Zinc finger protein zic

Overview
NameZinc finger protein zic
Smed IDSMED30016788
Length (bp)1895
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Zinc finger protein zic (SMED30016788) t-SNE clustered cells

Violin plots show distribution of expression levels for Zinc finger protein zic (SMED30016788) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Zinc finger protein zic (SMED30016788) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Zinc finger protein zic (SMED30016788) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016788

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
anterior region of the whole animalSMED30016788SMESG000052644.1 dd_Smed_v4_15531_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
anterior region of the whole animalSMED30016788SMESG000052644.1 dd_Smed_v4_15531_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
headSMED30016788SMESG000052644.1 dd_Smed_v4_15531_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
headSMED30016788SMESG000052644.1 dd_Smed_v4_15531_0_1dd_Smed_v4PMID:24992682
Vásquez-Doorman et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30016788SMESG000052644.1 zic-2smed_ncbi_20200123PMID:24992682
Vásquez-Doorman et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30016788SMESG000052644.1 SmedASXL_008776SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
muscle cellSMED30016788SMESG000052644.1 dd_Smed_v4_15531_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
anterior region of the whole animalSMED30016788SMESG000052644.1 dd_Smed_v4_15531_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
lateral region of the whole animalSMED30016788SMESG000052644.1 dd_Smed_v4_15531_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30016788SMESG000052644.1 dd_Smed_v4_15531_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30016788SMESG000052644.1 dd_Smed_v6_15531_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30016788SMESG000052644.1 OX_Smed_1.0.19409ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Zinc finger protein zic vs. Ensembl Human
Match: ZIC2 (Zic family member 2 [Source:HGNC Symbol;Acc:HGNC:12873])

HSP 1 Score: 271.166 bits (692), Expect = 1.234e-82
Identity = 126/217 (58.06%), Postives = 160/217 (73.73%), Query Frame = 1
Query:  703 AAFYQFFHRNAVSGFRTEFQCLWLD-KHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHNISPNNDYNMDANS--YETDFNQQLNSCPKMPKPNQN 1344
             AF+++  +  +   + E  C W+D + +   +++C K F T++E+V H++++HVGGPEQ +H C+W+ C R+ KPFKAKYKLVNH+RVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPF+C+FEGCDRRFANSSDRKKHMHVH +DKPY CK   CDKSYTHPSSLRKHM++H  SP    +  A S  YE+     L S    P+ + N
Sbjct:  241 GAFFRYMRQQCI---KQELICKWIDPEQLSNPKKSCNKTFSTMHELVTHVSVEHVGGPEQSNHVCFWEECPREGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFQCEFEGCDRRFANSSDRKKHMHVHTSDKPYLCKM--CDKSYTHPSSLRKHMKVHESSPQGSESSPAASSGYESSTPPGLVSPSAEPQSSSN 452          
BLAST of Zinc finger protein zic vs. Ensembl Human
Match: ZIC3 (Zic family member 3 [Source:HGNC Symbol;Acc:HGNC:12874])

HSP 1 Score: 268.085 bits (684), Expect = 3.791e-82
Identity = 119/197 (60.41%), Postives = 151/197 (76.65%), Query Frame = 1
Query:  703 AAFYQFFHRNAVSGFRTEFQCLWLDK-HMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHNISPNNDYNMDANSYET 1290
             AF+++  +      + E  C W+D+  +   +++C + F T++E+V H+T++HVGGPEQ +H CYW+ C R+ K FKAKYKLVNH+RVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+FEGCDRRFANSSDRKKHMHVH +DKPY CK   CDKSYTHPSSLRKHM++H    ++     ++ YE+
Sbjct:  237 GAFFRYMRQP----IKQELSCKWIDEAQLSRPKKSCDRTFSTMHELVTHVTMEHVGGPEQNNHVCYWEECPREGKSFKAKYKLVNHIRVHTGEKPFPCPFPGCGKIFARSENLKIHKRTHTGEKPFKCEFEGCDRRFANSSDRKKHMHVHTSDKPYICKV--CDKSYTHPSSLRKHMKVHESQGSDSSPAASSGYES 427          
BLAST of Zinc finger protein zic vs. Ensembl Human
Match: ZIC4 (Zic family member 4 [Source:HGNC Symbol;Acc:HGNC:20393])

HSP 1 Score: 262.307 bits (669), Expect = 9.389e-82
Identity = 118/193 (61.14%), Postives = 142/193 (73.58%), Query Frame = 1
Query:  703 AAFYQFFHRNAVSGFRTEFQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHNISPNNDYNMDANS 1281
             AF+++  +      + E  C WL          C K F T++E+V H+T++HVGGPEQ +H C+W+ C R  KPFKAKYKLVNH+RVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPF+C+FEGC+RRFANSSDRKKH HVH +DKPY CK  GCDK YTHPSSLRKHM++H  SP      D+ +
Sbjct:  114 GAFFRYMRQP----IKQELICKWLAADGTATPSLCSKTFSTMHELVTHVTVEHVGGPEQANHICFWEECPRQGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFRCEFEGCERRFANSSDRKKHSHVHTSDKPYTCKVRGCDKCYTHPSSLRKHMKVHGRSPPPSSGYDSAT 302          
BLAST of Zinc finger protein zic vs. Ensembl Human
Match: ZIC4 (Zic family member 4 [Source:HGNC Symbol;Acc:HGNC:20393])

HSP 1 Score: 262.307 bits (669), Expect = 9.389e-82
Identity = 118/193 (61.14%), Postives = 142/193 (73.58%), Query Frame = 1
Query:  703 AAFYQFFHRNAVSGFRTEFQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHNISPNNDYNMDANS 1281
             AF+++  +      + E  C WL          C K F T++E+V H+T++HVGGPEQ +H C+W+ C R  KPFKAKYKLVNH+RVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPF+C+FEGC+RRFANSSDRKKH HVH +DKPY CK  GCDK YTHPSSLRKHM++H  SP      D+ +
Sbjct:  114 GAFFRYMRQP----IKQELICKWLAADGTATPSLCSKTFSTMHELVTHVTVEHVGGPEQANHICFWEECPRQGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFRCEFEGCERRFANSSDRKKHSHVHTSDKPYTCKVRGCDKCYTHPSSLRKHMKVHGRSPPPSSGYDSAT 302          
BLAST of Zinc finger protein zic vs. Ensembl Human
Match: ZIC4 (Zic family member 4 [Source:HGNC Symbol;Acc:HGNC:20393])

HSP 1 Score: 262.307 bits (669), Expect = 9.389e-82
Identity = 118/193 (61.14%), Postives = 142/193 (73.58%), Query Frame = 1
Query:  703 AAFYQFFHRNAVSGFRTEFQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHNISPNNDYNMDANS 1281
             AF+++  +      + E  C WL          C K F T++E+V H+T++HVGGPEQ +H C+W+ C R  KPFKAKYKLVNH+RVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPF+C+FEGC+RRFANSSDRKKH HVH +DKPY CK  GCDK YTHPSSLRKHM++H  SP      D+ +
Sbjct:  114 GAFFRYMRQP----IKQELICKWLAADGTATPSLCSKTFSTMHELVTHVTVEHVGGPEQANHICFWEECPRQGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFRCEFEGCERRFANSSDRKKHSHVHTSDKPYTCKVRGCDKCYTHPSSLRKHMKVHGRSPPPSSGYDSAT 302          
BLAST of Zinc finger protein zic vs. Ensembl Celegans
Match: ref-2 (REgulator of Fusion [Source:UniProtKB/TrEMBL;Acc:Q7JNM3])

HSP 1 Score: 184.882 bits (468), Expect = 2.948e-53
Identity = 93/185 (50.27%), Postives = 118/185 (63.78%), Query Frame = 1
Query:  742 GFRTEFQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIH------NISPNNDYNMDAN 1278
            G   + QCLW     +   + C  +     E+  H++ +H+    +    C WK C R+FK FKAKYKLVNH+RVHTGE+PF C    C K+FARSENLKIHKR H+GEKPF+C   GC + FANSSDRKKHMHVH + KPY C    C K+YTHPSSLRKH ++H       +SP +D + D+ 
Sbjct:   65 GGDKQVQCLW-----ETNGQVCMHVCQNSGELSTHISSNHITHDSKF--VCLWKGCDREFKMFKAKYKLVNHMRVHTGERPFLCDV--CNKVFARSENLKIHKRIHSGEKPFQCTHNGCTKLFANSSDRKKHMHVHSSHKPYSCMYPDCGKTYTHPSSLRKHTKVHENEKKSQLSPEHDESSDSG 240          
BLAST of Zinc finger protein zic vs. Ensembl Celegans
Match: ref-2 (REgulator of Fusion [Source:UniProtKB/TrEMBL;Acc:Q7JNM3])

HSP 1 Score: 184.882 bits (468), Expect = 2.948e-53
Identity = 93/185 (50.27%), Postives = 118/185 (63.78%), Query Frame = 1
Query:  742 GFRTEFQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIH------NISPNNDYNMDAN 1278
            G   + QCLW     +   + C  +     E+  H++ +H+    +    C WK C R+FK FKAKYKLVNH+RVHTGE+PF C    C K+FARSENLKIHKR H+GEKPF+C   GC + FANSSDRKKHMHVH + KPY C    C K+YTHPSSLRKH ++H       +SP +D + D+ 
Sbjct:   65 GGDKQVQCLW-----ETNGQVCMHVCQNSGELSTHISSNHITHDSKF--VCLWKGCDREFKMFKAKYKLVNHMRVHTGERPFLCDV--CNKVFARSENLKIHKRIHSGEKPFQCTHNGCTKLFANSSDRKKHMHVHSSHKPYSCMYPDCGKTYTHPSSLRKHTKVHENEKKSQLSPEHDESSDSG 240          
BLAST of Zinc finger protein zic vs. Ensembl Celegans
Match: ref-2 (REgulator of Fusion [Source:UniProtKB/TrEMBL;Acc:Q7JNM3])

HSP 1 Score: 185.267 bits (469), Expect = 3.436e-53
Identity = 93/185 (50.27%), Postives = 118/185 (63.78%), Query Frame = 1
Query:  742 GFRTEFQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIH------NISPNNDYNMDAN 1278
            G   + QCLW     +   + C  +     E+  H++ +H+    +    C WK C R+FK FKAKYKLVNH+RVHTGE+PF C    C K+FARSENLKIHKR H+GEKPF+C   GC + FANSSDRKKHMHVH + KPY C    C K+YTHPSSLRKH ++H       +SP +D + D+ 
Sbjct:   78 GGDKQVQCLW-----ETNGQVCMHVCQNSGELSTHISSNHITHDSKF--VCLWKGCDREFKMFKAKYKLVNHMRVHTGERPFLCDV--CNKVFARSENLKIHKRIHSGEKPFQCTHNGCTKLFANSSDRKKHMHVHSSHKPYSCMYPDCGKTYTHPSSLRKHTKVHENEKKSQLSPEHDESSDSG 253          
BLAST of Zinc finger protein zic vs. Ensembl Celegans
Match: tra-1 (Sex-determining transformer protein 1 [Source:UniProtKB/Swiss-Prot;Acc:P34708])

HSP 1 Score: 155.606 bits (392), Expect = 2.291e-39
Identity = 76/163 (46.63%), Postives = 103/163 (63.19%), Query Frame = 1
Query:  754 EFQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHT--CYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMH-VHMNDKPYFCKQEGCDKSYTHPSSLRKHMR 1233
            +  C W         ++C   F T+  +V+H+   HV   EQ  H   C W+ C R+ + FKA Y L+ H+R HTGEKP +C +  CGK ++R ENLK H+RTHTGEKP+KC+F  C++ F+N+SDR KH +  H N KPY C+   C KSYT PSSLRKH++
Sbjct:  207 DLTCRW---------KSCNSSFQTLKALVDHVQESHVQSTEQEHHAWRCEWEGCDRN-ETFKALYMLIVHVRRHTGEKPNKCEYPGCGKEYSRLENLKTHRRTHTGEKPYKCEFADCEKAFSNASDRAKHQNRTHSNLKPYSCQIPQCTKSYTDPSSLRKHIK 359          
BLAST of Zinc finger protein zic vs. Ensembl Celegans
Match: ztf-14 (Zinc finger putative Transcription Factor family [Source:UniProtKB/TrEMBL;Acc:Q93902])

HSP 1 Score: 109.383 bits (272), Expect = 5.735e-25
Identity = 63/159 (39.62%), Postives = 84/159 (52.83%), Query Frame = 1
Query:  760 QCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKH-MHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMR 1233
            QCLW    +  + R     F  ++   NH+  + V         C W+ C R FK     Y+   H R HT +K + C    C K + R ENLK H+RTHTGEKP+ C+   C++ F N+SDR KH    H N+KPY C    C  +YT PSSLRKH++
Sbjct:  232 QCLWDGCTLTLDDR--ATFFVHVD---NHIQKNEVN--------CKWRYCERSFK---QTYEFTAHKRTHTKQKLYCCEV--CPKRYGRLENLKTHRRTHTGEKPYHCNVPNCNKSFTNASDRSKHSKRTHSNEKPYCCDFGSCACAYTDPSSLRKHVK 372          
BLAST of Zinc finger protein zic vs. Ensembl Fly
Match: opa (gene:FBgn0003002 transcript:FBtr0078836)

HSP 1 Score: 269.626 bits (688), Expect = 1.748e-81
Identity = 130/241 (53.94%), Postives = 162/241 (67.22%), Query Frame = 1
Query:  580 NHSQNHHQSMPCNPGTTLEPQILHSQTVAPTHPAMSSYSHQAAFYQFFH---RNAVSGFRTEFQCLWLDKHMKE-----ERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHN----ISPNNDYN 1266
             H  NHH + P                ++  HPA +      AF ++      ++ S  + E QCLW+D           R+TC K+F++++EIV HLT++HVGGPE   H C+W  C+R+ +PFKAKYKLVNH+RVHTGEKPF CP   CGK+FARSENLKIHKRTHTGEKPFKC+ EGCDRRFANSSDRKKH HVH +DKPY C+  GCDKSYTHPSSLRKHM++H      SP++ Y+
Sbjct:  153 GHPYNHHGNFPTAAVHHPVVHHPSHHAMSAMHPAGA-----GAFLRYMRHQPASSASSVKQEMQCLWIDPDQPGLVPPGGRKTCNKVFHSMHEIVTHLTVEHVGGPECTTHACFWVGCSRNGRPFKAKYKLVNHIRVHTGEKPFACPHPGCGKVFARSENLKIHKRTHTGEKPFKCEHEGCDRRFANSSDRKKHSHVHTSDKPYNCRINGCDKSYTHPSSLRKHMKVHGNVDEKSPSHGYD 388          
BLAST of Zinc finger protein zic vs. Ensembl Fly
Match: lmd (gene:FBgn0039039 transcript:FBtr0084364)

HSP 1 Score: 166.392 bits (420), Expect = 6.651e-43
Identity = 74/147 (50.34%), Postives = 100/147 (68.03%), Query Frame = 1
Query:  805 CGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHNI 1245
            C + F      V H+   HV   +  D +C+W +C R +KPF A+YKL+ H+RVH+GEKP +CPF  C K F+R ENLKIH+R+HTGE+P+ C ++GC + F+NSSDR KH   H + KPY C+  GC K YT PSSLRKH++ H +
Sbjct:  442 CDEEFPHQQAFVEHIEKCHVDVRKGEDFSCFWLDCPRRYKPFNARYKLLIHMRVHSGEKPNKCPFPGCNKAFSRLENLKIHQRSHTGERPYGCQYKGCLKAFSNSSDRAKHQRTHYDTKPYACQLPGCTKRYTDPSSLRKHVKNHAL 588          
BLAST of Zinc finger protein zic vs. Ensembl Fly
Match: ci (gene:FBgn0004859 transcript:FBtr0306168)

HSP 1 Score: 166.777 bits (421), Expect = 8.412e-43
Identity = 80/165 (48.48%), Postives = 105/165 (63.64%), Query Frame = 1
Query:  742 GFRTEFQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMH-VHMNDKPYFCKQEGCDKSYTHPSSLRKHMR 1233
            G   E  C W         R+C   F T +E+V H+  DH+   ++    C W++CTR  KPFKA+Y LV H+R HTGEKP +C F  C K ++R ENLK H R+HTGEKP+ C++ GC + F+N+SDR KH +  H N+KPY CK  GC K YT PSSLRKH++
Sbjct:  328 GDFIETNCHW---------RSCRIEFITQDELVKHINNDHIQTNKKA-FVCRWEDCTRGEKPFKAQYMLVVHMRRHTGEKPHKCTFEGCFKAYSRLENLKTHLRSHTGEKPYTCEYPGCSKAFSNASDRAKHQNRTHSNEKPYICKAPGCTKRYTDPSSLRKHVK 482          
BLAST of Zinc finger protein zic vs. Ensembl Fly
Match: ci (gene:FBgn0004859 transcript:FBtr0089178)

HSP 1 Score: 166.392 bits (420), Expect = 9.822e-43
Identity = 80/165 (48.48%), Postives = 105/165 (63.64%), Query Frame = 1
Query:  742 GFRTEFQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMH-VHMNDKPYFCKQEGCDKSYTHPSSLRKHMR 1233
            G   E  C W         R+C   F T +E+V H+  DH+   ++    C W++CTR  KPFKA+Y LV H+R HTGEKP +C F  C K ++R ENLK H R+HTGEKP+ C++ GC + F+N+SDR KH +  H N+KPY CK  GC K YT PSSLRKH++
Sbjct:  446 GDFIETNCHW---------RSCRIEFITQDELVKHINNDHIQTNKKA-FVCRWEDCTRGEKPFKAQYMLVVHMRRHTGEKPHKCTFEGCFKAYSRLENLKTHLRSHTGEKPYTCEYPGCSKAFSNASDRAKHQNRTHSNEKPYICKAPGCTKRYTDPSSLRKHVK 600          
BLAST of Zinc finger protein zic vs. Ensembl Fly
Match: sug (gene:FBgn0033782 transcript:FBtr0331985)

HSP 1 Score: 151.369 bits (381), Expect = 1.428e-40
Identity = 74/165 (44.85%), Postives = 101/165 (61.21%), Query Frame = 1
Query:  742 GFRTEFQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDH-VGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMR 1233
            G  ++F C W D         C ++F T++ +  H+T  H +       + C W+ C R  + F A+YK++ H R HT EKP +C    C K F+R+ENLKIH R+H+GEKP+KC FEGC + ++NSSDR KH   H  +KPY CK  GC K YT PSSLRKH++
Sbjct:   61 GTASDFVCNWTD---------CDRVFDTLDALAQHVTQRHAIASLTDGLYYCRWRGCQRSERGFNARYKMLVHTRTHTKEKPHRCHL--CEKSFSRAENLKIHIRSHSGEKPYKCSFEGCQKAYSNSSDRFKHTRTHSMEKPYMCKVAGCQKRYTDPSSLRKHVK 214          
BLAST of Zinc finger protein zic vs. Ensembl Zebrafish
Match: zic4 (zic family member 4 [Source:ZFIN;Acc:ZDB-GENE-040622-4])

HSP 1 Score: 268.47 bits (685), Expect = 2.903e-82
Identity = 125/222 (56.31%), Postives = 160/222 (72.07%), Query Frame = 1
Query:  703 AAFYQFFHRNAVSGFRTEFQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHNISPNNDYNMDANSYETDFNQQLNSCPKMPK-PNQNQLKEPIS 1365
             AF+++  +      + E  C WL+      ++ C K + T++E+V H+T++HVGGPEQ +H C+W+ C R+ KPFKAKYKLVNH+RVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+F+GCDRRFANSSDRKKH HVH +DKPY CK  GCDKSYTHPSSLRKHM++H  SP       ++ YE+     ++    + + P  + L EP+S
Sbjct:  234 GAFFRYMRQP----IKQELICKWLEPE-HSAKKLCSKTYSTMHELVTHVTVEHVGGPEQANHICFWEECPREGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFDGCDRRFANSSDRKKHSHVHTSDKPYNCKVRGCDKSYTHPSSLRKHMKVHCKSPP-----PSSGYESSTPSLVSPSSDLGREPAPSALSEPLS 445          
BLAST of Zinc finger protein zic vs. Ensembl Zebrafish
Match: zic1 (zic family member 1 (odd-paired homolog, Drosophila) [Source:ZFIN;Acc:ZDB-GENE-000208-4])

HSP 1 Score: 266.929 bits (681), Expect = 3.174e-82
Identity = 120/193 (62.18%), Postives = 151/193 (78.24%), Query Frame = 1
Query:  664 APTHPAMSSYSHQAAFYQFFHRNAVSGFRTEFQCLWLD-KHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIH 1239
             P +  M+++    AF+++  +      + E  C W++ + +   +++C K F T++E+V HLT++HVGGPEQ +H C+W+ C R+ KPFKAKYKLVNH+RVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+FEGCDRRFANSSDRKKHMHVH +DKPY CK   CDKSYTHPSSLRKHM++H
Sbjct:  193 GPMNMNMAAHHGAGAFFRYMRQP----IKQELICKWIEPEQLTNPKKSCNKTFSTMHELVTHLTVEHVGGPEQSNHICFWEECGREGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFEGCDRRFANSSDRKKHMHVHTSDKPYLCKM--CDKSYTHPSSLRKHMKVH 379          
BLAST of Zinc finger protein zic vs. Ensembl Zebrafish
Match: zic5 (zic family member 5 (odd-paired homolog, Drosophila) [Source:ZFIN;Acc:ZDB-GENE-040622-1])

HSP 1 Score: 268.085 bits (684), Expect = 4.139e-82
Identity = 119/191 (62.30%), Postives = 148/191 (77.49%), Query Frame = 1
Query:  679 AMSSYSHQAAFYQFFHRNAVSGFRTEFQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHNISP 1251
            A + +    AF ++  +      + E  C W+D+  +  ++ C K F T++E+VNH+T++HVGGPEQ  H C+W+ C R+ K FKAKYKL+NH+RVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+F+GCDR+FANSSDRKKH HVH +DKPYFCK  GCDKSYTHPSSLRKHM++H  SP
Sbjct:  227 ATAPHGATGAFLRYMRQP----IKQELICKWIDQE-QTAKKPCSKTFSTMHELVNHVTVEHVGGPEQSTHVCFWEECPREGKAFKAKYKLINHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFDGCDRKFANSSDRKKHSHVHTSDKPYFCKVRGCDKSYTHPSSLRKHMKVHCKSP 412          
BLAST of Zinc finger protein zic vs. Ensembl Zebrafish
Match: zic3 (zic family member 3 heterotaxy 1 (odd-paired homolog, Drosophila) [Source:ZFIN;Acc:ZDB-GENE-030708-2])

HSP 1 Score: 266.159 bits (679), Expect = 6.940e-82
Identity = 119/197 (60.41%), Postives = 151/197 (76.65%), Query Frame = 1
Query:  703 AAFYQFFHRNAVSGFRTEFQCLWLDK-HMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHNISPNNDYNMDANSYET 1290
             AF+++  +      + E  C W+D+  M   ++TC + F T++E+V H++++HVGGPEQ +H CYW++C R+ K FKAKYKLVNH+RVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+F+GCDRRFANSSDRKKHMHVH +DKPY CK   CDKSYTHPSSLRKHM++H    +      ++ YE+
Sbjct:  217 GAFFRYMRQP----IKQELSCKWIDENQMNRPKKTCDRTFSTMHEMVTHVSMEHVGGPEQSNHVCYWEDCPREGKSFKAKYKLVNHIRVHTGEKPFPCPFPGCGKIFARSENLKIHKRTHTGEKPFKCEFDGCDRRFANSSDRKKHMHVHTSDKPYICKV--CDKSYTHPSSLRKHMKVHESQGSESSPAASSGYES 407          
BLAST of Zinc finger protein zic vs. Ensembl Zebrafish
Match: zic4 (zic family member 4 [Source:ZFIN;Acc:ZDB-GENE-040622-4])

HSP 1 Score: 268.47 bits (685), Expect = 6.947e-82
Identity = 125/222 (56.31%), Postives = 160/222 (72.07%), Query Frame = 1
Query:  703 AAFYQFFHRNAVSGFRTEFQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHNISPNNDYNMDANSYETDFNQQLNSCPKMPK-PNQNQLKEPIS 1365
             AF+++  +      + E  C WL+      ++ C K + T++E+V H+T++HVGGPEQ +H C+W+ C R+ KPFKAKYKLVNH+RVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+F+GCDRRFANSSDRKKH HVH +DKPY CK  GCDKSYTHPSSLRKHM++H  SP       ++ YE+     ++    + + P  + L EP+S
Sbjct:  270 GAFFRYMRQP----IKQELICKWLEPE-HSAKKLCSKTYSTMHELVTHVTVEHVGGPEQANHICFWEECPREGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFDGCDRRFANSSDRKKHSHVHTSDKPYNCKVRGCDKSYTHPSSLRKHMKVHCKSPP-----PSSGYESSTPSLVSPSSDLGREPAPSALSEPLS 481          
BLAST of Zinc finger protein zic vs. Ensembl Xenopus
Match: bcam (basal cell adhesion molecule (Lutheran blood group) [Source:Xenbase;Acc:XB-GENE-921467])

HSP 1 Score: 272.322 bits (695), Expect = 2.945e-83
Identity = 118/169 (69.82%), Postives = 142/169 (84.02%), Query Frame = 1
Query:  745 FRTEFQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHNISP 1251
             + E  C W+D+  +  ++ C K F T++E+VNH+T++HVGGPEQ  H C+W+ C+R+ KPFKAKYKLVNH+RVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+F+GCDR+FANSSDRKKH HVH +DKPY+CK  GCDKSYTHPSSLRKHM+IH  SP
Sbjct:  268 IKQELICKWIDQD-QSSKKPCSKTFSTMHELVNHVTVEHVGGPEQSTHVCFWEECSREGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFDGCDRKFANSSDRKKHSHVHTSDKPYYCKVRGCDKSYTHPSSLRKHMKIHCKSP 435          
BLAST of Zinc finger protein zic vs. Ensembl Xenopus
Match: zic2 (Zic family member 2 [Source:NCBI gene;Acc:549779])

HSP 1 Score: 270.781 bits (691), Expect = 8.042e-83
Identity = 128/233 (54.94%), Postives = 163/233 (69.96%), Query Frame = 1
Query:  586 SQNHHQSMPCNPGTTLEPQILHSQTVAPTHPAMSSYSHQAAFYQFFHRNAVSGFRTEFQCLWLD-KHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHNISPNNDYNMDANS 1281
            +Q H+Q  P N G  +     H     P            AF+++  +  +   + E  C W+D + +   +++C K F T++E+V H++++HVGGPEQ +H C+W+ C+R+ KPFKAKYKLVNH+RVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPF+C+FEGCDRRFANSSDRKKHMHVH +DKPY CK   CDKSYTHPSSLRKHM++H  SP    +  A S
Sbjct:  232 AQLHNQYAPMNMGMNMAAHHHHHHHHHP-----------GAFFRYMRQQCI---KQELICKWIDPEQLSNPKKSCNKTFSTMHELVTHVSVEHVGGPEQSNHICFWEECSREGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFQCEFEGCDRRFANSSDRKKHMHVHTSDKPYLCKM--CDKSYTHPSSLRKHMKVHESSPQGSESSPAAS 448          
BLAST of Zinc finger protein zic vs. Ensembl Xenopus
Match: cnot10 (CCR4-NOT transcription complex subunit 10 [Source:Xenbase;Acc:XB-GENE-5755016])

HSP 1 Score: 266.929 bits (681), Expect = 3.646e-82
Identity = 119/193 (61.66%), Postives = 151/193 (78.24%), Query Frame = 1
Query:  664 APTHPAMSSYSHQAAFYQFFHRNAVSGFRTEFQCLWLD-KHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIH 1239
             P +  M+++    AF+++  +      + E  C W++ + +   +++C K F T++E+V H+T++HVGGPEQ +H C+W+ C R+ KPFKAKYKLVNH+RVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+FEGCDRRFANSSDRKKHMHVH +DKPY CK   CDKSYTHPSSLRKHM++H
Sbjct:  194 GPMNMNMAAHHGAGAFFRYMRQP----IKQELICKWIEPEQLANPKKSCNKTFSTMHELVTHVTVEHVGGPEQSNHICFWEECAREGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFEGCDRRFANSSDRKKHMHVHTSDKPYLCKM--CDKSYTHPSSLRKHMKVH 380          
BLAST of Zinc finger protein zic vs. Ensembl Xenopus
Match: nt5dc3 (5'-nucleotidase domain containing 3 [Source:Xenbase;Acc:XB-GENE-940463])

HSP 1 Score: 267.7 bits (683), Expect = 8.394e-82
Identity = 121/183 (66.12%), Postives = 147/183 (80.33%), Query Frame = 1
Query:  703 AAFYQFFHRNAVSGFRTEFQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHNISP 1251
             AF+++  R A+   + E  C W+++     ++ C K F T++E+V H+T++HVGGPEQ +H C+W+ C R+ KPFKAKYKLVNH+RVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+FEGCDRRFANSSDRKKH HVH +DKPY CK  GCDKSYTHPSSLRKHM++H  SP
Sbjct:  237 GAFFRYM-RQAI---KQELICKWIEEE-HHPKKLCSKTFSTMHELVTHVTVEHVGGPEQSNHICFWEECPREGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFEGCDRRFANSSDRKKHSHVHTSDKPYNCKVRGCDKSYTHPSSLRKHMKVHCKSP 414          
BLAST of Zinc finger protein zic vs. Ensembl Xenopus
Match: nt5dc3 (5'-nucleotidase domain containing 3 [Source:Xenbase;Acc:XB-GENE-940463])

HSP 1 Score: 268.085 bits (684), Expect = 1.791e-81
Identity = 121/183 (66.12%), Postives = 147/183 (80.33%), Query Frame = 1
Query:  703 AAFYQFFHRNAVSGFRTEFQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHNISP 1251
             AF+++  R A+   + E  C W+++     ++ C K F T++E+V H+T++HVGGPEQ +H C+W+ C R+ KPFKAKYKLVNH+RVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+FEGCDRRFANSSDRKKH HVH +DKPY CK  GCDKSYTHPSSLRKHM++H  SP
Sbjct:  274 GAFFRYM-RQAI---KQELICKWIEEE-HHPKKLCSKTFSTMHELVTHVTVEHVGGPEQSNHICFWEECPREGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFEGCDRRFANSSDRKKHSHVHTSDKPYNCKVRGCDKSYTHPSSLRKHMKVHCKSP 451          
BLAST of Zinc finger protein zic vs. Ensembl Mouse
Match: Zic4 (zinc finger protein of the cerebellum 4 [Source:MGI Symbol;Acc:MGI:107201])

HSP 1 Score: 266.544 bits (680), Expect = 1.753e-83
Identity = 119/191 (62.30%), Postives = 142/191 (74.35%), Query Frame = 1
Query:  703 AAFYQFFHRNAVSGFRTEFQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHNISPNNDYNMDA 1275
             AF+++  +      + E  C WL        R C K F T++E+V H+T++HVGGPEQ +H C+W+ C R  KPFKAKYKLVNH+RVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPF+C+FEGC+RRFANSSDRKKH HVH +DKPY CK  GCDK YTHPSSLRKHM++H  SP      D+
Sbjct:  114 GAFFRYMRQP----IKQELICKWLGDDSPMSPRPCSKTFSTMHELVTHVTVEHVGGPEQANHICFWEECPRQGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFRCEFEGCERRFANSSDRKKHSHVHTSDKPYMCKVRGCDKCYTHPSSLRKHMKVHGRSPPPSSGYDS 300          
BLAST of Zinc finger protein zic vs. Ensembl Mouse
Match: Zic4 (zinc finger protein of the cerebellum 4 [Source:MGI Symbol;Acc:MGI:107201])

HSP 1 Score: 266.544 bits (680), Expect = 1.753e-83
Identity = 119/191 (62.30%), Postives = 142/191 (74.35%), Query Frame = 1
Query:  703 AAFYQFFHRNAVSGFRTEFQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHNISPNNDYNMDA 1275
             AF+++  +      + E  C WL        R C K F T++E+V H+T++HVGGPEQ +H C+W+ C R  KPFKAKYKLVNH+RVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPF+C+FEGC+RRFANSSDRKKH HVH +DKPY CK  GCDK YTHPSSLRKHM++H  SP      D+
Sbjct:  114 GAFFRYMRQP----IKQELICKWLGDDSPMSPRPCSKTFSTMHELVTHVTVEHVGGPEQANHICFWEECPRQGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFRCEFEGCERRFANSSDRKKHSHVHTSDKPYMCKVRGCDKCYTHPSSLRKHMKVHGRSPPPSSGYDS 300          
BLAST of Zinc finger protein zic vs. Ensembl Mouse
Match: Zic4 (zinc finger protein of the cerebellum 4 [Source:MGI Symbol;Acc:MGI:107201])

HSP 1 Score: 266.159 bits (679), Expect = 2.697e-83
Identity = 119/191 (62.30%), Postives = 142/191 (74.35%), Query Frame = 1
Query:  703 AAFYQFFHRNAVSGFRTEFQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHNISPNNDYNMDA 1275
             AF+++  +      + E  C WL        R C K F T++E+V H+T++HVGGPEQ +H C+W+ C R  KPFKAKYKLVNH+RVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPF+C+FEGC+RRFANSSDRKKH HVH +DKPY CK  GCDK YTHPSSLRKHM++H  SP      D+
Sbjct:  121 GAFFRYMRQP----IKQELICKWLGDDSPMSPRPCSKTFSTMHELVTHVTVEHVGGPEQANHICFWEECPRQGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFRCEFEGCERRFANSSDRKKHSHVHTSDKPYMCKVRGCDKCYTHPSSLRKHMKVHGRSPPPSSGYDS 307          
BLAST of Zinc finger protein zic vs. Ensembl Mouse
Match: Zic3 (zinc finger protein of the cerebellum 3 [Source:MGI Symbol;Acc:MGI:106676])

HSP 1 Score: 261.536 bits (667), Expect = 9.736e-83
Identity = 118/197 (59.90%), Postives = 151/197 (76.65%), Query Frame = 1
Query:  703 AAFYQFFHRNAVSGFRTEFQCLWLDK-HMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHNISPNNDYNMDANSYET 1290
             AF+++  +      + E  C W+++  +   +++C + F T++E+V H+T++HVGGPEQ +H CYW+ C R+ K FKAKYKLVNH+RVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+FEGCDRRFANSSDRKKHMHVH +DKPY CK   CDKSYTHPSSLRKHM++H    ++     ++ YE+
Sbjct:   16 GAFFRYMRQP----IKQELSCKWIEEAQLSRPKKSCDRTFSTMHELVTHVTMEHVGGPEQNNHVCYWEECPREGKSFKAKYKLVNHIRVHTGEKPFPCPFPGCGKIFARSENLKIHKRTHTGEKPFKCEFEGCDRRFANSSDRKKHMHVHTSDKPYICKV--CDKSYTHPSSLRKHMKVHESQGSDSSPAASSGYES 206          
BLAST of Zinc finger protein zic vs. Ensembl Mouse
Match: Zic2 (zinc finger protein of the cerebellum 2 [Source:MGI Symbol;Acc:MGI:106679])

HSP 1 Score: 268.855 bits (686), Expect = 5.217e-82
Identity = 125/215 (58.14%), Postives = 159/215 (73.95%), Query Frame = 1
Query:  709 FYQFFHRNAVSGFRTEFQCLWLD-KHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHNISPNNDYNMDANS--YETDFNQQLNSCPKMPKPNQN 1344
            F+++  +  +   + E  C W+D + +   +++C K F T++E+V H++++HVGGPEQ +H C+W+ C R+ KPFKAKYKLVNH+RVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPF+C+FEGCDRRFANSSDRKKHMHVH +DKPY CK   CDKSYTHPSSLRKHM++H  SP    +  A S  YE+     L S    P+ + N
Sbjct:  242 FFRYMRQQCI---KQELICKWIDPEQLSNPKKSCNKTFSTMHELVTHVSVEHVGGPEQSNHVCFWEECPREGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFQCEFEGCDRRFANSSDRKKHMHVHTSDKPYLCKM--CDKSYTHPSSLRKHMKVHESSPQGSESSPAASSGYESSTPPGLVSPSAEPQSSSN 451          
BLAST of Zinc finger protein zic vs. UniProt/SwissProt
Match: sp|Q61467|ZIC4_MOUSE (Zinc finger protein ZIC 4 OS=Mus musculus OX=10090 GN=Zic4 PE=1 SV=2)

HSP 1 Score: 266.159 bits (679), Expect = 1.886e-82
Identity = 119/191 (62.30%), Postives = 142/191 (74.35%), Query Frame = 1
Query:  703 AAFYQFFHRNAVSGFRTEFQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHNISPNNDYNMDA 1275
             AF+++  +      + E  C WL        R C K F T++E+V H+T++HVGGPEQ +H C+W+ C R  KPFKAKYKLVNH+RVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPF+C+FEGC+RRFANSSDRKKH HVH +DKPY CK  GCDK YTHPSSLRKHM++H  SP      D+
Sbjct:  121 GAFFRYMRQP----IKQELICKWLGDDSPMSPRPCSKTFSTMHELVTHVTVEHVGGPEQANHICFWEECPRQGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFRCEFEGCERRFANSSDRKKHSHVHTSDKPYMCKVRGCDKCYTHPSSLRKHMKVHGRSPPPSSGYDS 307          
BLAST of Zinc finger protein zic vs. UniProt/SwissProt
Match: sp|Q9YIB7|ZIC2B_XENLA (Zinc finger protein ZIC 2-B OS=Xenopus laevis OX=8355 GN=zic2-b PE=2 SV=1)

HSP 1 Score: 271.166 bits (692), Expect = 2.789e-82
Identity = 120/194 (61.86%), Postives = 151/194 (77.84%), Query Frame = 1
Query:  703 AAFYQFFHRNAVSGFRTEFQCLWLD-KHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHNISPNNDYNMDANS 1281
             AF+++  +  +   + E  C W+D + +   +++C K F T++E+V H++++HVGGPEQ +H C+W+ C R+ KPFKAKYKLVNH+RVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPF+C+FEGCDRRFANSSDRKKHMHVH +DKPY CK   CDKSYTHPSSLRKHM++H  SP    +  A S
Sbjct:  258 GAFFRYMRQQCI---KQELICKWIDPEQLNNPKKSCNKTFSTMHELVTHMSVEHVGGPEQSNHICFWEECAREGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFQCEFEGCDRRFANSSDRKKHMHVHTSDKPYLCKM--CDKSYTHPSSLRKHMKVHESSPQGSESSPAAS 446          
BLAST of Zinc finger protein zic vs. UniProt/SwissProt
Match: sp|O95409|ZIC2_HUMAN (Zinc finger protein ZIC 2 OS=Homo sapiens OX=9606 GN=ZIC2 PE=1 SV=2)

HSP 1 Score: 271.166 bits (692), Expect = 5.927e-82
Identity = 126/217 (58.06%), Postives = 160/217 (73.73%), Query Frame = 1
Query:  703 AAFYQFFHRNAVSGFRTEFQCLWLD-KHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHNISPNNDYNMDANS--YETDFNQQLNSCPKMPKPNQN 1344
             AF+++  +  +   + E  C W+D + +   +++C K F T++E+V H++++HVGGPEQ +H C+W+ C R+ KPFKAKYKLVNH+RVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPF+C+FEGCDRRFANSSDRKKHMHVH +DKPY CK   CDKSYTHPSSLRKHM++H  SP    +  A S  YE+     L S    P+ + N
Sbjct:  241 GAFFRYMRQQCI---KQELICKWIDPEQLSNPKKSCNKTFSTMHELVTHVSVEHVGGPEQSNHVCFWEECPREGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFQCEFEGCDRRFANSSDRKKHMHVHTSDKPYLCKM--CDKSYTHPSSLRKHMKVHESSPQGSESSPAASSGYESSTPPGLVSPSAEPQSSSN 452          
BLAST of Zinc finger protein zic vs. UniProt/SwissProt
Match: sp|Q9IB89|ZIC5_XENLA (Zinc finger protein ZIC 5 OS=Xenopus laevis OX=8355 GN=zic5 PE=2 SV=1)

HSP 1 Score: 270.011 bits (689), Expect = 1.069e-81
Identity = 117/169 (69.23%), Postives = 141/169 (83.43%), Query Frame = 1
Query:  745 FRTEFQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHNISP 1251
             + E  C W+D+  +  ++ C K F T++E+VNH+ ++HVGGPEQ +H C+W+ C R+ KPFKAKYKLVNH+RVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+F+GCDR+FANSSDRKKH HVH +DKPY+CK  GCDKSYTHPSSLRKHM+IH  SP
Sbjct:  263 IKQELICKWIDQD-QSSKKPCSKTFSTMHELVNHVAVEHVGGPEQSNHICFWEECAREGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFDGCDRKFANSSDRKKHSHVHTSDKPYYCKVRGCDKSYTHPSSLRKHMKIHCKSP 430          
BLAST of Zinc finger protein zic vs. UniProt/SwissProt
Match: sp|O60481|ZIC3_HUMAN (Zinc finger protein ZIC 3 OS=Homo sapiens OX=9606 GN=ZIC3 PE=1 SV=1)

HSP 1 Score: 268.085 bits (684), Expect = 1.820e-81
Identity = 119/197 (60.41%), Postives = 151/197 (76.65%), Query Frame = 1
Query:  703 AAFYQFFHRNAVSGFRTEFQCLWLDK-HMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHNISPNNDYNMDANSYET 1290
             AF+++  +      + E  C W+D+  +   +++C + F T++E+V H+T++HVGGPEQ +H CYW+ C R+ K FKAKYKLVNH+RVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+FEGCDRRFANSSDRKKHMHVH +DKPY CK   CDKSYTHPSSLRKHM++H    ++     ++ YE+
Sbjct:  237 GAFFRYMRQP----IKQELSCKWIDEAQLSRPKKSCDRTFSTMHELVTHVTMEHVGGPEQNNHVCYWEECPREGKSFKAKYKLVNHIRVHTGEKPFPCPFPGCGKIFARSENLKIHKRTHTGEKPFKCEFEGCDRRFANSSDRKKHMHVHTSDKPYICKV--CDKSYTHPSSLRKHMKVHESQGSDSSPAASSGYES 427          
BLAST of Zinc finger protein zic vs. TrEMBL
Match: Q1JV16 (Zinc finger protein Dj-ZicB OS=Dugesia japonica OX=6161 GN=Dj-ZicB PE=2 SV=1)

HSP 1 Score: 855.899 bits (2210), Expect = 0.000e+0
Identity = 404/472 (85.59%), Postives = 435/472 (92.16%), Query Frame = 1
Query:  223 MVSYPSLLITDNLSKDIKFHQNIQVNNQLPLSMTTSETERFSSTNHNKNFCANDLLLKRYSYDPNYDLLASHPASVSDNYPPEFLASNSLSSFSVNALNSADILSQTSASDYQNYGMYGNHSQNHHQSMPCNPGTTLEPQILHSQTVAPTHPAMSSYSHQAAFYQFFHRNAVSGFRTEFQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHNISPNNDYNMDANSYETDFNQQLNSCPKMPKPNQNQLKEPISRFEHDHRSINQHEHSGSSNKLLNFFPFPHSSNFKQRPCHINPDQSSVWLPYPYFENPSGSRNPLWSKSYPSLFDITKPSFLASNPHSDSVT 1638
            MVSYPSLLITDNLSKDIKFHQ I +NN L LSM+TSETERF +TNHNKNFC NDLLLKRYSYDPNY+LL+SHPA+VSDNYPPEFL SNSLSSFSVNALNS +I+ QTS +DYQNYG+YGNHSQNH Q++ CN    LEP ILHSQT  P HP+MSSY+HQAAFYQFFHRNAV+GFR+EFQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHN+SPNN+YNMD NSY+ +FN  LN+C K PK NQN  K+P++ FE DHR++NQ EH+GSSNKLLNFFPFPH+ NFKQRPC+IN DQSSVWLPYPYFENP+ SRNPLWSK+YPSLFDITKPSFL SN HSDSVT
Sbjct:    1 MVSYPSLLITDNLSKDIKFHQEISINNHLSLSMSTSETERFPNTNHNKNFCTNDLLLKRYSYDPNYELLSSHPATVSDNYPPEFLTSNSLSSFSVNALNSGEIIPQTSVNDYQNYGVYGNHSQNH-QTLSCNASMALEPHILHSQTAMPPHPSMSSYTHQAAFYQFFHRNAVTGFRSEFQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHNLSPNNEYNMDVNSYDNEFNHHLNNCQKTPKSNQNNNKDPMTAFELDHRNLNQTEHAGSSNKLLNFFPFPHTPNFKQRPCNINTDQSSVWLPYPYFENPTASRNPLWSKTYPSLFDITKPSFLTSNQHSDSVT 471          
BLAST of Zinc finger protein zic vs. TrEMBL
Match: A0A159X5T5 (Zinc finger protein of the cerebellum 2 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=zic-2 PE=2 SV=1)

HSP 1 Score: 462.225 bits (1188), Expect = 3.578e-158
Identity = 216/217 (99.54%), Postives = 216/217 (99.54%), Query Frame = 1
Query:  571 MYGNHSQNHHQSMPCNPGTTLEPQILHSQTVAPTHPAMSSYSHQAAFYQFFHRNAVSGFRTEFQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLR 1221
            MYGNHSQNHHQSMPCNPGTTLEPQILHSQTVAPTHPAMSSYSHQAAFYQFFHRNAVSGFRTEFQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSEN KIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLR
Sbjct:    1 MYGNHSQNHHQSMPCNPGTTLEPQILHSQTVAPTHPAMSSYSHQAAFYQFFHRNAVSGFRTEFQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENPKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLR 217          
BLAST of Zinc finger protein zic vs. TrEMBL
Match: X5CWX3 (Zinc finger protein A OS=Schmidtea mediterranea OX=79327 GN=ZicA PE=2 SV=1)

HSP 1 Score: 313.538 bits (802), Expect = 5.318e-96
Identity = 143/196 (72.96%), Postives = 162/196 (82.65%), Query Frame = 1
Query:  670 THPAMSSYSHQAAFYQFFHRNAVSGFRT--EFQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHNISP 1251
            T P +S+Y  QAA Y+ F  N         E +CLW+D + +E  + C KL+ +I +IV HLT+DHVGGPEQLDHTCYWK+C RD K FKAKYKLVNH+RVHTGEKPFQCPF +CGKLFARSENLKIHKRTHTGE PFKCDFEGCDRRFANSSDRKKHMHVH NDKPYFCK +GC+KSYTHPSSLRKHMR+HN+SP
Sbjct:  134 TFPGLSNYGRQAALYRCFKNNLNEPMHINKELRCLWIDPNQREGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEXPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSP 329          
BLAST of Zinc finger protein zic vs. TrEMBL
Match: Q1JV17 (Zinc finger protein Dj-ZicA OS=Dugesia japonica OX=6161 GN=Dj-ZicA PE=2 SV=1)

HSP 1 Score: 313.153 bits (801), Expect = 7.831e-96
Identity = 150/240 (62.50%), Postives = 175/240 (72.92%), Query Frame = 1
Query:  631 LEPQILHSQTVAPTHPAMSSYSHQAAFYQFFHRNAVSGFRT--EFQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHNISPNNDYNMDANSYETDFNQQLNSCPKMPKPNQN 1344
            + P   H      T   +SSY  QAA Y+ F  N         E +CLW+D + ++  + C KL+ +I +IV HLT+DHVGGPEQLDHTCYWK+C RD K FKAKYKLVNH+RVHTGEKPFQCPF +CGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVH NDKPY+CK +GC+KSYTHPSSLRKHMR+HN+SP         S   D +  ++    +P  NQN
Sbjct:  121 MSPYNYHYTPFPSTFSGLSSYGRQAALYRCFRNNLNEPIHINKELRCLWIDPNQRDGSKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYYCKIKGCEKSYTHPSSLRKHMRVHNLSPGTISAAIVASKHPDSSTNISRDNSVPVINQN 360          
BLAST of Zinc finger protein zic vs. TrEMBL
Match: A0A2G8L3Q9 (Zinc finger protein Ap-Zic OS=Stichopus japonicus OX=307972 GN=BSL78_08245 PE=4 SV=1)

HSP 1 Score: 286.96 bits (733), Expect = 1.919e-88
Identity = 132/195 (67.69%), Postives = 154/195 (78.97%), Query Frame = 1
Query:  667 PTHPAMSSYSHQAAFYQFFHRNAVSGFRTEFQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHNISP 1251
            P HP  ++  H A    FF R      + E  CLW+++   E R+ C K F T++EIV H+T++HVGGPEQ +HTCYW+NC R+ KPFKAKYKLVNH+RVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+FEGCDRRFANSSDRKKH HVH +DKPY CK  GCDKSYTHPSSLRKHM++H+ SP
Sbjct:    4 PHHPTPAAAHHGAHHAAFF-RYMRQPIKQELTCLWIEQEQPEPRKPCNKTFTTMHEIVTHITVEHVGGPEQTNHTCYWQNCAREQKPFKAKYKLVNHVRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFEGCDRRFANSSDRKKHSHVHTSDKPYNCKIRGCDKSYTHPSSLRKHMKVHSKSP 197          
BLAST of Zinc finger protein zic vs. Ensembl Cavefish
Match: zic5 (zic family member 5 (odd-paired homolog, Drosophila) [Source:ZFIN;Acc:ZDB-GENE-040622-1])

HSP 1 Score: 267.314 bits (682), Expect = 3.935e-82
Identity = 118/191 (61.78%), Postives = 149/191 (78.01%), Query Frame = 1
Query:  679 AMSSYSHQAAFYQFFHRNAVSGFRTEFQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHNISP 1251
            A + +    AF ++  +      + E  C W+D+  +  ++ C K F T++E+VNH+T++HVGGPEQ +H C+W+ C R+ K FKAKYKL+NH+RVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+F+GCDR+FANSSDRKKH HVH +DKPY+CK  GCDKSYTHPSSLRKHM++H  SP
Sbjct:  195 ASAPHGATGAFLRYMRQP----IKQELICKWIDQE-QTAKKPCSKTFSTMHELVNHVTVEHVGGPEQSNHVCFWEECPREGKAFKAKYKLINHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFDGCDRKFANSSDRKKHSHVHTSDKPYYCKVRGCDKSYTHPSSLRKHMKVHCKSP 380          
BLAST of Zinc finger protein zic vs. Ensembl Cavefish
Match: zic4 (zinc finger protein ZIC 4 [Source:NCBI gene;Acc:103028672])

HSP 1 Score: 269.24 bits (687), Expect = 3.986e-82
Identity = 123/205 (60.00%), Postives = 152/205 (74.15%), Query Frame = 1
Query:  745 FRTEFQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHNISPNNDYNMDANSYETDFNQQLNSCPKMPKPNQNQLKEP 1359
             + E  C WL+      ++ C K + T++E+V H+T++HVGGPEQ +H C+W+ C R+ KPFKAKYKLVNH+RVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+F+GCDRRFANSSDRKKH HVH +DKPY CK  GCDKSYTHPSSLRKHM++H  SP       ++ YE+       S P +  P+ +  +EP
Sbjct:  290 IKQELICKWLEPE-HSAKKLCSKTYSTMHELVTHVTVEHVGGPEQANHVCFWQECPREGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFDGCDRRFANSSDRKKHSHVHTSDKPYNCKVRGCDKSYTHPSSLRKHMKVHCKSPP-----PSSGYES-------STPSLVSPSSDLGREP 481          
BLAST of Zinc finger protein zic vs. Ensembl Cavefish
Match: zic3 (Zic family member 3 [Source:NCBI gene;Acc:103039856])

HSP 1 Score: 266.159 bits (679), Expect = 8.002e-82
Identity = 118/197 (59.90%), Postives = 151/197 (76.65%), Query Frame = 1
Query:  703 AAFYQFFHRNAVSGFRTEFQCLWLDK-HMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHNISPNNDYNMDANSYET 1290
             AF+++  +      + E  C W+D+  +   ++TC + F T++E+V H++++HVGGPEQ +H CYW++C R+ K FKAKYKLVNH+RVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+F+GCDRRFANSSDRKKHMHVH +DKPY CK   CDKSYTHPSSLRKHM++H    +      ++ YE+
Sbjct:  225 GAFFRYMRQP----IKQELSCKWIDENQLNRPKKTCDRTFSTMHEMVTHVSMEHVGGPEQSNHICYWEDCPREGKSFKAKYKLVNHIRVHTGEKPFPCPFPGCGKIFARSENLKIHKRTHTGEKPFKCEFDGCDRRFANSSDRKKHMHVHTSDKPYICKV--CDKSYTHPSSLRKHMKVHESQGSESSPAASSGYES 415          
BLAST of Zinc finger protein zic vs. Ensembl Cavefish
Match: zic5 (zic family member 5 (odd-paired homolog, Drosophila) [Source:ZFIN;Acc:ZDB-GENE-040622-1])

HSP 1 Score: 266.929 bits (681), Expect = 1.285e-81
Identity = 118/191 (61.78%), Postives = 149/191 (78.01%), Query Frame = 1
Query:  679 AMSSYSHQAAFYQFFHRNAVSGFRTEFQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHNISP 1251
            A + +    AF ++  +      + E  C W+D+  +  ++ C K F T++E+VNH+T++HVGGPEQ +H C+W+ C R+ K FKAKYKL+NH+RVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+F+GCDR+FANSSDRKKH HVH +DKPY+CK  GCDKSYTHPSSLRKHM++H  SP
Sbjct:  237 ASAPHGATGAFLRYMRQP----IKQELICKWIDQE-QTAKKPCSKTFSTMHELVNHVTVEHVGGPEQSNHVCFWEECPREGKAFKAKYKLINHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFDGCDRKFANSSDRKKHSHVHTSDKPYYCKVRGCDKSYTHPSSLRKHMKVHCKSP 422          
BLAST of Zinc finger protein zic vs. Ensembl Cavefish
Match: zic1 (zic family member 1 (odd-paired homolog, Drosophila) [Source:ZFIN;Acc:ZDB-GENE-000208-4])

HSP 1 Score: 265.003 bits (676), Expect = 2.650e-81
Identity = 115/166 (69.28%), Postives = 140/166 (84.34%), Query Frame = 1
Query:  745 FRTEFQCLWLD-KHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIH 1239
             + E  C W++ + +   +++C K F T++E+V HLT++HVGGPEQ +H C+W+ C+R+ KPFKAKYKLVNH+RVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+F+GCDRRFANSSDRKKHMHVH +DKPY CK   CDKSYTHPSSLRKHM++H
Sbjct:  236 IKQELICKWVEPEQLSSPKKSCNKTFSTMHELVTHLTVEHVGGPEQSNHICFWEECSREGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFDGCDRRFANSSDRKKHMHVHTSDKPYLCKM--CDKSYTHPSSLRKHMKVH 399          
BLAST of Zinc finger protein zic vs. Ensembl Sea Lamprey
Match: glis2b (GLIS family zinc finger 2b [Source:ZFIN;Acc:ZDB-GENE-091204-120])

HSP 1 Score: 158.303 bits (399), Expect = 3.021e-45
Identity = 73/146 (50.00%), Postives = 98/146 (67.12%), Query Frame = 1
Query:  805 CGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHN 1242
            C ++F +  E+V H+   HV    ++ + C+W+ C R  + F A+YK++ H+R HT EKP QCP   C K F+R ENLKIH R+HTGEKP+ C ++GC +R++NSSDR KH   H  DKPY CK  GC K YT PSSLRKH++ H 
Sbjct:    3 CQQVFDSQQELVEHVHDAHVRADREVGYCCHWEGCARMGRGFNARYKMLIHVRTHTNEKPHQCPI--CNKSFSRLENLKIHGRSHTGEKPYACPYQGCSKRYSNSSDRFKHTRTHYVDKPYACKTPGCLKRYTDPSSLRKHVKAHG 146          
BLAST of Zinc finger protein zic vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008614.1 (pep scaffold:Pmarinus_7.0:GL479003:10005:19084:-1 gene:ENSPMAG00000007806.1 transcript:ENSPMAT00000008614.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 152.525 bits (384), Expect = 4.419e-44
Identity = 71/131 (54.20%), Postives = 95/131 (72.52%), Query Frame = 1
Query:  844 HLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHM-HVHMNDKPYFCKQEGCDKSYTHPSSLRKHMR 1233
            H+  +H+ G E+ +  C W++C+R+ KPFKA+Y LV H+R HTGEKP +C F  C K ++R ENLK H R+HTGEKP+ C+ EGC++ F+N+SDR KH    H N+KPY CK  GC K YT PSSLRKH++
Sbjct:    1 HINNEHIHG-ERKEFVCRWRDCSREKKPFKAQYMLVVHMRRHTGEKPHKCTFEGCAKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYVCKISGCTKRYTDPSSLRKHVK 130          
BLAST of Zinc finger protein zic vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003448.1 (pep scaffold:Pmarinus_7.0:GL477543:42863:56609:1 gene:ENSPMAG00000003158.1 transcript:ENSPMAT00000003448.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 116.316 bits (290), Expect = 1.237e-30
Identity = 61/145 (42.07%), Postives = 83/145 (57.24%), Query Frame = 1
Query:  805 CGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFA--NSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMR 1233
            C   F    ++  H+   HV      +  C W+ C R  +PF A+YKL+ H+RVH+GEKP +C  + C + F+ S+  K   R H   K  +C FEGC + F+  NSSDR KH   H + KPY C+  GC K YT PSSLRKH++
Sbjct:   13 CRAAFGRREQLCRHIEKSHVEPQRGEEFACQWEACGRRRRPFNARYKLLIHMRVHSGEKPNRC--MLCCETFSHSDTHKHSTRPHQDIKRLQCTFEGCPKAFSRLNSSDRAKHQRTHQDTKPYVCQVPGCSKRYTDPSSLRKHVK 155          
BLAST of Zinc finger protein zic vs. Ensembl Sea Lamprey
Match: znf143b (zinc finger protein 143b [Source:NCBI gene;Acc:393954])

HSP 1 Score: 120.168 bits (300), Expect = 9.425e-30
Identity = 59/146 (40.41%), Postives = 82/146 (56.16%), Query Frame = 1
Query:  805 CGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHN 1242
            CG+L+ T + +  H        P + +  C  K        F   Y L +HLR HTGEKP+ CP  +C K F  S +L+ H RTHTGEKPFKC FEGC R F  S+ RK H+  H  ++PY C + GC + ++  ++ + H+RIH 
Sbjct:  142 CGRLYTTAHHLKVHERAHTGDRPYRCNQPCCGK-------AFSTGYGLKSHLRTHTGEKPYLCPDETCRKGFKTSGDLQKHIRTHTGEKPFKCPFEGCGRSFTTSNIRKVHIRTHTGERPYLCPEPGCGRGFSSATNYKNHVRIHT 280          

HSP 2 Score: 119.783 bits (299), Expect = 1.443e-29
Identity = 64/148 (43.24%), Postives = 82/148 (55.41%), Query Frame = 1
Query:  805 CGKLFYTINEIVNHLTLDHVGGPEQL--DHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHN 1242
            CGK F T   + +HL   H G    L  D TC         K FK    L  H+R HTGEKPF+CPF  CG+ F  S   K+H RTHTGE+P+ C   GC R F+++++ K H+ +H  +KPY C   GC K +T  SSL KH  +H 
Sbjct:  172 CGKAFSTGYGLKSHLRT-HTGEKPYLCPDETCR--------KGFKTSGDLQKHIRTHTGEKPFKCPFEGCGRSFTTSNIRKVHIRTHTGERPYLCPEPGCGRGFSSATNYKNHVRIHTGEKPYVCTVPGCGKRFTEYSSLYKHQVVHT 310          

HSP 3 Score: 97.0561 bits (240), Expect = 6.778e-22
Identity = 56/144 (38.89%), Postives = 73/144 (50.69%), Query Frame = 1
Query:  802 TCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMR 1233
            TC K F T  ++  H+   H G   +    C ++ C R F     +     H+R HTGE+P+ CP   CG+ F+ + N K H R HTGEKP+ C   GC +RF   S   KH  VH   KPY C    C K+Y  PS+L  H R
Sbjct:  201 TCRKGFKTSGDLQKHIRT-HTG---EKPFKCPFEGCGRSFTTSNIRKV---HIRTHTGERPYLCPEPGCGRGFSSATNYKNHVRIHTGEKPYVCTVPGCGKRFTEYSSLYKHQVVHTPVKPYSCSN--CSKTYRQPSTLATHKR 335          

HSP 4 Score: 87.4261 bits (215), Expect = 9.730e-19
Identity = 34/91 (37.36%), Postives = 54/91 (59.34%), Query Frame = 1
Query:  970 TGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHN 1242
            +GEK F C +  CG+L+  + +LK+H+R HTG++P++C+   C + F+     K H+  H  +KPY C  E C K +     L+KH+R H 
Sbjct:  130 SGEKAFHCRYEGCGRLYTTAHHLKVHERAHTGDRPYRCNQPCCGKAFSTGYGLKSHLRTHTGEKPYLCPDETCRKGFKTSGDLQKHIRTHT 220          
BLAST of Zinc finger protein zic vs. Ensembl Sea Lamprey
Match: znf143b (zinc finger protein 143b [Source:NCBI gene;Acc:393954])

HSP 1 Score: 120.168 bits (300), Expect = 1.036e-29
Identity = 59/146 (40.41%), Postives = 82/146 (56.16%), Query Frame = 1
Query:  805 CGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHN 1242
            CG+L+ T + +  H        P + +  C  K        F   Y L +HLR HTGEKP+ CP  +C K F  S +L+ H RTHTGEKPFKC FEGC R F  S+ RK H+  H  ++PY C + GC + ++  ++ + H+RIH 
Sbjct:  111 CGRLYTTAHHLKVHERAHTGDRPYRCNQPCCGK-------AFSTGYGLKSHLRTHTGEKPYLCPDETCRKGFKTSGDLQKHIRTHTGEKPFKCPFEGCGRSFTTSNIRKVHIRTHTGERPYLCPEPGCGRGFSSATNYKNHVRIHT 249          

HSP 2 Score: 119.013 bits (297), Expect = 2.049e-29
Identity = 64/148 (43.24%), Postives = 82/148 (55.41%), Query Frame = 1
Query:  805 CGKLFYTINEIVNHLTLDHVGGPEQL--DHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHN 1242
            CGK F T   + +HL   H G    L  D TC         K FK    L  H+R HTGEKPF+CPF  CG+ F  S   K+H RTHTGE+P+ C   GC R F+++++ K H+ +H  +KPY C   GC K +T  SSL KH  +H 
Sbjct:  141 CGKAFSTGYGLKSHLRT-HTGEKPYLCPDETCR--------KGFKTSGDLQKHIRTHTGEKPFKCPFEGCGRSFTTSNIRKVHIRTHTGERPYLCPEPGCGRGFSSATNYKNHVRIHTGEKPYVCTVPGCGKRFTEYSSLYKHQVVHT 279          

HSP 3 Score: 98.5969 bits (244), Expect = 1.873e-22
Identity = 61/168 (36.31%), Postives = 80/168 (47.62%), Query Frame = 1
Query:  802 TCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHNISPNNDYNMDANSYETDFNQQ 1305
            TC K F T  ++  H+   H G   +    C ++ C R F     +     H+R HTGE+P+ CP   CG+ F+ + N K H R HTGEKP+ C   GC +RF   S   KH  VH   KPY C    C K+Y  PS+L  H R    S + D      S    + QQ
Sbjct:  170 TCRKGFKTSGDLQKHIRT-HTG---EKPFKCPFEGCGRSFTTSNIRKV---HIRTHTGERPYLCPEPGCGRGFSSATNYKNHVRIHTGEKPYVCTVPGCGKRFTEYSSLYKHQVVHTPVKPYSCSN--CSKTYRQPSTLATHKR----SAHGDMEATEESERARYEQQ 324          

HSP 4 Score: 87.0409 bits (214), Expect = 1.166e-18
Identity = 34/91 (37.36%), Postives = 54/91 (59.34%), Query Frame = 1
Query:  970 TGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHN 1242
            +GEK F C +  CG+L+  + +LK+H+R HTG++P++C+   C + F+     K H+  H  +KPY C  E C K +     L+KH+R H 
Sbjct:   99 SGEKAFHCRYEGCGRLYTTAHHLKVHERAHTGDRPYRCNQPCCGKAFSTGYGLKSHLRTHTGEKPYLCPDETCRKGFKTSGDLQKHIRTHT 189          

HSP 5 Score: 58.9214 bits (141), Expect = 1.672e-9
Identity = 28/79 (35.44%), Postives = 39/79 (49.37%), Query Frame = 1
Query: 1006 CGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHN 1242
            CG  F +S N        +GEK F C +EGC R +  +   K H   H  D+PY C Q  C K+++    L+ H+R H 
Sbjct:   81 CGHHFCQSMNRASSSGQPSGEKAFHCRYEGCGRLYTTAHHLKVHERAHTGDRPYRCNQPCCGKAFSTGYGLKSHLRTHT 159          
BLAST of Zinc finger protein zic vs. Ensembl Yeast
Match: ZAP1 (Zinc-regulated transcription factor; binds to zinc-responsive promoters to induce transcription of certain genes in presence of zinc, represses other genes in low zinc; regulates its own transcription; contains seven zinc-finger domains [Source:SGD;Acc:S000003592])

HSP 1 Score: 96.2857 bits (238), Expect = 4.314e-21
Identity = 54/145 (37.24%), Postives = 82/145 (56.55%), Query Frame = 1
Query:  805 CGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIH 1239
            C K F +  E+ +HL   H+   +  ++ C W +C R    F  + KL+ HL+VH+  KP++C   +C + F+  E L  H RTH+GEKP+KC    C+++FA SS  K H+  H  +KP  CK   C K +   S+L KH++ H
Sbjct:  712 CNKSFSSAQELNDHLEAVHLTRGKS-EYQCLWHDCHR---TFPQRQKLIRHLKVHSKYKPYKCK--TCKRCFSSEETLVQHTRTHSGEKPYKCHI--CNKKFAISSSLKIHIRTHTGEKPLQCKI--CGKRFNESSNLSKHIKTH 846          

HSP 2 Score: 85.8853 bits (211), Expect = 6.409e-18
Identity = 57/151 (37.75%), Postives = 77/151 (50.99%), Query Frame = 1
Query:  748 RTEFQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSY 1200
            ++E+QCLW D         C + F    +++ HL +     P +       K C R    F ++  LV H R H+GEKP++C    C K FA S +LKIH RTHTGEKP +C    C +RF  SS+  KH+  H   K Y C    C KS+
Sbjct:  735 KSEYQCLWHD---------CHRTFPQRQKLIRHLKVHSKYKPYKC------KTCKR---CFSSEETLVQHTRTHSGEKPYKCHI--CNKKFAISSSLKIHIRTHTGEKPLQCKI--CGKRFNESSNLSKHIKTHQ--KKYKCSD--CSKSF 859          

HSP 3 Score: 64.3142 bits (155), Expect = 3.358e-11
Identity = 36/126 (28.57%), Postives = 61/126 (48.41%), Query Frame = 1
Query:  862 VGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIH 1239
            +  PEQ+   C W  C + F   +     +  + +  G+  +QC +  C + F + + L  H + H+  KP+KC  + C R F++     +H   H  +KPY C    C+K +   SSL+ H+R H
Sbjct:  699 IKQPEQV--ICQWDGCNKSFSSAQELNDHLEAVHLTRGKSEYQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKC--KTCKRCFSSEETLVQHTRTHSGEKPYKC--HICNKKFAISSSLKIHIRTH 818          
BLAST of Zinc finger protein zic vs. Ensembl Yeast
Match: AZF1 (Zinc-finger transcription factor; involved in diauxic shift; in the presence of glucose, activates transcription of genes involved in growth and carbon metabolism; in nonfermentable carbon sources, activates transcription of genes involved in maintenance of cell wall integrity; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000005639])

HSP 1 Score: 89.7373 bits (221), Expect = 5.227e-19
Identity = 42/105 (40.00%), Postives = 60/105 (57.14%), Query Frame = 1
Query:  928 FKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHM-RIH 1239
            F     L  H+R H G KPF C +  CGK F +  NL+ H+R HTGEKP+ CD   CD++F+   +   H+  H   KP+ CK E C+K++T   +++ H  R H
Sbjct:  602 FSQATHLEVHVRSHIGYKPFVCDY--CGKRFTQGGNLRTHERLHTGEKPYSCDI--CDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQNRFH 702          
BLAST of Zinc finger protein zic vs. Ensembl Yeast
Match: CRZ1 (Transcription factor, activates transcription of stress response genes; nuclear localization is positively regulated by calcineurin-mediated dephosphorylation; rapidly localizes to the nucleus under blue light stress; can be activated in stochastic pulses of nuclear localization in response to calcium [Source:SGD;Acc:S000004972])

HSP 1 Score: 65.0846 bits (157), Expect = 1.953e-11
Identity = 35/90 (38.89%), Postives = 44/90 (48.89%), Query Frame = 1
Query:  985 FQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQE-------GCDKSYTHPSSLRKHMR 1233
            F C    CGK F R  NLK H RTHT E+PF C    C + FA   DRK+H  +H   K Y C  +       GC K +    +L +H +
Sbjct:  569 FACDV--CGKKFTRPYNLKSHLRTHTNERPFICSI--CGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHFK 654          

HSP 2 Score: 60.077 bits (144), Expect = 7.441e-10
Identity = 32/79 (40.51%), Postives = 42/79 (53.16%), Query Frame = 1
Query:  922 KPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFE-------GCDRRFANSSDRKKH 1137
            K F   Y L +HLR HT E+PF C    CGK FAR  + K H+  HTG+K + C  +       GC ++FA S    +H
Sbjct:  576 KKFTRPYNLKSHLRTHTNERPFICSI--CGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRH 652          
BLAST of Zinc finger protein zic vs. Ensembl Yeast
Match: MIG2 (Zinc finger transcriptional repressor; cooperates with Mig1p in glucose-induced gene repression; under low glucose conditions relocalizes to mitochondrion, where it interacts with Ups1p, antagonizes mitochondrial fission factor Dnm1p, indicative of a role in mitochondrial fusion or regulating morphology; regulates filamentous growth in response to glucose depletion; activated in stochastic pulses of nuclear localization in response to low glucose [Source:SGD;Acc:S000003177])

HSP 1 Score: 58.9214 bits (141), Expect = 9.101e-10
Identity = 33/76 (43.42%), Postives = 41/76 (53.95%), Query Frame = 1
Query:  907 CTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKK 1134
            C R F   + K +   HLR HTGEKP  C F  CGK F+RS+ LK H RTHTG+           RR   +S +K+
Sbjct:   22 CHRGFHRLEHKKR---HLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRTHTGQ---------SQRRLKKASVQKQ 85          

HSP 2 Score: 58.151 bits (139), Expect = 1.765e-9
Identity = 29/72 (40.28%), Postives = 39/72 (54.17%), Query Frame = 1
Query:  979 KPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDK 1194
            +PF+C   +C + F R E+ K H RTHTGEKP  C F GC + F+ S + K+HM  H        K+    K
Sbjct:   15 RPFRCD--TCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRTHTGQSQRRLKKASVQK 84          
BLAST of Zinc finger protein zic vs. Ensembl Yeast
Match: MIG3 (Transcriptional regulator; partially nonfunctional in S288C strains but has a major role in catabolite repression and ethanol response in some other strains; involved in response to toxic agents; phosphorylation by Snf1p or the Mec1p pathway inactivates Mig3p, allowing induction of damage response genesenvironment [Source:SGD;Acc:S000000830])

HSP 1 Score: 58.5362 bits (140), Expect = 1.271e-9
Identity = 26/58 (44.83%), Postives = 37/58 (63.79%), Query Frame = 1
Query:  976 EKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVH 1149
            ++PF+C    C + F R E+ K H RTHTGEKP KC  +GC + F+ S + K+H+  H
Sbjct:   14 QRPFRCEI--CSRGFHRLEHKKRHGRTHTGEKPHKCTVQGCPKSFSRSDELKRHLRTH 69          

HSP 2 Score: 50.447 bits (119), Expect = 5.065e-7
Identity = 20/58 (34.48%), Postives = 34/58 (58.62%), Query Frame = 1
Query: 1066 EKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIH 1239
            ++PF+C+   C R F     +K+H   H  +KP+ C  +GC KS++    L++H+R H
Sbjct:   14 QRPFRCEI--CSRGFHRLEHKKRHGRTHTGEKPHKCTVQGCPKSFSRSDELKRHLRTH 69          

HSP 3 Score: 49.2914 bits (116), Expect = 1.028e-6
Identity = 30/78 (38.46%), Postives = 39/78 (50.00%), Query Frame = 1
Query:  907 CTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHM 1140
            C+R F   + K +   H R HTGEKP +C    C K F+RS+ LK H RTHT         +G  RR   S   +K +
Sbjct:   22 CSRGFHRLEHKKR---HGRTHTGEKPHKCTVQGCPKSFSRSDELKRHLRTHT---------KGVQRRRIKSKGSRKTV 87          
BLAST of Zinc finger protein zic vs. Ensembl Nematostella
Match: NV-ZICC (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK36])

HSP 1 Score: 251.136 bits (640), Expect = 2.999e-79
Identity = 116/182 (63.74%), Postives = 139/182 (76.37%), Query Frame = 1
Query:  757 FQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHN-------ISPNNDYNMDANS 1281
              C W++   K   + CG+ F+ +++IV HL+ DHVGGPE   H CYWK+C R+  PFKAKYKL+NH+RVHTGEKPF CPF  CGKLFARSENLKIHKRTHTGEKPF C+F GCDRRFANSSDRKKH HVH +DKPY CK +GC+KSYTHPSSLRKHM++H+        SP++D    A +
Sbjct:   29 VMCEWIEPGSKG--KPCGRQFFRMHDIVAHLSEDHVGGPESTTHVCYWKDCARNGLPFKAKYKLINHIRVHTGEKPFACPFPGCGKLFARSENLKIHKRTHTGEKPFICEFPGCDRRFANSSDRKKHSHVHTSDKPYICKVDGCNKSYTHPSSLRKHMKLHSKPSDSGVGSPSDDGGSSAKT 208          
BLAST of Zinc finger protein zic vs. Ensembl Nematostella
Match: NV-ZICE (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK34])

HSP 1 Score: 238.424 bits (607), Expect = 1.758e-75
Identity = 111/166 (66.87%), Postives = 131/166 (78.92%), Query Frame = 1
Query:  757 FQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHNISPN 1254
              C W+D     + + CGK F  +++IV H+  +HV   +   H C+W+NCTR+  PFKAKYKLVNH+RVHTGEKPF CPF  CGKLFARSENLKIHKRTHTGEKPF C+F GCDRRFANSSDRKKH HVH +DKPY CK EGC+KSYTHPSSLRKHM++H +SP+
Sbjct:   13 MTCEWVDPQNYGKGKICGKQFSVLHDIVRHINDEHVSQNDSPLHVCHWRNCTRNGLPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKLFARSENLKIHKRTHTGEKPFICEFPGCDRRFANSSDRKKHSHVHTSDKPYNCKYEGCNKSYTHPSSLRKHMKLHGMSPS 178          
BLAST of Zinc finger protein zic vs. Ensembl Nematostella
Match: NV-ZICD (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK35])

HSP 1 Score: 236.884 bits (603), Expect = 9.256e-75
Identity = 107/162 (66.05%), Postives = 132/162 (81.48%), Query Frame = 1
Query:  757 FQCLWLDKH-MKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIH 1239
              C+W+D+  +  +R+ CGK +  + +IV+H++ +HV   +   H CYW+ C+R+ +PFKAKYKLVNH+RVHTGEKPF CPF  CGKLFARSENLKIHKRTHTGEKPF C+F GCDRRFANSSDRKKH HVH +DKPY CK +GC+KSYTHPSSLRKHM++H
Sbjct:   17 LTCMWIDQGPIPGKRKPCGKQYTHMPDIVSHISDEHVSANDSSLHVCYWQECSRNGQPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKLFARSENLKIHKRTHTGEKPFMCEFPGCDRRFANSSDRKKHSHVHTSDKPYICKVDGCNKSYTHPSSLRKHMKLH 178          
BLAST of Zinc finger protein zic vs. Ensembl Nematostella
Match: NV-ZICA (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8M8])

HSP 1 Score: 233.032 bits (593), Expect = 1.751e-73
Identity = 111/179 (62.01%), Postives = 135/179 (75.42%), Query Frame = 1
Query:  703 AAFYQFFHRNAVSGFRTEFQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIH 1239
             AF++F    A    +  F C W+D   K     C K+F  ++E+V H+T++HV G +   H C W++C R  KPFKAKYKLVNH+RVHTGEKPF CPF SC KLFARSENLKIHKRTHTGEKPF+C+F+GC+RRFANSSDRKKH HVH +DKPY C+  GC+KSYTHPSSLRKH++ H
Sbjct:    1 GAFFRFMRSPA----KDNFSCKWIDCTEKVSL-LCDKVFSCMDELVKHITIEHVNGRDSTQHVCCWESCDRAGKPFKAKYKLVNHIRVHTGEKPFVCPFSSCNKLFARSENLKIHKRTHTGEKPFECEFKGCNRRFANSSDRKKHSHVHTSDKPYNCRYSGCEKSYTHPSSLRKHLKAH 174          
BLAST of Zinc finger protein zic vs. Ensembl Nematostella
Match: NV-ZICB (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK39])

HSP 1 Score: 197.978 bits (502), Expect = 2.111e-60
Identity = 90/142 (63.38%), Postives = 110/142 (77.46%), Query Frame = 1
Query:  817 FYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHN 1242
            FY I E+V H+T  H+         C W+ C R+  PFKAKYKL+NH+RVHTGEKPF C    CGK FAR+ENLKIH RTHTGE+PF C+++GCD+RFANSSDR+KH+HVH  +KPY C+  GCDKSYTHPSSLRKHM++H+
Sbjct:    1 FYRIEELVFHITESHLVTGVTSAFVCNWRECPRNGLPFKAKYKLINHIRVHTGEKPFTCSQPGCGKSFARAENLKIHIRTHTGERPFACEYKGCDKRFANSSDRRKHIHVHTLEKPYCCRFVGCDKSYTHPSSLRKHMKVHS 142          
BLAST of Zinc finger protein zic vs. Ensembl Medaka
Match: zic2a (Zic family member 2 [Source:NCBI gene;Acc:101159393])

HSP 1 Score: 266.544 bits (680), Expect = 3.056e-82
Identity = 117/186 (62.90%), Postives = 150/186 (80.65%), Query Frame = 1
Query:  685 SSYSHQAAFYQFFHRNAVSGFRTEFQCLWLD-KHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIH 1239
            +++ H  AF+++  +  +   + E  C W+D   +   ++ C K F T++E+V H++++HVGGPEQ +H C+W++C+R+ KPFKAKYKLVNH+RVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPF+C+FEGCDRRFANSSDRKKHMHVH +DKPY CK   CDKSYTHPSSLRKHM++H
Sbjct:  201 AAHHHPGAFFRYMRQQCI---KQELICKWIDPDQLSNPKKCCNKTFSTMHELVTHVSVEHVGGPEQTNHVCFWEDCSRESKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFQCEFEGCDRRFANSSDRKKHMHVHTSDKPYLCKM--CDKSYTHPSSLRKHMKVH 381          
BLAST of Zinc finger protein zic vs. Ensembl Medaka
Match: zic1 (Zic family member 1 [Source:NCBI gene;Acc:101170307])

HSP 1 Score: 264.618 bits (675), Expect = 1.153e-81
Identity = 119/195 (61.03%), Postives = 154/195 (78.97%), Query Frame = 1
Query:  664 APTHPAMSSYSHQAAFYQFFHRNAVSGFRTEFQCLWLD-KHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHNI 1245
             P +  M+++    AF+++  +      + E  C W++ + +   +++C K F T++E+V HLT++HVGGPEQ +H CYW++C+R+ KPFKAKYKLVNH+RVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+F+GCDRRFANSSDRKKHMHVH +DKPY CK   CDKSYTHPSSLRKHM++ ++
Sbjct:  191 GPMNMNMAAHHGAGAFFRYMRQP----IKQELICKWIEPEQLTNPKKSCNKTFSTMHELVTHLTVEHVGGPEQTNHVCYWEDCSREGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFDGCDRRFANSSDRKKHMHVHTSDKPYLCKM--CDKSYTHPSSLRKHMKVKSM 379          
BLAST of Zinc finger protein zic vs. Ensembl Medaka
Match: zic4 (Zic family member 4 [Source:NCBI gene;Acc:101170551])

HSP 1 Score: 266.929 bits (681), Expect = 2.507e-81
Identity = 123/205 (60.00%), Postives = 152/205 (74.15%), Query Frame = 1
Query:  745 FRTEFQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHNISPNNDYNMDANSYETDFNQQLNSCPKMPKPNQNQLKEP 1359
             + E  C WL+      ++ C K + T++E+V H+T++HVGGPEQ +H C+W+ C R+ KPFKAKYKLVNH+RVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+F+GCDRRFANSSDRKKH HVH +DKPY CK  GCDKSYTHPSSLRKHM++H  SP       ++ YE+       S P +  P+ +  +EP
Sbjct:  283 IKQELICKWLEPE-HSPKKLCSKTYSTMHELVTHVTVEHVGGPEQANHICFWEECPREGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFDGCDRRFANSSDRKKHSHVHTSDKPYNCKVRGCDKSYTHPSSLRKHMKVHCKSPP-----PSSGYES-------STPSLVSPSSDLGREP 474          
BLAST of Zinc finger protein zic vs. Ensembl Medaka
Match: zic5 (Zic family member 5 [Source:NCBI gene;Acc:101159624])

HSP 1 Score: 265.774 bits (678), Expect = 3.006e-81
Identity = 114/169 (67.46%), Postives = 141/169 (83.43%), Query Frame = 1
Query:  745 FRTEFQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHNISP 1251
             + E  C W+D+ +  +++ C K + T++E+VNH+T++HVGGPEQ  H C+W+ C R+ K FKAKYKL+NH+RVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+F+GCDR+FANSSDRKKH HVH +DKPY+CK  GCDKSYTHPSSLRKHM++H  SP
Sbjct:  242 IKQELICKWIDQEL-SQKKPCSKTYSTMHELVNHVTVEHVGGPEQSSHVCFWEECPREGKAFKAKYKLINHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFDGCDRKFANSSDRKKHSHVHTSDKPYYCKVRGCDKSYTHPSSLRKHMKVHCKSP 409          
BLAST of Zinc finger protein zic vs. Ensembl Medaka
Match: zic3 (zinc finger protein ZIC 3 [Source:NCBI gene;Acc:101166969])

HSP 1 Score: 262.692 bits (670), Expect = 1.070e-80
Identity = 117/197 (59.39%), Postives = 151/197 (76.65%), Query Frame = 1
Query:  703 AAFYQFFHRNAVSGFRTEFQCLWLDK-HMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHNISPNNDYNMDANSYET 1290
             AF+++  +      + E  C W+++  M   ++TC + F T++E+V H++++HVGGPEQ +H C+W++C R+ K FKAKYKLVNH+RVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+F+GCDRRFANSSDRKKHMHVH +DKPY CK   CDKSYTHPSSLRKHM++H    +      ++ YE+
Sbjct:  214 GAFFRYMRQP----IKQELSCKWIEENQMNRPKKTCDRTFSTMHEMVTHVSMEHVGGPEQSNHVCFWEDCPREGKSFKAKYKLVNHIRVHTGEKPFPCPFPGCGKIFARSENLKIHKRTHTGEKPFKCEFDGCDRRFANSSDRKKHMHVHTSDKPYICKV--CDKSYTHPSSLRKHMKVHESQGSESSPAASSGYES 404          
BLAST of Zinc finger protein zic vs. Planmine SMEST
Match: SMESG000052644.1 (SMESG000052644.1)

HSP 1 Score: 979.548 bits (2531), Expect = 0.000e+0
Identity = 470/472 (99.58%), Postives = 471/472 (99.79%), Query Frame = 1
Query:  223 MVSYPSLLITDNLSKDIKFHQNIQVNNQLPLSMTTSETERFSSTNHNKNFCANDLLLKRYSYDPNYDLLASHPASVSDNYPPEFLASNSLSSFSVNALNSADILSQTSASDYQNYGMYGNHSQNHHQSMPCNPGTTLEPQILHSQTVAPTHPAMSSYSHQAAFYQFFHRNAVSGFRTEFQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHNISPNNDYNMDANSYETDFNQQLNSCPKMPKPNQNQLKEPISRFEHDHRSINQHEHSGSSNKLLNFFPFPHSSNFKQRPCHINPDQSSVWLPYPYFENPSGSRNPLWSKSYPSLFDITKPSFLASNPHSDSVT 1638
            MVSYPSLLITDNLSKDIKFHQNIQVNNQLPLSMTTSETERFSSTNHNKNFCANDLLLKRYSYDPNYDLLASHPASVSDNYPPEFLASNSLSSFSVNALNSADILSQTSASDYQNYGMYGNHSQNHHQSMPCNPGTTLEPQILHSQTVAPTHPAMSSYSHQAAFYQFFHRNAVSGFRTEFQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHNISPNNDYNMDANSYETDFNQQLNSCPKMPKPNQNQLKEPIS FEH+HRSINQHEHSGSSNKLLNFFPFPHSSNFKQRPCHINPDQSSVWLPYPYFENPSGSRNPLWSKSYPSLFDITKPSFLASNPHSDSVT
Sbjct:    1 MVSYPSLLITDNLSKDIKFHQNIQVNNQLPLSMTTSETERFSSTNHNKNFCANDLLLKRYSYDPNYDLLASHPASVSDNYPPEFLASNSLSSFSVNALNSADILSQTSASDYQNYGMYGNHSQNHHQSMPCNPGTTLEPQILHSQTVAPTHPAMSSYSHQAAFYQFFHRNAVSGFRTEFQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHNISPNNDYNMDANSYETDFNQQLNSCPKMPKPNQNQLKEPISSFEHNHRSINQHEHSGSSNKLLNFFPFPHSSNFKQRPCHINPDQSSVWLPYPYFENPSGSRNPLWSKSYPSLFDITKPSFLASNPHSDSVT 472          
BLAST of Zinc finger protein zic vs. Planmine SMEST
Match: SMESG000022958.1 (SMESG000022958.1)

HSP 1 Score: 315.464 bits (807), Expect = 4.899e-100
Identity = 144/196 (73.47%), Postives = 163/196 (83.16%), Query Frame = 1
Query:  670 THPAMSSYSHQAAFYQFFHRNAVSGFRT--EFQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHNISP 1251
            T P +S+Y  QAA Y+ F  N         E +CLW+D + +E  + C KL+ +I +IV HLT+DHVGGPEQLDHTCYWK+C RD K FKAKYKLVNH+RVHTGEKPFQCPF +CGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVH NDKPYFCK +GC+KSYTHPSSLRKHMR+HN+SP
Sbjct:  158 TFPGLSNYGRQAALYRCFKNNLNEPMHINKELRCLWIDPNQREGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSP 353          
BLAST of Zinc finger protein zic vs. Planmine SMEST
Match: SMESG000073727.1 (SMESG000073727.1)

HSP 1 Score: 174.866 bits (442), Expect = 7.973e-46
Identity = 83/162 (51.23%), Postives = 105/162 (64.81%), Query Frame = 1
Query:  751 TEFQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMH-VHMNDKPYFCKQEGCDKSYTHPSSLRKHMR 1233
            TE  C W D         C K F T  E+V H++  H+ G  +    C WK+C R  +PFKA+Y LV H+R HTGEKP QC F +C K ++R ENLK H R+HTGEKP++C+F GC + F+N+SDR KH +  H N KPY CK EGC K YT PSSLRKH++
Sbjct:  299 TETNCHWND---------CVKTFDTQAELVKHISTIHISGSGKQTFVCQWKDCVRSGRPFKAQYMLVVHMRRHTGEKPHQCTFPNCNKRYSRLENLKTHIRSHTGEKPYECEFPGCHKAFSNASDRAKHQNRTHSNTKPYVCKVEGCAKRYTDPSSLRKHVK 451          
BLAST of Zinc finger protein zic vs. Planmine SMEST
Match: SMESG000073727.1 (SMESG000073727.1)

HSP 1 Score: 174.866 bits (442), Expect = 8.635e-46
Identity = 83/162 (51.23%), Postives = 105/162 (64.81%), Query Frame = 1
Query:  751 TEFQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMH-VHMNDKPYFCKQEGCDKSYTHPSSLRKHMR 1233
            TE  C W D         C K F T  E+V H++  H+ G  +    C WK+C R  +PFKA+Y LV H+R HTGEKP QC F +C K ++R ENLK H R+HTGEKP++C+F GC + F+N+SDR KH +  H N KPY CK EGC K YT PSSLRKH++
Sbjct:  321 TETNCHWND---------CVKTFDTQAELVKHISTIHISGSGKQTFVCQWKDCVRSGRPFKAQYMLVVHMRRHTGEKPHQCTFPNCNKRYSRLENLKTHIRSHTGEKPYECEFPGCHKAFSNASDRAKHQNRTHSNTKPYVCKVEGCAKRYTDPSSLRKHVK 473          
BLAST of Zinc finger protein zic vs. Planmine SMEST
Match: SMESG000078300.1 (SMESG000078300.1)

HSP 1 Score: 171.014 bits (432), Expect = 8.078e-45
Identity = 84/192 (43.75%), Postives = 113/192 (58.85%), Query Frame = 1
Query:  691 YSHQAAFYQFFHRNAVSGFRTEFQ--------CLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLD-HTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIH 1239
            YS Q   +QF + N  +   T           C W+D         C + F+    +VNH+   HV      D +TC+W+ C+R  KPF A+YKL+ H+RVH+GEKP +C +  C K F+R ENLKIH+R+HTGE+P++C + GC + F+NSSDR KH   H + KPY C   GC K YT PSSLRKH + H
Sbjct:  357 YSPQINIHQFSNCNLSNQIYTSIDSRPHPKLICFWID---------CYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSH 539          
The following BLAST results are available for this feature:
BLAST of Zinc finger protein zic vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZIC21.234e-8258.06Zic family member 2 [Source:HGNC Symbol;Acc:HGNC:1... [more]
ZIC33.791e-8260.41Zic family member 3 [Source:HGNC Symbol;Acc:HGNC:1... [more]
ZIC49.389e-8261.14Zic family member 4 [Source:HGNC Symbol;Acc:HGNC:2... [more]
ZIC49.389e-8261.14Zic family member 4 [Source:HGNC Symbol;Acc:HGNC:2... [more]
ZIC49.389e-8261.14Zic family member 4 [Source:HGNC Symbol;Acc:HGNC:2... [more]
back to top
BLAST of Zinc finger protein zic vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ref-22.948e-5350.27REgulator of Fusion [Source:UniProtKB/TrEMBL;Acc:... [more]
ref-22.948e-5350.27REgulator of Fusion [Source:UniProtKB/TrEMBL;Acc:... [more]
ref-23.436e-5350.27REgulator of Fusion [Source:UniProtKB/TrEMBL;Acc:... [more]
tra-12.291e-3946.63Sex-determining transformer protein 1 [Source:Uni... [more]
ztf-145.735e-2539.62Zinc finger putative Transcription Factor family ... [more]
back to top
BLAST of Zinc finger protein zic vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
opa1.748e-8153.94gene:FBgn0003002 transcript:FBtr0078836[more]
lmd6.651e-4350.34gene:FBgn0039039 transcript:FBtr0084364[more]
ci8.412e-4348.48gene:FBgn0004859 transcript:FBtr0306168[more]
ci9.822e-4348.48gene:FBgn0004859 transcript:FBtr0089178[more]
sug1.428e-4044.85gene:FBgn0033782 transcript:FBtr0331985[more]
back to top
BLAST of Zinc finger protein zic vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zic42.903e-8256.31zic family member 4 [Source:ZFIN;Acc:ZDB-GENE-0406... [more]
zic13.174e-8262.18zic family member 1 (odd-paired homolog, Drosophil... [more]
zic54.139e-8262.30zic family member 5 (odd-paired homolog, Drosophil... [more]
zic36.940e-8260.41zic family member 3 heterotaxy 1 (odd-paired homol... [more]
zic46.947e-8256.31zic family member 4 [Source:ZFIN;Acc:ZDB-GENE-0406... [more]
back to top
BLAST of Zinc finger protein zic vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bcam2.945e-8369.82basal cell adhesion molecule (Lutheran blood group... [more]
zic28.042e-8354.94Zic family member 2 [Source:NCBI gene;Acc:549779][more]
cnot103.646e-8261.66CCR4-NOT transcription complex subunit 10 [Source:... [more]
nt5dc38.394e-8266.125'-nucleotidase domain containing 3 [Source:Xenbas... [more]
nt5dc31.791e-8166.125'-nucleotidase domain containing 3 [Source:Xenbas... [more]
back to top
BLAST of Zinc finger protein zic vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Zic41.753e-8362.30zinc finger protein of the cerebellum 4 [Source:MG... [more]
Zic41.753e-8362.30zinc finger protein of the cerebellum 4 [Source:MG... [more]
Zic42.697e-8362.30zinc finger protein of the cerebellum 4 [Source:MG... [more]
Zic39.736e-8359.90zinc finger protein of the cerebellum 3 [Source:MG... [more]
Zic25.217e-8258.14zinc finger protein of the cerebellum 2 [Source:MG... [more]
back to top
BLAST of Zinc finger protein zic vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q61467|ZIC4_MOUSE1.886e-8262.30Zinc finger protein ZIC 4 OS=Mus musculus OX=10090... [more]
sp|Q9YIB7|ZIC2B_XENLA2.789e-8261.86Zinc finger protein ZIC 2-B OS=Xenopus laevis OX=8... [more]
sp|O95409|ZIC2_HUMAN5.927e-8258.06Zinc finger protein ZIC 2 OS=Homo sapiens OX=9606 ... [more]
sp|Q9IB89|ZIC5_XENLA1.069e-8169.23Zinc finger protein ZIC 5 OS=Xenopus laevis OX=835... [more]
sp|O60481|ZIC3_HUMAN1.820e-8160.41Zinc finger protein ZIC 3 OS=Homo sapiens OX=9606 ... [more]
back to top
BLAST of Zinc finger protein zic vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q1JV160.000e+085.59Zinc finger protein Dj-ZicB OS=Dugesia japonica OX... [more]
A0A159X5T53.578e-15899.54Zinc finger protein of the cerebellum 2 (Fragment)... [more]
X5CWX35.318e-9672.96Zinc finger protein A OS=Schmidtea mediterranea OX... [more]
Q1JV177.831e-9662.50Zinc finger protein Dj-ZicA OS=Dugesia japonica OX... [more]
A0A2G8L3Q91.919e-8867.69Zinc finger protein Ap-Zic OS=Stichopus japonicus ... [more]
back to top
BLAST of Zinc finger protein zic vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zic53.935e-8261.78zic family member 5 (odd-paired homolog, Drosophil... [more]
zic43.986e-8260.00zinc finger protein ZIC 4 [Source:NCBI gene;Acc:10... [more]
zic38.002e-8259.90Zic family member 3 [Source:NCBI gene;Acc:10303985... [more]
zic51.285e-8161.78zic family member 5 (odd-paired homolog, Drosophil... [more]
zic12.650e-8169.28zic family member 1 (odd-paired homolog, Drosophil... [more]
back to top
BLAST of Zinc finger protein zic vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glis2b3.021e-4550.00GLIS family zinc finger 2b [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000008614.14.419e-4454.20pep scaffold:Pmarinus_7.0:GL479003:10005:19084:-1 ... [more]
ENSPMAT00000003448.11.237e-3042.07pep scaffold:Pmarinus_7.0:GL477543:42863:56609:1 g... [more]
znf143b9.425e-3040.41zinc finger protein 143b [Source:NCBI gene;Acc:393... [more]
znf143b1.036e-2940.41zinc finger protein 143b [Source:NCBI gene;Acc:393... [more]
back to top
BLAST of Zinc finger protein zic vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ZAP14.314e-2137.24Zinc-regulated transcription factor; binds to zinc... [more]
AZF15.227e-1940.00Zinc-finger transcription factor; involved in diau... [more]
CRZ11.953e-1138.89Transcription factor, activates transcription of s... [more]
MIG29.101e-1043.42Zinc finger transcriptional repressor; cooperates ... [more]
MIG31.271e-944.83Transcriptional regulator; partially nonfunctional... [more]
back to top
BLAST of Zinc finger protein zic vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
NV-ZICC2.999e-7963.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
NV-ZICE1.758e-7566.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
NV-ZICD9.256e-7566.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
NV-ZICA1.751e-7362.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
NV-ZICB2.111e-6063.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Zinc finger protein zic vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zic2a3.056e-8262.90Zic family member 2 [Source:NCBI gene;Acc:10115939... [more]
zic11.153e-8161.03Zic family member 1 [Source:NCBI gene;Acc:10117030... [more]
zic42.507e-8160.00Zic family member 4 [Source:NCBI gene;Acc:10117055... [more]
zic53.006e-8167.46Zic family member 5 [Source:NCBI gene;Acc:10115962... [more]
zic31.070e-8059.39zinc finger protein ZIC 3 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Zinc finger protein zic vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000052644.10.000e+099.58SMESG000052644.1[more]
SMESG000022958.14.899e-10073.47SMESG000022958.1[more]
SMESG000073727.17.973e-4651.23SMESG000073727.1[more]
SMESG000073727.18.635e-4651.23SMESG000073727.1[more]
SMESG000078300.18.078e-4543.75SMESG000078300.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016788 ID=SMED30016788|Name=Zinc finger protein zic|organism=Schmidtea mediterranea sexual|type=transcript|length=1895bp
CGTGGTCTCATGTGTTACTTGATTTTCAGTTGTCAGTTTGCGGAACTTTA
AACCATAATTTCTGATTATATGTATTTTTGTTTCAATGTTAGCTATGTGA
TACATTTTCCATTTTGATAAAATATCCAATGTCCCAGTCTATTCATTGGT
ATCAACGGATCATGTTTGGATTATTCATTTCAAAATTTAGTCGATCAAAT
CTGACAACAGTCAATATTATTAATGGTTTCTTATCCATCATTATTGATCA
CCGATAATTTGTCGAAAGATATTAAATTTCATCAAAATATACAAGTCAAC
AATCAATTGCCTTTATCAATGACAACGTCTGAAACCGAGAGGTTTTCGTC
TACAAATCACAATAAAAATTTCTGTGCAAATGATTTACTGTTGAAACGAT
ATTCCTATGATCCCAATTATGATTTGTTGGCCTCTCATCCAGCATCGGTT
TCCGACAATTATCCGCCTGAATTTCTAGCTTCAAATTCATTGTCATCGTT
TAGTGTGAACGCGTTGAATTCTGCCGATATTCTTTCCCAGACTTCGGCAA
GTGATTACCAAAACTATGGAATGTATGGAAACCATTCCCAGAATCATCAC
CAATCTATGCCATGCAATCCCGGTACGACATTGGAGCCGCAAATTCTCCA
TTCTCAAACCGTAGCTCCTACTCATCCAGCGATGAGTTCCTACAGCCATC
AAGCTGCATTCTATCAATTCTTTCACAGAAACGCAGTTTCAGGATTCAGA
ACCGAGTTCCAATGCCTATGGTTGGATAAACACATGAAAGAAGAACGTCG
AACATGCGGGAAATTGTTTTACACAATCAATGAAATAGTCAACCACTTAA
CACTTGATCATGTCGGCGGACCGGAACAACTTGATCACACTTGCTATTGG
AAGAACTGCACGAGAGATTTTAAACCATTTAAAGCGAAATACAAATTGGT
CAATCATCTCCGTGTCCACACGGGAGAGAAACCATTTCAGTGTCCTTTCT
TAAGCTGTGGAAAATTGTTTGCTCGAAGTGAAAATCTGAAAATCCATAAA
AGAACTCACACAGGTGAAAAGCCATTCAAATGCGACTTTGAAGGATGCGA
TAGAAGGTTTGCTAACAGTTCCGACCGTAAGAAGCACATGCACGTGCACA
TGAATGACAAACCGTATTTCTGTAAGCAAGAAGGTTGTGATAAAAGCTAT
ACGCATCCCAGCTCTTTGCGCAAACACATGAGAATTCATAACATTTCACC
AAATAATGACTACAACATGGATGCCAACTCATATGAAACCGATTTCAACC
AGCAACTCAATAGCTGCCCAAAAATGCCTAAACCCAACCAGAATCAATTG
AAAGAACCGATTTCCCGTTTTGAGCATGACCATCGAAGTATCAATCAACA
CGAACATTCTGGTTCCTCCAATAAACTGTTAAATTTTTTCCCTTTTCCTC
ATTCATCGAATTTCAAACAGAGACCTTGTCATATTAATCCAGACCAATCA
AGCGTCTGGCTGCCATATCCTTATTTTGAGAATCCGTCTGGCAGTCGCAA
TCCTTTATGGTCAAAATCCTATCCGTCATTGTTCGATATCACCAAACCCT
CTTTCCTCGCCTCCAATCCACATTCAGATTCCGTGACGTAACATTTGACA
AACCTGACTGCCGTTAGATATATCCCAACTACAACATAATTTTTTGAAAT
TTATACGTTGCTTTGTCGGTTTTTTTATGTCGCATAATCCTCTTGTCAGG
CTCGGTAACAGGGTTCGTACAGGGTATCAAATCAGTAATTGTGATGCTAT
TGTTTTATCGGAGCTAAATTTAAACGATAAAAAACAAAATAAACATTTAT
ATATGCTTTATTTATATTTGTATAATTAACGGGAAAAAATATTAG
back to top

protein sequence of SMED30016788-orf-1

>SMED30016788-orf-1 ID=SMED30016788-orf-1|Name=SMED30016788-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=473bp
MVSYPSLLITDNLSKDIKFHQNIQVNNQLPLSMTTSETERFSSTNHNKNF
CANDLLLKRYSYDPNYDLLASHPASVSDNYPPEFLASNSLSSFSVNALNS
ADILSQTSASDYQNYGMYGNHSQNHHQSMPCNPGTTLEPQILHSQTVAPT
HPAMSSYSHQAAFYQFFHRNAVSGFRTEFQCLWLDKHMKEERRTCGKLFY
TINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHT
GEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSS
DRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHNISPNNDYNMD
ANSYETDFNQQLNSCPKMPKPNQNQLKEPISRFEHDHRSINQHEHSGSSN
KLLNFFPFPHSSNFKQRPCHINPDQSSVWLPYPYFENPSGSRNPLWSKSY
PSLFDITKPSFLASNPHSDSVT*
back to top
Aliases
The feature 'Zinc finger protein zic' has the following synonyms
Synonym
Dj-ZicB
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
PLANA:0002056medial muscle cell
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR041643Znf_ZIC
IPR036236Znf_C2H2_sf
IPR015880Znf_C2H2-like
IPR007087Znf_C2H2
IPR013087Znf_C2H2_type
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0003676nucleic acid binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 315..339
e-value: 8.3E-5
score: 32.0
coord: 222..249
e-value: 13.0
score: 12.1
coord: 255..279
e-value: 0.0041
score: 26.3
coord: 285..309
e-value: 0.0022
score: 27.3
IPR013087Zinc finger C2H2-typePFAMPF00096zf-C2H2coord: 285..309
e-value: 0.0076
score: 16.7
coord: 315..339
e-value: 1.9E-5
score: 24.8
coord: 255..279
e-value: 6.2E-4
score: 20.1
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 287..309
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 317..339
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 257..279
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 315..339
score: 11.157
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 285..314
score: 12.757
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 255..284
score: 16.83
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 227..254
score: 10.866
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 313..340
e-value: 1.1E-11
score: 46.4
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 169..251
e-value: 5.8E-23
score: 83.1
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 252..282
e-value: 1.2E-15
score: 59.0
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 283..310
e-value: 5.8E-11
score: 44.2
NoneNo IPR availablePANTHERPTHR19818:SF91ZINC FINGER PROTEIN ZIC 4coord: 125..364
NoneNo IPR availablePANTHERPTHR19818ZINC FINGER PROTEIN ZIC AND GLIcoord: 125..364
IPR041643ZIC protein, zinc finger domainPFAMPF18366zf_ZICcoord: 176..217
e-value: 2.5E-15
score: 56.3
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 236..291
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 283..339