 765
            ++++++I++P R    SL  A L +   W ++ + A+P LLFSRV             + +R    C E+ +  +  KL YT   +V QY  P+  +      + +  + +  N+ +  ++I+ENK  Y S  S +               N++L ++ + FA+ WLPLN+ N   AV + N                         ++   N ++ N + ++C +  + S CINP+ YG+LN NF++ L     C   S    +  M
Sbjct:  117 IERHQLILHP-RGWRPSLNHACLGISLTWALAVLTATPFLLFSRVTDAPLKQLPSVFQEQYRGKVVCVEE-WPSREIKLTYTTGMLVLQYITPLTFI--FICYLKIYTRLQRRNNMM--ERIRENK--YRSSESKRI--------------NIMLFSIVVAFAVCWLPLNVFN---AVIDWN-------------------------HEVAMNCTH-NLLFSLCHLTAMCSVCINPVFYGFLNRNFQRDLRAFRLCKIVSTRENEYDM 333          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Match: errfi1 (ERBB receptor feedback inhibitor 1 [Source:Xenbase;Acc:XB-GENE-1005334])

HSP 1 Score: 53.9138 bits (128), Expect = 1.075e-7
Identity = 61/235 (25.96%), Postives = 104/235 (44.26%), Query Frame = 1
Query:   22 IYPTRSAVQSLEAVXXXXXXXXXXXXMASPLLLFS-RVYKDHRDYYSCGEDDFRQKTNKLVYTIISIVFQYFVPILIVSXXXXXXXXXXXXXXXNSAINTKQIKENKSKYESINSGKFSAXXXXXXXXXXXTNMLLANLSILFALSWLPLNIVNLYMAVKEHNFNFTISTGDKKSSFSIPSTNFSNNLYDTNSNDSYSNFIQAVCLMLVLASACINPILYGWLNDNFRKVLPKML 723
            +YP R  +        L  IW++SC+MA+P L  +  V     D+  C E  F  +  +L Y   +++  Y +P +I++++Y+RI +++K R++   I   Q + ++++ +                    T  LL  +   F + WLPL+I N+   +  H         DK+                      Y N +Q +C  L + SAC N +LY WL+D+FR  L KM 
Sbjct:  138 VYPLRRRLTIPTCAYILAGIWLLSCLMAAPALAHTYHVEFPQLDFSICEEFWFGMEKKRLAYAYSTLILTYALPFIIIALSYLRISVKLKNRVVPGNITNVQAEWDRARRKK-------------------TFRLLVLVVGAFGMCWLPLHIFNIMKDIDIHLI-------DKQ----------------------YFNLVQLLCHWLAMMSACTNSLLYAWLHDSFRGELKKMF 324          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Match: npy4r (neuropeptide Y receptor Y4 [Source:NCBI gene;Acc:100127810])

HSP 1 Score: 51.6026 bits (122), Expect = 6.547e-7
Identity = 36/143 (25.17%), Postives = 59/143 (41.26%), Query Frame = 1
Query:  415 NMLLANLSILFALSWLPLNIVNLYMAVKEHNFNFTISTGDKKSSFSIPSTNFSNNLYDTNSND---SYSNFIQAVCLMLVLASACINPILYGWLNDNFRK-VLPKMLKCSSDSKTSK-------QTKMEMENKSVMSIIVNPN 810
            N++L ++ + F L WLPL + N                                 L+D +       Y N I ++C +  +AS C+NP++YG+LN NF+K V   +L+C       +           E+   S+ S+I N N
Sbjct:  259 NVMLLSIVVAFGLCWLPLTVFN--------------------------------ALFDWDHEQISACYHNLIFSLCHLAAMASTCVNPVMYGFLNSNFQKEVKTILLRCRCAGGRDRYESFPLSTVSTEVSKASLQSVITNGN 369          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Match: npy5r (neuropeptide Y receptor Y5 [Source:NCBI gene;Acc:779693])

HSP 1 Score: 49.6766 bits (117), Expect = 2.738e-6
Identity = 30/102 (29.41%), Postives = 49/102 (48.04%), Query Frame = 1
Query:  424 LANLSILFALSWLPLNIVNLYMAVKEHNFNFTISTGDKKSSFSIPSTNFSNNLYDTNSNDSYSNFIQAVCLMLVLASACINPILYGWLNDNFRKVLPKMLKC 729
            L  L I FA+SW+PL++ +L                          T+F+ NL     ++ +   +  +C +L + S C+NPILYG+LND  +  L  ++KC
Sbjct:  372 LTILIIAFAVSWMPLHLFHLV-------------------------TDFNANLI----SNRHFKLVYCICHLLGMVSCCLNPILYGFLNDGIKADLMSLIKC 444          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Prlhr (prolactin releasing hormone receptor [Source:MGI Symbol;Acc:MGI:2135956])

HSP 1 Score: 52.373 bits (124), Expect = 2.792e-7
Identity = 33/105 (31.43%), Postives = 49/105 (46.67%), Query Frame = 1
Query:  412 TNMLLANLSILFALSWLPLNIVNLYMAVKEHNFNFTISTGDKKSSFSIPSTNFSNNLYDTNSNDSYS-NFIQAVCLMLVLASACINPILYGWLNDNFRKVLPKML 723
            T  LL  + ++FA+ WLPL+I NL   +                              D  + D Y+   +Q +C  L ++SAC NP +Y WL+D+FR+ L KML
Sbjct:  276 TFCLLVVVVVVFAVCWLPLHIFNLLRDL------------------------------DPRAIDPYAFGLVQLLCHWLAMSSACYNPFIYAWLHDSFREELRKML 350          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9VNM1|NPFR_DROME (Neuropeptide F receptor OS=Drosophila melanogaster OX=7227 GN=NPFR PE=1 SV=3)

HSP 1 Score: 78.9518 bits (193), Expect = 3.485e-15
Identity = 66/194 (34.02%), Postives = 96/194 (49.48%), Query Frame = 1
Query:  169 DDFRQKTNKLVYTIISIVFQYFVPILIVSXXXXXXXXXXXXXXXNSAINTKQIKENKSKYESINSGKFSAXXXXXXXXXXXTNMLLANLSILFALSWLPLNIVNLYMAVKEHNFNFTISTGDKKSSFSIPSTNFSNNLYDTNSNDSYSNFIQAVCLMLVLASACINPILYGWLNDNFRKVLPKMLKCSSDSKTS 750
            +D+  +  +  Y+I S+  QY VPILIVS+AY  IY ++K R+   A+      +  S    +  G+          R +RTN LL +++I+F +SWLPLN  NLY               D + S   P T      Y             A+C M+ ++SAC NP+LYGWLNDNFRK   ++L   SD+  +
Sbjct:  250 EDWPSRNGRFYYSIFSLCVQYLVPILIVSVAYFGIYNKLKSRITVVAV------QASSAQRKVERGR----------RMKRTNCLLISIAIIFGVSWLPLNFFNLY--------------ADMERS---PVTQSMLVRY-------------AICHMIGMSSACSNPLLYGWLNDNFRKEFQELLCRCSDTNVA 397          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q64121|PRLHR_RAT (Prolactin-releasing peptide receptor OS=Rattus norvegicus OX=10116 GN=Prlhr PE=2 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 5.927e-7
Identity = 34/105 (32.38%), Postives = 49/105 (46.67%), Query Frame = 1
Query:  412 TNMLLANLSILFALSWLPLNIVNLYMAVKEHNFNFTISTGDKKSSFSIPSTNFSNNLYDTNSNDSYS-NFIQAVCLMLVLASACINPILYGWLNDNFRKVLPKML 723
            T  LL  + ++FAL WLPL+I NL   +                              D  + D Y+   +Q +C  L ++SAC NP +Y WL+D+FR+ L KML
Sbjct:  276 TFCLLVVVVVVFALCWLPLHIFNLLRDL------------------------------DPRAIDPYAFGLVQLLCHWLAMSSACYNPFIYAWLHDSFREELRKML 350          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6VMN6|PRLHR_MOUSE (Prolactin-releasing peptide receptor OS=Mus musculus OX=10090 GN=Prlhr PE=2 SV=2)

HSP 1 Score: 52.373 bits (124), Expect = 1.953e-6
Identity = 33/105 (31.43%), Postives = 49/105 (46.67%), Query Frame = 1
Query:  412 TNMLLANLSILFALSWLPLNIVNLYMAVKEHNFNFTISTGDKKSSFSIPSTNFSNNLYDTNSNDSYS-NFIQAVCLMLVLASACINPILYGWLNDNFRKVLPKML 723
            T  LL  + ++FA+ WLPL+I NL   +                              D  + D Y+   +Q +C  L ++SAC NP +Y WL+D+FR+ L KML
Sbjct:  276 TFCLLVVVVVVFAVCWLPLHIFNLLRDL------------------------------DPRAIDPYAFGLVQLLCHWLAMSSACYNPFIYAWLHDSFREELRKML 350          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q4EW11|PRLHR_BOVIN (Prolactin-releasing peptide receptor OS=Bos taurus OX=9913 GN=PRLHR PE=3 SV=1)

HSP 1 Score: 50.8322 bits (120), Expect = 5.807e-6
Identity = 31/105 (29.52%), Postives = 50/105 (47.62%), Query Frame = 1
Query:  412 TNMLLANLSILFALSWLPLNIVNLYMAVKEHNFNFTISTGDKKSSFSIPSTNFSNNLYDTNSNDSYS-NFIQAVCLMLVLASACINPILYGWLNDNFRKVLPKML 723
            T  LL  + ++FA+ WLPL++ NL   +                              D ++ D Y+   +Q +C  L ++SAC NP +Y WL+D+FR+ L K+L
Sbjct:  276 TFCLLVVVVVVFAVCWLPLHVFNLLRDL------------------------------DPHAIDPYAFGLVQLLCHWLAMSSACYNPFIYAWLHDSFREELRKLL 350          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A193KUX4 (NPYR-5 OS=Schmidtea mediterranea OX=79327 GN=npyr-5 PE=2 SV=1)

HSP 1 Score: 476.093 bits (1224), Expect = 2.443e-165
Identity = 279/282 (98.94%), Postives = 281/282 (99.65%), Query Frame = 1
Query:   13 KVIIYPTRSAVQSLEAVXXXXXXXXXXXXMASPLLLFSRVYKDHRDYYSCGEDDFRQKTNKLVYTIISIVFQYFVPILIVSXXXXXXXXXXXXXXXNSAINTKQIKENKSKYESINSGKFSAXXXXXXXXXXXTNMLLANLSILFALSWLPLNIVNLYMAVKEHNFNFTISTGDKKSSFSIPSTNFSNNLYDTNSNDSYSNFIQAVCLMLVLASACINPILYGWLNDNFRKVLPKMLKCSSDSKTSKQTKMEMENKSVMSIIVNPNSAPVTIQIPIVTPLIC 858
            +VIIYPTRSAVQSLEAVLCLCSIWIISCIMASPLLLFSRVYKDHRDYYSCGEDDFRQKTNKLVYTIISIVFQYFVPILIVSIAYIRIYLRIKYRLINSAINTKQIKENKSKYESINSGKFSAKQKKEKQRQRRTNMLLANLSILFALSWLPLNIVNLYMAVKEHNFNFTISTGDKKSSFSIPSTN SNNLYDTNSNDSYSNFIQAVCLMLVLASACINPILYGWLNDNFRKVLPKMLKCSSDSKTSKQTKMEMENKSVMSIIVNPNSAP+TIQIPIVTPLIC
Sbjct:  169 QVIIYPTRSAVQSLEAVLCLCSIWIISCIMASPLLLFSRVYKDHRDYYSCGEDDFRQKTNKLVYTIISIVFQYFVPILIVSIAYIRIYLRIKYRLINSAINTKQIKENKSKYESINSGKFSAKQKKEKQRQRRTNMLLANLSILFALSWLPLNIVNLYMAVKEHNFNFTISTGDKKSSFSIPSTNLSNNLYDTNSNDSYSNFIQAVCLMLVLASACINPILYGWLNDNFRKVLPKMLKCSSDSKTSKQTKMEMENKSVMSIIVNPNSAPITIQIPIVTPLIC 450          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A193KUR8 (NPYR-3 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=npyr-3 PE=2 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 2.319e-25
Identity = 94/283 (33.22%), Postives = 158/283 (55.83%), Query Frame = 1
Query:   13 KVIIYPTRSAVQSLEAVXXXXXXXXXXXXMASPLLLFSRVYKDHRDYYSCGE--DDFRQKTNKLVYTIISIVFQYFVPILIVSXXXXXXXXXXXXXXXN--------SAINTKQIKENKSKYESINSGKFSAXXXXXXXXXXXTNMLLANLSILFALSWLPLNIVNLYMAVKEHNFNFTISTGDKKSSFSIPSTNFSNNLYDTNSNDSYSN-------------FIQAVCLMLVLASACINPILYGWLNDNFRKVLPKMLK-----CSSDSKTSKQTKMEMEN 777
            ++I++P R+A+ +   V  L  IW ++ I++ PL  FS V++D      C E  +    K  +  ++ + +V QY VP+ I+S++Y RI ++IKYR++N        S+ +T Q+ E++   ES    +              TN+LL++++I+FALSWLPLNIVNL M  ++ +FN     G++  S   P+     N+YD + N +  +              IQAVCL++VL SAC+NP+LYGWLN+NF++    M K       S ++ +++T++ +EN
Sbjct:  162 QIIVHPERNAISNTGVVRILFLIWCVAIILSFPLYFFSTVHQDESK--KCFEVTESKSLKPLRFAHSYLMLVLQYVVPLFILSVSYFRICIKIKYRMVNQRGKNNEVSSTSTSQVIESRRLKESRRQRR--------------TNILLSSIAIIFALSWLPLNIVNLVMDFRQSSFNERKDYGNRDPSMIKPN----ENVYDMSKNVTQLHSTVPSIIEPKNVLGIQAVCLLIVLCSACVNPVLYGWLNENFKREFRCMFKSLFPYLQSKTEAAEETQL-LEN 423          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: V4AIT8 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_115283 PE=3 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 5.139e-24
Identity = 100/285 (35.09%), Postives = 155/285 (54.39%), Query Frame = 1
Query:   13 KVIIYPTRSAVQSLEAVXXXXXXXXXXXXMASPLLLFSRVYKDHR----DYYS--CGEDDFRQKTNKLVYTIISIVFQYFVPILIVSXXXXXXXXXXXXXXXNSAINTKQIKENKSKYESINSGKFSAXXXXXXXXXXXTNMLLANLSILFALSWLPLNIVNLYMAVKEHNFN-FTISTGDKKSSFSIPSTNFSNNLYDTNSNDSYSNFIQAVCLMLVLASACINPILYGWLNDNFRKVLPKMLKCSSDSKTSKQTKMEMENKSVMSIIVNPNSAPVTIQIPIVT 846
            +VI+YPT+ +++   A + L +IW+IS +MASP LLFS + +D      D+Y   C ED  +  T K  Y++  IV QY +PI+IV +A++RI  ++KYR+++     +Q   ++S Y+   + +        + R+R+TN LL  ++++FALSWLPLNI NL   + E N + F      ++ S +I                   N   A+C MLVLASAC+NP+LYGWLNDNFR    K+L C          KM++   +       P+ A   + +P +T
Sbjct:  110 QVIVYPTKDSMKRAGAAIALITIWLISFLMASPFLLFSILKEDQPLPAFDFYIYICIED-VKLATEKRAYSVAQIVVQYVLPIVIVIVAHLRICNKLKYRMVH-----QQNPGSRSPYQRKKNER-------NRNRKRKTNFLLIGIAVVFALSWLPLNIFNL---LSEFNLDVFRADLQGREQSINI-------------------NLAYAICHMLVLASACLNPVLYGWLNDNFRTEFMKVLCCQCCKDFQSWIKMKLCCHT-------PDVAAPALNVPAIT 352          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A193KUU3 (NPYR-6 OS=Schmidtea mediterranea OX=79327 GN=npyr-6 PE=2 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 3.642e-23
Identity = 90/260 (34.62%), Postives = 144/260 (55.38%), Query Frame = 1
Query:   13 KVIIYPTRSAVQSLEAVXXXXXXXXXXXXMASPLLLFSRVYKDHRDYYSCGE--DDFRQKTNKLVYTIISIVFQYFVP---ILIVSXXXXXXXXXXXXXXXNSAINT-KQIKEN-KSKYESINSGKFS---AXXXXXXXXXXXTNMLLANLSILFALSWLPLNIVNLYMAVKEHNFNFTISTGDKKSSFSIPSTNFSNNLYDTNSNDSYSN--------------------FIQAVCLMLVLASACINPILYGWLNDNFR 702
            +VI++PT +++    AV  L  IWI+S  +ASPL++FS++   H  +  C E   +F    +KL+Y+++S V QY VP   ++IV                   +N  + I +  +++++      FS   +K+ +E+QR+RRTN+LLA+++++FALSWLPL   N+ M ++E  F F  ST    S F++ +   SN L ++++ +                         IQA CL+ VL+SACINPILYGWLN+NFR
Sbjct:  156 QVIVHPTITSMDRKAAVKMLAVIWILSIFLASPLIVFSKI--KHEGHIQCTEKSQNFAILLSKLIYSMLSAVVQYLVPLIIVIIVYTRICIRIRSRMNLTREPELNVERHISQGCQNQFDDTACQLFSFKRSKRIQEEQRKRRTNILLASIAMIFALSWLPLVSFNILMDIREMRF-FMTSTFTSNSLFNLSTNLMSNMLNNSHTEEKLFERNISLQKPDINGVLQGQTVFLIQASCLLAVLSSACINPILYGWLNENFR 412          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A2C9JJZ3 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106074426 PE=3 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 4.745e-21
Identity = 87/251 (34.66%), Postives = 134/251 (53.39%), Query Frame = 1
Query:    1 MKQNKVIIYPTRSAVQSLEAVXXXXXXXXXXXXMASPLLLFSRVYKDHR-------DYYSCGEDDFRQKTNKLVYTIISIVFQYFVPILIVSXXXXXXXXXXXXXXXNSAINTKQIKE-NKSKYESINSGKFSAXXXXXXXXXXXTNMLLANLSILFALSWLPLNIVNLYMAVKEHNFNFTISTGDKKSSFSIPSTNFSNNLYDTNSNDSYSNFIQAVCLMLVLASACINPILYGWLNDNFRKVLPKMLKC 729
            + + +VI+YPT+ +++ L A + L SIW+IS ++ASP LLFS V +           +Y C ED    +  K  Y++  +V QY +P +I+S+A++RI  +++YR++   ++T       K K E  +  K            R+TN+LLA ++++FALSWLPLNI NL +  +   F   +   D K ++                         A+C MLVL S C+NP+LYGWLNDNFR    K+L C
Sbjct:  131 LDRFQVIVYPTKDSMKKLGAAVALISIWLISFLIASPALLFSVVERRQVLQEVPNVFFYYCLED-VSMEIEKRAYSVAQMVVQYVLPFIILSVAHLRICNKLRYRMVTQNVSTTATTSFQKKKIERRSRRK------------RKTNLLLAGIALVFALSWLPLNIFNLLIDFRGEYFTGRV---DIKLAY-------------------------AICHMLVLCSGCLNPVLYGWLNDNFRTEFIKILCC 340          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: npy8br (neuropeptide Y receptor Y8b [Source:ZFIN;Acc:ZDB-GENE-980526-208])

HSP 1 Score: 52.373 bits (124), Expect = 2.116e-7
Identity = 49/194 (25.26%), Postives = 88/194 (45.36%), Query Frame = 1
Query:  148 DYYSCGEDDFRQKTNKLVYTIISIVFQYFVPILIVSXXXXXXXXXXXXXXXNSAINTKQIKENKSKYESINSGKFSAXXXXXXXXXXXTNMLLANLSILFALSWLPLNIVNLYMAVKEHNFNFTISTGDKKSSFSIPSTNFSNNLYDTNSN--DSYSNFIQAVCLMLVLASACINPILYGWLNDNFRKVLPKML 723
            D+  C E+ +    N+L Y    ++FQY  P+++++  Y+RI+LR+  R  +    T+  ++ K+K+                    R N++LA +  +FA  WLPL + N                                 ++D N        + + +VC ++ +AS C+NPI+YG+LN+NF+K L  +L
Sbjct:  184 DHIVCKEE-WPSPGNRLAYVTSLLMFQYCFPLVLITFCYLRIFLRLCQRK-DIIERTRDARQRKAKHSK------------------RINIMLATIVAVFAFCWLPLTVFN--------------------------------TIFDWNHEALPVCHDAVFSVCHLMAMASTCVNPIIYGFLNNNFQKELKSLL 325          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: prlh2r (prolactin-releasing peptide receptor-like [Source:NCBI gene;Acc:103044274])

HSP 1 Score: 48.9062 bits (115), Expect = 2.778e-6
Identity = 50/186 (26.88%), Postives = 77/186 (41.40%), Query Frame = 1
Query:  160 CGEDDFRQKTNKLVYTIISIVFQYFVPILIVSXXXXXXXXXXXXXXXNSAINTKQIKENKSKYESINSGKFSAXXXXXXXXXXXTNMLLANLSILFALSWLPLNIVNLYMAVKEHNFNFTISTGDKKSSFSIPSTNFSNNLYDTNSNDSYSNFIQAVCLMLVLASACINPILYGWLNDNFRKVLPK 717
            C E    Q+  +L+Y+   ++  YFVP+  V+I+Y  I   ++ R     +    I  N+ K+       F               +LL ++ + FA SWLPL +VNL                D  + F I S N             + N IQ  C +L ++SAC NP +Y  L+D F   L +
Sbjct:  189 CEEFWQGQELGRLIYSCFFLLLSYFVPLAAVTISYCAISHHLRRRAGPGLM--AAIPSNQEKWGRKRRKTF--------------RLLLVSV-LCFAFSWLPLQVVNL--------------IRDLDTDFIILSKN-------------HINVIQVSCHLLAMSSACFNPFIYASLHDKFLAYLCR 330          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: prlhr2a (prolactin releasing hormone receptor 2a [Source:ZFIN;Acc:ZDB-GENE-060209-1])

HSP 1 Score: 48.1358 bits (113), Expect = 4.462e-6
Identity = 28/95 (29.47%), Postives = 44/95 (46.32%), Query Frame = 1
Query:  445 FALSWLPLNIVNLYMAVKEHNFNFTISTGDKKSSFSIPSTNFSNNLYDTNSNDSYSNFIQAVCLMLVLASACINPILYGWLNDNFRKVLPKMLKC 729
            FA+ WLP+++ N+   +++ + N      DK+                      Y   IQ +C +  ++S+C NP LY WL+D FR  L KM  C
Sbjct:  287 FAVCWLPISVFNV---LRDIDINLI----DKR----------------------YFLLIQLLCHLCAMSSSCCNPFLYAWLHDRFRAELRKMFTC 352          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Match: prlh2r (prolactin releasing hormone 2 receptor [Source:ZFIN;Acc:ZDB-GENE-120411-41])

HSP 1 Score: 52.373 bits (124), Expect = 3.808e-8
Identity = 49/202 (24.26%), Postives = 81/202 (40.10%), Query Frame = 1
Query:  160 CGEDDFRQKTNKLVYTIISIVFQYFVPILIVSXXXXXXXXXXXXXXXNSAINTKQIKENKSKYESINSGKFSAXXXXXXXXXXXTNMLLANLSILFALSWLPLNIVNLYMAVKEHNFNFTISTGDKKSSFSIPSTNFSNNLYDTNSNDSYSNFIQAVCLMLVLASACINPILYGWLNDNFRKVLPKMLKCSSDSKTSKQTKM 765
            C E     +  +L Y   ++V  Y +P+L++S++Y +I +++K R++   +   Q + ++++                      T  LL  +   F++ WLPL+I N    V        I   DK                       Y N +Q +C    ++SAC NP +Y WL+D FR  L KM         S  T M
Sbjct:  172 CEEFWIGTERERLAYAYSTLVLTYGLPLLVISLSYFKISVKLKNRVVPGTVTQNQAEMDRARRRK-------------------TFRLLVLVVTAFSVCWLPLHIFNFLRDVD-------IRLIDK----------------------YYFNLVQLLCHWFAMSSACYNPFIYAWLHDRFRSELKKMFTVKRRVAPSNNTGM 325          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011005.1 (pep scaffold:Pmarinus_7.0:GL478289:65146:65414:1 gene:ENSPMAG00000009978.1 transcript:ENSPMAT00000011005.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 47.7506 bits (112), Expect = 8.273e-8
Identity = 28/102 (27.45%), Postives = 47/102 (46.08%), Query Frame = 1
Query:  439 ILFALSWLPLNIVNLYMAVKEHNFNFTISTGDKKSSFSIPSTNFSNNLYDTNSNDSYSNFIQAVCLMLVLASACINPILYGWLNDNFRKVLPKMLKCSSDSK 744
            + FALSWLPL++ +L                          T+F ++L D  +       +   C +L + S C+NP+LYG+LN+  +K L   ++C+   K
Sbjct:   13 LAFALSWLPLHVFHLV-------------------------TDFDDSLLDNGA----FKLVFCTCHLLGMISCCLNPVLYGFLNNGLKKELLTAVRCARPRK 85          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Match: galr1b (galanin receptor 1b [Source:ZFIN;Acc:ZDB-GENE-140624-1])

HSP 1 Score: 45.8246 bits (107), Expect = 5.540e-6
Identity = 30/117 (25.64%), Postives = 55/117 (47.01%), Query Frame = 1
Query:  442 LFALSWLPLNIVNLYMAVKEHNFNFTISTGDKKSSFSIPSTNFSNNLYDTNSNDSYSNFIQAVCLMLVLASACINPILYGWLNDNFRKVLPKMLKCS---SDSKTSKQTKMEMENKS 783
            +F +SWLP +++++++                  SF + S +F+  +   +   SY N             +C NPI+Y +L++NFRK   ++  C    S S  +K T++ +EN S
Sbjct:  253 VFCISWLPHHVIHMWVL---------------YGSFPLTSASFAFRI--VSHCLSYGN-------------SCANPIIYAFLSENFRKAYRQVFSCQLPVSSSLKAKSTRIRLENFS 339          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: prlhr2b (prolactin-releasing peptide receptor-like [Source:NCBI gene;Acc:101164576])

HSP 1 Score: 55.4546 bits (132), Expect = 1.747e-8
Identity = 32/103 (31.07%), Postives = 45/103 (43.69%), Query Frame = 1
Query:  421 LLANLSILFALSWLPLNIVNLYMAVKEHNFNFTISTGDKKSSFSIPSTNFSNNLYDTNSNDSYSNFIQAVCLMLVLASACINPILYGWLNDNFRKVLPKMLKC 729
            L+A L   FA+ WLP+++ N+   +  H  N                               Y   IQ +C +  ++S+C NP LY WL+D FR  L KMLKC
Sbjct:  273 LVALLVSAFAVCWLPIHVFNVLRDIDIHLIN-----------------------------KRYFLLIQLLCHLCAMSSSCCNPFLYAWLHDRFRSELRKMLKC 346          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: npy8br (neuropeptide Y receptor type 1 [Source:NCBI gene;Acc:101167799])

HSP 1 Score: 54.6842 bits (130), Expect = 3.824e-8
Identity = 53/199 (26.63%), Postives = 88/199 (44.22%), Query Frame = 1
Query:  190 NKLVYTIISIVFQYFVPILIVSXXXXXXXXXXXXXXXNSAINTKQIKENKSKYESINSGKFSAXXXXXXXXXXXTNMLLANLSILFALSWLPLNIVNLYMAVKEHNFNFTISTGDKKSSFSIPSTNFSNNLYDTNSNDSYSNFIQAVCLMLVLASACINPILYGWLNDNFRKVLPK-MLKCSSDSKTSKQTKMEMENKS 783
             +  YT   +VFQYF+P+ ++ I Y++IYL              ++K  K   E     K SA+           N +L ++ + FALSWLPLNI N                            ++++++  T  +D   +F    C ++ + S C+NPI+YG+LN NF+K L   +L+C     T +   + +   S
Sbjct:  199 GRRAYTTSLLVFQYFLPLSLILICYLQIYL--------------RLKRRKDMVERGRKNKGSAR----------INAMLFSIVVAFALSWLPLNIFNTVF-------------------------DWNHDVIPTCGHDIIFSF----CHLMAMVSTCVNPIIYGFLNSNFQKQLKSTVLRCRCWGVTERYESIPLSTVS 344          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: npy4r (neuropeptide Y receptor type 1-like [Source:NCBI gene;Acc:101168234])

HSP 1 Score: 53.9138 bits (128), Expect = 7.732e-8
Identity = 50/207 (24.15%), Postives = 91/207 (43.96%), Query Frame = 1
Query:  169 DDFRQKTNKLVYTIISIVFQYFVPILIVSXXXXXXXXXXXXXXXNSAINTKQIKENKSKYESINSGKFSAXXXXXXXXXXXTNMLLANLSILFALSWLPLNIVNLYMAVKEHNFNFTISTGDKKSSFSIPSTNFSNNLYDTNSNDSYSNFIQAVCLMLVLASACINPILYGWLNDNFRK-VLPKMLKCSSDSKTSKQTKMEMENKSV 786
            + +  +  ++ YT   +VFQY  P+L+V      + + ++ R     ++  +  EN+    S                 RR N++LA L   FAL WLPL I N+            ++  ++++   +P                + N + ++C +L ++S CINPI+YG+LN NFR+ V   +L C    +  +  +  M   +V
Sbjct:  253 EHWPSQEQRVAYTTWLLVFQYCGPLLLV--LLCYVRVFVRLRHRKDMLDRARTPENQRITHS-----------------RRINIMLAALITAFALCWLPLTIFNV------------VADWNQEA---LPV--------------CHHNLLFSLCHLLAMSSTCINPIIYGFLNSNFRQEVREVLLHCRHFQQGGEFEQFPMSTGNV 411          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: prlhr2a (prolactin-releasing peptide receptor [Source:NCBI gene;Acc:101174270])

HSP 1 Score: 47.7506 bits (112), Expect = 6.572e-6
Identity = 19/44 (43.18%), Postives = 26/44 (59.09%), Query Frame = 1
Query:  598 NDSYSNFIQAVCLMLVLASACINPILYGWLNDNFRKVLPKMLKC 729
            +  Y   IQ +C +  ++S+C NP LY WL+D FR  L KM  C
Sbjct:  304 DKRYFLLIQLLCHLCAMSSSCCNPFLYAWLHDRFRAELRKMFTC 347          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000004267.1 (SMESG000004267.1)

HSP 1 Score: 478.789 bits (1231), Expect = 6.066e-170
Identity = 281/282 (99.65%), Postives = 282/282 (100.00%), Query Frame = 1
Query:   13 KVIIYPTRSAVQSLEAVXXXXXXXXXXXXMASPLLLFSRVYKDHRDYYSCGEDDFRQKTNKLVYTIISIVFQYFVPILIVSXXXXXXXXXXXXXXXNSAINTKQIKENKSKYESINSGKFSAXXXXXXXXXXXTNMLLANLSILFALSWLPLNIVNLYMAVKEHNFNFTISTGDKKSSFSIPSTNFSNNLYDTNSNDSYSNFIQAVCLMLVLASACINPILYGWLNDNFRKVLPKMLKCSSDSKTSKQTKMEMENKSVMSIIVNPNSAPVTIQIPIVTPLIC 858
            +VIIYPTRSAVQSLEAVLCLCSIWIISCIMASPLLLFSRVYKDHRDYYSCGEDDFRQKTNKLVYTIISIVFQYFVPILIVSIAYIRIYLRIKYRLINSAINTKQIKENKSKYESINSGKFSAKQKKEKQRQRRTNMLLANLSILFALSWLPLNIVNLYMAVKEHNFNFTISTGDKKSSFSIPSTNFSNNLYDTNSNDSYSNFIQAVCLMLVLASACINPILYGWLNDNFRKVLPKMLKCSSDSKTSKQTKMEMENKSVMSIIVNPNSAPVTIQIPIVTPLIC
Sbjct:  169 QVIIYPTRSAVQSLEAVLCLCSIWIISCIMASPLLLFSRVYKDHRDYYSCGEDDFRQKTNKLVYTIISIVFQYFVPILIVSIAYIRIYLRIKYRLINSAINTKQIKENKSKYESINSGKFSAKQKKEKQRQRRTNMLLANLSILFALSWLPLNIVNLYMAVKEHNFNFTISTGDKKSSFSIPSTNFSNNLYDTNSNDSYSNFIQAVCLMLVLASACINPILYGWLNDNFRKVLPKMLKCSSDSKTSKQTKMEMENKSVMSIIVNPNSAPVTIQIPIVTPLIC 450          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000062221.1 (SMESG000062221.1)

HSP 1 Score: 110.153 bits (274), Expect = 2.810e-27
Identity = 94/260 (36.15%), Postives = 146/260 (56.15%), Query Frame = 1
Query:   13 KVIIYPTRSAVQSLEAVXXXXXXXXXXXXMASPLLLFSRVYKDHRDYYSCGE--DDFRQKTNKLVYTIISIVFQYFVP---ILIVSXXXXXXXXXXXXXXXNSAINT-KQIKEN-KSKYESINSGKFS---AXXXXXXXXXXXTNMLLANLSILFALSWLPLNIVNLYMAVKEHNFNFTISTGDKKSSFSIPSTNFSNNLYDTNS-------NDSYSN-------------FIQAVCLMLVLASACINPILYGWLNDNFR 702
            +VI++PT +++    AV  L  IWI+S  +ASPL++FS++   H  +  C E   +F    +KL+Y+++S + QY VP   ++IV                   +N  + I +  K++++      FS   +K+ +EKQR+RRTN+LLA+++++FALSWLPL   N+ M ++E  F F  ST    S F++ +   SN L ++++       N S  N              IQA CL+ VL+SACINPILYGWLN+NFR
Sbjct:  156 QVIVHPTITSMDRKAAVKMLAVIWILSIFLASPLIVFSKI--KHEGHIQCTEKSQNFAILVSKLIYSMLSAIVQYLVPLIIVIIVYTRICIRIRSRMNLTREPELNVERHISQGCKNQFDDTACQLFSFKRSKRIQEKQRKRRTNILLASIAMIFALSWLPLVSFNILMDIREMRF-FMTSTFTSNSLFNLSTNLMSNMLNNSHTEEKLFERNISLQNPDINGVLQGQTVFLIQASCLLAVLSSACINPILYGWLNENFR 412          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000052051.1 (SMESG000052051.1)

HSP 1 Score: 102.834 bits (255), Expect = 1.169e-24
Identity = 92/275 (33.45%), Postives = 147/275 (53.45%), Query Frame = 1
Query:   16 VIIYPTRSAVQSLEAVXXXXXXXXXXXXMASPLLLFSRVYKDHRDYYSCGEDDFRQ--KTNKLVYTIISIVFQYFVPILIVSXXXXXXXXXXXXXXXNSA-------INTKQIKENKSKYESINSGKFSA-------XXXXXXXXXXXTNMLLANLSILFALSWLPLNIVNLYMAVKEHNFNFTISTGDKKSSFSIPSTNFSNNLYDTNSNDSYSNFIQAVCLMLVLASACINPILYGWLNDNFRKVLPKML---KCSSDSKTSKQTKMEMENKS 783
            VI+YPT+ ++ +  A   +  IW  + I+ASPL +FS +   H   Y C E   +Q  +  KLVY++  ++FQY +P++I+   Y +IY R++ R+   +        +T Q  ++    +S    +FS+       K   E  RQR+ N+LL +++++F LSWLPLNI N+ M  + + +N  +   +  S +S  +T        T S   Y    QAVCL+LVL+SAC NPILY WLN++FR    + L   K  S +   K ++M   + S
Sbjct:  171 VIMYPTKKSLDNRGATGVIILIWFFAFILASPLAIFSHLDSVHSIRYECTELSSKQFFREMKLVYSVFGMLFQYLLPLIILLTVYTKIYRRMESRIRKHSNYPKQELASTDQATQSNLLQDSKTLSQFSSFSLLKEQKHLVEISRQRKVNILLFSIAVVFTLSWLPLNINNMAMDFQLYYYNKDME--NVTSYYSATATQ------STVSYTQYVTITQAVCLLLVLSSACTNPILYSWLNESFRNEFQRFLFWRKPDSQTNRIKVSRMHFNHAS 437          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000003106.1 (SMESG000003106.1)

HSP 1 Score: 93.2041 bits (230), Expect = 2.378e-21
Identity = 90/259 (34.75%), Postives = 138/259 (53.28%), Query Frame = 1
Query:   13 KVIIYPTRSAVQSLEAVXXXXXXXXXXXXMASPLLLFSRVYKDHRD-----YYSCGE--DDFRQKTNKLVYTIISIVFQYFVPILIVSXXXXXXXXXXXXXXXNSAINTKQIKENK---SKYESINSGKFSAXXXX---------XXXXXXXTNMLLANLSILFALSWLPLNIVNLYMAVKEHNFNFTISTGDKKSSFSIPSTNFSNNLYDTNSNDSYSNFIQAVCLMLVLASACINPILYGWLNDNFRKVLPKMLKCS 732
            ++II+PT++ +Q L     L  +WIIS  +ASP++ F++    ++         C E   D   +  KL Y+ +S V QY  P+LIV   Y RI+ +IK R++N     K  KE     SK E+   G  S +            EK+RQ+RTN+LL  + ++FALSWLP+NI+NL M +        ++    + S S  S ++ N              IQA+CL++V+ SAC NP+LY WLNDNF++ +  ++ CS
Sbjct:  162 QLIIHPTKNNLQQLATFRALIVMWIISIFLASPMIFFTKNESFNQPNSKVIVTRCAEYDPDLSMRKIKLAYSTMSFVIQYISPLLIVVTVYTRIFFKIKKRMVN-----KSKKEGSCFISKEETCQEGDTSTRMLMNVKKRKQVLEKKRQKRTNILLFCIGLIFALSWLPINIMNLIMDI-------ILAIPSYRESTSFKSLSWRN-----------VKTIQAICLLIVMCSACTNPLLYSWLNDNFKEKIKNLICCS 397          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000053241.1 (SMESG000053241.1)

HSP 1 Score: 92.8189 bits (229), Expect = 2.481e-21
Identity = 87/239 (36.40%), Postives = 140/239 (58.58%), Query Frame = 1
Query:    1 MKQNKVIIYPTRSAVQSLEAVXXXXXXXXXXXXMASPLLLFSRVYKDHR---DYYSCGED--DFRQKTNKLVYTIISIVFQYFVPILIVSXXXXXXXXXXXXXXXNSAINTKQIKENKSKYESINSGKFSAXXXXXXXXXXXTNMLLANLSILFALSWLPLNIVNLYMAVKEHNFNFTISTGDKKSSFSIPSTNFSNNLYDTNSNDSYSNFIQAVCLMLVLASACINPILYGWLNDNFR 702
            + + +VI+ PTR+++Q + A+  +  IWI+S I+ASPL+LFS V   +    ++  C E   +   +  K+ Y+I ++V  Y +P+ IV+I Y++IY  IK R+ N  ++ K ++ + S   S      + KQK + QRQRR N+LL +++I+FA+SWLPLN++N+ M +                            +Y+ ++    S  IQ++CL++VL SAC NPILYGWLNDNFR
Sbjct:  150 LDRYQVILCPTRNSLQLIGAIKVMLGIWILSLIIASPLVLFSGVETVNMLKANHTRCTEHTVEIYMRKLKVGYSIATLVLLYVIPLSIVTITYMKIYRIIKQRMNN--LHKKDLESSNSLPNSHKMELLTDKQKYDIQRQRRANILLLSITIVFAISWLPLNLINMIMDLYL--------------------------MYNESTVGPMSLRIQSICLLMVLTSACTNPILYGWLNDNFR 360          
The following BLAST results are available for this feature:
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
NPY1R5.380e-627.89neuropeptide Y receptor Y1 [Source:HGNC Symbol;Acc... [more]
PRLHR7.007e-642.55prolactin releasing hormone receptor [Source:HGNC ... [more]
PRLHR7.007e-642.55prolactin releasing hormone receptor [Source:HGNC ... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
NPFR3.249e-1634.02gene:FBgn0037408 transcript:FBtr0308318[more]
NPFR3.477e-1634.02gene:FBgn0037408 transcript:FBtr0078590[more]
NPFR2.994e-1531.02gene:FBgn0037408 transcript:FBtr0308316[more]
NPFR2.998e-1531.02gene:FBgn0037408 transcript:FBtr0308317[more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npy1r8.494e-925.00neuropeptide Y receptor Y1 [Source:ZFIN;Acc:ZDB-GE... [more]
npy1r8.494e-925.00neuropeptide Y receptor Y1 [Source:ZFIN;Acc:ZDB-GE... [more]
npy1r9.578e-925.00neuropeptide Y receptor Y1 [Source:ZFIN;Acc:ZDB-GE... [more]
npy1r1.573e-824.63neuropeptide Y receptor Y1 [Source:ZFIN;Acc:ZDB-GE... [more]
npy1r1.573e-824.63neuropeptide Y receptor Y1 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
errfi11.075e-725.96ERBB receptor feedback inhibitor 1 [Source:Xenbase... [more]
npy4r6.547e-725.17neuropeptide Y receptor Y4 [Source:NCBI gene;Acc:1... [more]
npy5r2.738e-629.41neuropeptide Y receptor Y5 [Source:NCBI gene;Acc:7... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Prlhr2.792e-731.43prolactin releasing hormone receptor [Source:MGI S... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q9VNM1|NPFR_DROME3.485e-1534.02Neuropeptide F receptor OS=Drosophila melanogaster... [more]
sp|Q64121|PRLHR_RAT5.927e-732.38Prolactin-releasing peptide receptor OS=Rattus nor... [more]
sp|Q6VMN6|PRLHR_MOUSE1.953e-631.43Prolactin-releasing peptide receptor OS=Mus muscul... [more]
sp|Q4EW11|PRLHR_BOVIN5.807e-629.52Prolactin-releasing peptide receptor OS=Bos taurus... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUX42.443e-16598.94NPYR-5 OS=Schmidtea mediterranea OX=79327 GN=npyr-... [more]
A0A193KUR82.319e-2533.22NPYR-3 (Fragment) OS=Schmidtea mediterranea OX=793... [more]
V4AIT85.139e-2435.09G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A193KUU33.642e-2334.62NPYR-6 OS=Schmidtea mediterranea OX=79327 GN=npyr-... [more]
A0A2C9JJZ34.745e-2134.66G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
npy8br2.116e-725.26neuropeptide Y receptor Y8b [Source:ZFIN;Acc:ZDB-G... [more]
prlh2r2.778e-626.88prolactin-releasing peptide receptor-like [Source:... [more]
prlhr2a4.462e-629.47prolactin releasing hormone receptor 2a [Source:ZF... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
prlh2r3.808e-824.26prolactin releasing hormone 2 receptor [Source:ZFI... [more]
ENSPMAT00000011005.18.273e-827.45pep scaffold:Pmarinus_7.0:GL478289:65146:65414:1 g... [more]
galr1b5.540e-625.64galanin receptor 1b [Source:ZFIN;Acc:ZDB-GENE-1406... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
prlhr2b1.747e-831.07prolactin-releasing peptide receptor-like [Source:... [more]
npy8br3.824e-826.63neuropeptide Y receptor type 1 [Source:NCBI gene;A... [more]
npy4r7.732e-824.15neuropeptide Y receptor type 1-like [Source:NCBI g... [more]
prlhr2a6.572e-643.18prolactin-releasing peptide receptor [Source:NCBI ... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000004267.16.066e-17099.65SMESG000004267.1[more]
SMESG000062221.12.810e-2736.15SMESG000062221.1[more]
SMESG000052051.11.169e-2433.45SMESG000052051.1[more]
SMESG000003106.12.378e-2134.75SMESG000003106.1[more]
SMESG000053241.12.481e-2136.40SMESG000053241.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016794 ID=SMED30016794|Name=G_PROTEIN_RECEP_F1_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=858bp
ATGAAACAAAACAAGGTCATTATATATCCTACAAGATCGGCAGTTCAAAG
TCTCGAAGCAGTCTTATGTTTATGTTCAATTTGGATTATTTCTTGTATAA
TGGCTAGTCCACTGTTATTATTTTCCCGAGTTTACAAAGATCACCGAGAT
TACTACAGCTGTGGAGAAGATGATTTTCGACAGAAAACTAACAAACTTGT
TTACACTATTATAAGTATTGTATTTCAATATTTTGTCCCGATATTAATAG
TCAGTATTGCTTATATAAGAATATATCTGAGAATAAAGTATCGACTAATA
AATTCGGCAATCAATACAAAACAAATAAAAGAAAACAAATCGAAATATGA
GTCGATAAATTCTGGAAAGTTTTCCGCAAAACAAAAAAAAGAAAAACAAA
GACAAAGAAGAACAAATATGCTTTTAGCAAATTTATCAATTTTATTCGCA
TTGAGTTGGCTGCCTCTCAACATTGTCAATCTTTATATGGCAGTAAAAGA
ACACAATTTCAATTTTACAATTTCTACGGGAGATAAAAAAAGCAGTTTCA
GTATTCCAAGTACAAATTTTTCAAATAATCTATACGATACCAACAGTAAC
GATTCTTATTCAAATTTCATCCAAGCCGTCTGTCTAATGTTGGTATTGGC
CTCTGCGTGCATTAATCCAATTCTTTACGGTTGGTTAAATGATAATTTTC
GGAAAGTTCTGCCTAAAATGCTAAAATGTTCGAGCGACTCAAAAACTTCC
AAGCAGACCAAAATGGAGATGGAAAACAAATCGGTGATGTCTATTATTGT
CAATCCAAATAGTGCACCAGTCACTATTCAAATACCAATTGTGACTCCCT
TAATTTGC
back to top

protein sequence of SMED30016794-orf-1

>SMED30016794-orf-1 ID=SMED30016794-orf-1|Name=SMED30016794-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=286bp
MKQNKVIIYPTRSAVQSLEAVLCLCSIWIISCIMASPLLLFSRVYKDHRD
YYSCGEDDFRQKTNKLVYTIISIVFQYFVPILIVSIAYIRIYLRIKYRLI
NSAINTKQIKENKSKYESINSGKFSAKQKKEKQRQRRTNMLLANLSILFA
LSWLPLNIVNLYMAVKEHNFNFTISTGDKKSSFSIPSTNFSNNLYDTNSN
DSYSNFIQAVCLMLVLASACINPILYGWLNDNFRKVLPKMLKCSSDSKTS
KQTKMEMENKSVMSIIVNPNSAPVTIQIPIVTPLIC
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000028Category 2 cell
PLANA:0000044cephalic ganglia
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000611NPY_rcpt
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
GO:0007218neuropeptide signaling pathway
Vocabulary: molecular function
TermDefinition
GO:0004983neuropeptide Y receptor activity
GO:0004930G-protein coupled receptor activity
GO:0004871signal transducer activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 208..234
score: 30.68
coord: 138..162
score: 25.06
coord: 69..92
score: 22.82
coord: 19..40
score: 21.9
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 10..226
e-value: 2.3E-19
score: 69.7
IPR000611Neuropeptide Y receptor familyPRINTSPR01012NRPEPTIDEYRcoord: 224..237
score: 54.87
coord: 213..222
score: 35.0
coord: 16..31
score: 17.05
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 5..254
e-value: 1.0E-35
score: 125.2
NoneNo IPR availablePANTHERPTHR24235:SF7NEUROPEPTIDE F RECEPTORcoord: 5..168
NoneNo IPR availablePANTHERPTHR24235FAMILY NOT NAMEDcoord: 5..168
NoneNo IPR availablePANTHERPTHR24235:SF7NEUROPEPTIDE F RECEPTORcoord: 189..263
NoneNo IPR availablePANTHERPTHR24235FAMILY NOT NAMEDcoord: 189..263
NoneNo IPR availablePROSITEPS51257PROKAR_LIPOPROTEINcoord: 1..32
score: 6.0
NoneNo IPR availableCDDcd152037tmA_NPYR-likecoord: 6..237
e-value: 1.15778E-49
score: 163.929
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 8..249
NoneNo IPR availableTMHMMTMhelixcoord: 206..228
NoneNo IPR availableTMHMMTMhelixcoord: 20..42
NoneNo IPR availableTMHMMTMhelixcoord: 67..89
NoneNo IPR availableTMHMMTMhelixcoord: 141..163
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 1..226
score: 21.475