JmjC domain-containing protein

Overview
NameJmjC domain-containing protein
Smed IDSMED30016779
Length (bp)1641
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of JmjC domain-containing protein (SMED30016779) t-SNE clustered cells

Violin plots show distribution of expression levels for JmjC domain-containing protein (SMED30016779) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of JmjC domain-containing protein (SMED30016779) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for JmjC domain-containing protein (SMED30016779) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016779

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30016779SMESG000053108.1 SmedASXL_014604SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30016779SMESG000053108.1 dd_Smed_v4_12267_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30016779SMESG000053108.1 dd_Smed_v4_12267_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal cellSMED30016779SMESG000053108.1 dd_Smed_v4_12267_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30016779SMESG000053108.1 dd_Smed_v6_12267_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30016779SMESG000053108.1 OX_Smed_1.0.14684ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30016779SMESG000053108.1 dd_Smed_v4_12267_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of JmjC domain-containing protein vs. Ensembl Human
Match: JMJD6 (jumonji domain containing 6, arginine demethylase and lysine hydroxylase [Source:HGNC Symbol;Acc:HGNC:19355])

HSP 1 Score: 75.0998 bits (183), Expect = 6.738e-14
Identity = 72/295 (24.41%), Postives = 122/295 (41.36%), Query Frame = 2
Query:  569 LSIEEYRDIYSGKW-PVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKTMADGVSENFAMPLDIYMQHLHKGYPKQWTYLNDELF--IPSRPKLQSDLGTCKEIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPPGQDNLLHVKLETKYKFPININKYNSKIDCFDPNAHIEYPSLK------SAKVLEFYQYPGELLIIPTGWFHQVKFTSKPLKSVAGQLMNSENYLYVLEEIFKGGDLQRGPYYSDLKNKSPQEKVKEVLLGITEKT 1426
            LS+EE+ + Y   + PV++ +    W A +KWT     + +  +        DG S    M +  Y++++         Y+ D  +   P R KL  D    K   +D FQ    + RP + + + G   S + +H+DP   +  N ++ G K+W LFP      L      K       N+ +  I  F+    + YP  +        K LE  Q PGE + +P GW+H V      + ++     +S N+  V  +  +G       +Y  LK + P+  V    + + E T
Sbjct:   54 LSVEEFVERYERPYKPVVLLNAQEGWSAQEKWTLERLKRKYRNQKFKCGEDNDGYS--VKMKMKYYIEYMESTRDDSPLYIFDSSYGEHPKRRKLLEDYKVPKFFTDDLFQYAGEKRRPPYRWFVMGPPRSGTGIHIDPLGTSAWNALVQGHKRWCLFPTSTPREL-----IKVTRDEGGNQQDEAITWFN----VIYPRTQLPTWPPEFKPLEILQKPGETVFVPGGWWHVVLNLDTTI-AITQNFASSTNFPVVWHKTVRGRPKLSRKWYRILKQEHPELAVLADSVDLQEST 336          
BLAST of JmjC domain-containing protein vs. Ensembl Human
Match: JMJD6 (jumonji domain containing 6, arginine demethylase and lysine hydroxylase [Source:HGNC Symbol;Acc:HGNC:19355])

HSP 1 Score: 75.0998 bits (183), Expect = 8.475e-14
Identity = 72/295 (24.41%), Postives = 122/295 (41.36%), Query Frame = 2
Query:  569 LSIEEYRDIYSGKW-PVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKTMADGVSENFAMPLDIYMQHLHKGYPKQWTYLNDELF--IPSRPKLQSDLGTCKEIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPPGQDNLLHVKLETKYKFPININKYNSKIDCFDPNAHIEYPSLK------SAKVLEFYQYPGELLIIPTGWFHQVKFTSKPLKSVAGQLMNSENYLYVLEEIFKGGDLQRGPYYSDLKNKSPQEKVKEVLLGITEKT 1426
            LS+EE+ + Y   + PV++ +    W A +KWT     + +  +        DG S    M +  Y++++         Y+ D  +   P R KL  D    K   +D FQ    + RP + + + G   S + +H+DP   +  N ++ G K+W LFP      L      K       N+ +  I  F+    + YP  +        K LE  Q PGE + +P GW+H V      + ++     +S N+  V  +  +G       +Y  LK + P+  V    + + E T
Sbjct:   54 LSVEEFVERYERPYKPVVLLNAQEGWSAQEKWTLERLKRKYRNQKFKCGEDNDGYS--VKMKMKYYIEYMESTRDDSPLYIFDSSYGEHPKRRKLLEDYKVPKFFTDDLFQYAGEKRRPPYRWFVMGPPRSGTGIHIDPLGTSAWNALVQGHKRWCLFPTSTPREL-----IKVTRDEGGNQQDEAITWFN----VIYPRTQLPTWPPEFKPLEILQKPGETVFVPGGWWHVVLNLDTTI-AITQNFASSTNFPVVWHKTVRGRPKLSRKWYRILKQEHPELAVLADSVDLQEST 336          
BLAST of JmjC domain-containing protein vs. Ensembl Human
Match: JMJD6 (jumonji domain containing 6, arginine demethylase and lysine hydroxylase [Source:HGNC Symbol;Acc:HGNC:19355])

HSP 1 Score: 71.633 bits (174), Expect = 7.126e-13
Identity = 65/263 (24.71%), Postives = 110/263 (41.83%), Query Frame = 2
Query:  569 LSIEEYRDIYSGKW-PVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKTMADGVSENFAMPLDIYMQHLHKGYPKQWTYLNDELF--IPSRPKLQSDLGTCKEIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPPGQDNLLHVKLETKYKFPININKYNSKIDCFDPNAHIEYPSLK------SAKVLEFYQYPGELLIIPTGWFHQVKFTSKPLKSVAGQLMNSENYLYVLEEIFKG 1330
            LS+EE+ + Y   + PV++ +    W A +KWT     + +  +        DG S    M +  Y++++         Y+ D  +   P R KL  D    K   +D FQ    + RP + + + G   S + +H+DP   +  N ++ G K+W LFP      L      K       N+ +  I  F+    + YP  +        K LE  Q PGE + +P GW+H V      + ++     +S N+  V  +  +G
Sbjct:   54 LSVEEFVERYERPYKPVVLLNAQEGWSAQEKWTLERLKRKYRNQKFKCGEDNDGYS--VKMKMKYYIEYMESTRDDSPLYIFDSSYGEHPKRRKLLEDYKVPKFFTDDLFQYAGEKRRPPYRWFVMGPPRSGTGIHIDPLGTSAWNALVQGHKRWCLFPTSTPREL-----IKVTRDEGGNQQDEAITWFN----VIYPRTQLPTWPPEFKPLEILQKPGETVFVPGGWWHVVLNLDTTI-AITQNFASSTNFPVVWHKTVRG 304          
BLAST of JmjC domain-containing protein vs. Ensembl Human
Match: JMJD6 (jumonji domain containing 6, arginine demethylase and lysine hydroxylase [Source:HGNC Symbol;Acc:HGNC:19355])

HSP 1 Score: 71.633 bits (174), Expect = 8.230e-13
Identity = 65/263 (24.71%), Postives = 110/263 (41.83%), Query Frame = 2
Query:  569 LSIEEYRDIYSGKW-PVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKTMADGVSENFAMPLDIYMQHLHKGYPKQWTYLNDELF--IPSRPKLQSDLGTCKEIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPPGQDNLLHVKLETKYKFPININKYNSKIDCFDPNAHIEYPSLK------SAKVLEFYQYPGELLIIPTGWFHQVKFTSKPLKSVAGQLMNSENYLYVLEEIFKG 1330
            LS+EE+ + Y   + PV++ +    W A +KWT     + +  +        DG S    M +  Y++++         Y+ D  +   P R KL  D    K   +D FQ    + RP + + + G   S + +H+DP   +  N ++ G K+W LFP      L      K       N+ +  I  F+    + YP  +        K LE  Q PGE + +P GW+H V      + ++     +S N+  V  +  +G
Sbjct:   54 LSVEEFVERYERPYKPVVLLNAQEGWSAQEKWTLERLKRKYRNQKFKCGEDNDGYS--VKMKMKYYIEYMESTRDDSPLYIFDSSYGEHPKRRKLLEDYKVPKFFTDDLFQYAGEKRRPPYRWFVMGPPRSGTGIHIDPLGTSAWNALVQGHKRWCLFPTSTPREL-----IKVTRDEGGNQQDEAITWFN----VIYPRTQLPTWPPEFKPLEILQKPGETVFVPGGWWHVVLNLDTTI-AITQNFASSTNFPVVWHKTVRG 304          
BLAST of JmjC domain-containing protein vs. Ensembl Human
Match: JMJD6 (jumonji domain containing 6, arginine demethylase and lysine hydroxylase [Source:HGNC Symbol;Acc:HGNC:19355])

HSP 1 Score: 71.633 bits (174), Expect = 8.230e-13
Identity = 65/263 (24.71%), Postives = 110/263 (41.83%), Query Frame = 2
Query:  569 LSIEEYRDIYSGKW-PVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKTMADGVSENFAMPLDIYMQHLHKGYPKQWTYLNDELF--IPSRPKLQSDLGTCKEIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPPGQDNLLHVKLETKYKFPININKYNSKIDCFDPNAHIEYPSLK------SAKVLEFYQYPGELLIIPTGWFHQVKFTSKPLKSVAGQLMNSENYLYVLEEIFKG 1330
            LS+EE+ + Y   + PV++ +    W A +KWT     + +  +        DG S    M +  Y++++         Y+ D  +   P R KL  D    K   +D FQ    + RP + + + G   S + +H+DP   +  N ++ G K+W LFP      L      K       N+ +  I  F+    + YP  +        K LE  Q PGE + +P GW+H V      + ++     +S N+  V  +  +G
Sbjct:   54 LSVEEFVERYERPYKPVVLLNAQEGWSAQEKWTLERLKRKYRNQKFKCGEDNDGYS--VKMKMKYYIEYMESTRDDSPLYIFDSSYGEHPKRRKLLEDYKVPKFFTDDLFQYAGEKRRPPYRWFVMGPPRSGTGIHIDPLGTSAWNALVQGHKRWCLFPTSTPREL-----IKVTRDEGGNQQDEAITWFN----VIYPRTQLPTWPPEFKPLEILQKPGETVFVPGGWWHVVLNLDTTI-AITQNFASSTNFPVVWHKTVRG 304          
BLAST of JmjC domain-containing protein vs. Ensembl Celegans
Match: jmjd-4 (JuMonJi (Transcription factor) Domain protein [Source:UniProtKB/TrEMBL;Acc:Q14V35])

HSP 1 Score: 68.9366 bits (167), Expect = 2.264e-12
Identity = 74/296 (25.00%), Postives = 120/296 (40.54%), Query Frame = 2
Query:  641 WPAMKKWT-------KSYFMKSHGRELVTVKTMADGVSENFAMPLDIYMQHLHKGYPKQWTYLNDELFIPSRPKLQSDLGTCKEIMEDYFQMFPVEIRPWWS------------FLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPPGQDNLLHVKLETKYKFPININKYNSKIDCFDPNAHIEYPSLKSAKVLEFYQYPGELLIIPTGWFHQVKFTSKPLKSVAGQLMNSENYLYVLEEIFKGGDLQRGPYYSDLKN----KSPQEKVKEVLLGITEKTRTQGREATEFI 1459
            W A+K W        K Y  KS+G   V +     G ++     L  +++ +  G P+   YL D  F       Q++ GT    +  +F    V   PW S            F+  G   S + LH D  +    +  I G KQW + PPG +NL    + T+  F  +I +Y    +               AKV++F Q PGE++ +P+ W+HQ       + S+    MNS N L++++E     +L       D  +    +  +EKV  VL        ++ R+  E +
Sbjct:   39 WTAVKDWVLPNGQPNKEYLKKSYGDSKVPILC---GGNQYKTTTLKEFLEEM--GDPE--VYLKDWHF-------QNEFGTSSYSLHPFFSRDFVNCEPWTSEKSENPFGDDYRFVYIGASGSWTKLHSDVVSSHSWSANICGRKQWFMMPPGSENLFRSSV-TESGFVDDIREYERLFE--------------QAKVIKFVQEPGEIVFVPSNWYHQAHNLEDTI-SINHNWMNSTN-LHLVQEFLSRRELDVREELQDCVDLFSAEEFEEKVDLVLFADARLNNSKFRKLCELV 303          
BLAST of JmjC domain-containing protein vs. Ensembl Celegans
Match: psr-1 (Bifunctional arginine demethylase and lysyl-hydroxylase psr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9GYI4])

HSP 1 Score: 68.9366 bits (167), Expect = 2.719e-12
Identity = 63/231 (27.27%), Postives = 95/231 (41.13%), Query Frame = 2
Query:  566 DLSIEEYR-DIYSGKWPVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKTMADGVSENFAMPLDIYMQHLHKGYPKQWTYLNDELFIPSRP--KLQSDLGTCKEIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPP-GQDNLLHVKLETKYKFPININKYNSKIDCFDP-NAHIEYPSL-KSAKVLEFYQYPGELLIIPTGWFHQV 1240
            +L++EE+R D    + PVIIT     W A  KWT     K +  +    K   D    +  M +  Y  ++         Y+ D  F   R   KL  D    K   +D F     + RP   + + G   S + +H+DP   +  N ++ G K+W L PP    +L+      K K P      +  I  F      +  PS  K    +E  Q PGE + +P+GW+H V
Sbjct:   74 NLTVEEFRRDFERPRIPVIITGLTDNWAAKDKWTVERLSKKYRNQ--NFKCGEDDNGNSVRMKMKYYHDYMLNNKDDSPLYIFDSSFAERRKTKKLSEDYSVPKFFEDDLFHYADDKKRPPHRWFVMGPARSGTAIHIDPLGTSAWNSLLQGHKRWVLIPPIAPRDLVKPMAHEKGKHP------DEGITWFQTVYKRVRSPSWPKEYAPIECRQGPGETMFVPSGWWHVV 296          
BLAST of JmjC domain-containing protein vs. Ensembl Celegans
Match: psr-1 (Bifunctional arginine demethylase and lysyl-hydroxylase psr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9GYI4])

HSP 1 Score: 68.9366 bits (167), Expect = 2.771e-12
Identity = 63/231 (27.27%), Postives = 95/231 (41.13%), Query Frame = 2
Query:  566 DLSIEEYR-DIYSGKWPVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKTMADGVSENFAMPLDIYMQHLHKGYPKQWTYLNDELFIPSRP--KLQSDLGTCKEIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPP-GQDNLLHVKLETKYKFPININKYNSKIDCFDP-NAHIEYPSL-KSAKVLEFYQYPGELLIIPTGWFHQV 1240
            +L++EE+R D    + PVIIT     W A  KWT     K +  +    K   D    +  M +  Y  ++         Y+ D  F   R   KL  D    K   +D F     + RP   + + G   S + +H+DP   +  N ++ G K+W L PP    +L+      K K P      +  I  F      +  PS  K    +E  Q PGE + +P+GW+H V
Sbjct:   58 NLTVEEFRRDFERPRIPVIITGLTDNWAAKDKWTVERLSKKYRNQ--NFKCGEDDNGNSVRMKMKYYHDYMLNNKDDSPLYIFDSSFAERRKTKKLSEDYSVPKFFEDDLFHYADDKKRPPHRWFVMGPARSGTAIHIDPLGTSAWNSLLQGHKRWVLIPPIAPRDLVKPMAHEKGKHP------DEGITWFQTVYKRVRSPSWPKEYAPIECRQGPGETMFVPSGWWHVV 280          
BLAST of JmjC domain-containing protein vs. Ensembl Celegans
Match: psr-1 (Bifunctional arginine demethylase and lysyl-hydroxylase psr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9GYI4])

HSP 1 Score: 49.6766 bits (117), Expect = 2.334e-6
Identity = 49/181 (27.07%), Postives = 74/181 (40.88%), Query Frame = 2
Query:  803 YLNDELFIPSRP--KLQSDLGTCKEIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPP-GQDNLLHVKLETKYKFPININKYNSKIDCFDPN-AHIEYPSL-KSAKVLEFYQYPGELLIIPTGWFHQVKFTSKPLKSVAGQLMNSENYLYVLEEIFKG 1330
            Y+ D  F   R   KL  D    K   +D F     + RP   + + G   S + +H+DP   +  N ++ G K+W L PP    +L+      K K P      +  I  F      +  PS  K    +E  Q PGE + +P+GW+H V    +   +V     + EN   V  +  KG
Sbjct:   20 YIFDSSFAERRKTKKLSEDYSVPKFFEDDLFHYADDKKRPPHRWFVMGPARSGTAIHIDPLGTSAWNSLLQGHKRWVLIPPIAPRDLVKPMAHEKGKHP------DEGITWFQTVYKRVRSPSWPKEYAPIECRQGPGETMFVPSGWWHVV-INEEYTIAVTHNYCSVENLHLVWPKTVKG 193          
BLAST of JmjC domain-containing protein vs. Ensembl Fly
Match: PSR (gene:FBgn0038948 transcript:FBtr0330378)

HSP 1 Score: 63.5438 bits (153), Expect = 2.423e-10
Identity = 55/214 (25.70%), Postives = 88/214 (41.12%), Query Frame = 2
Query:  611 PVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKTMADGVSENFAMPLDIYMQHLHKGYPKQWTYLNDELFIP--SRPKLQSDLGTCKEIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPPGQDNLLHVKLETKYKFPININKYNSKIDCFDP-NAHIEYPSL-KSAKVLEFYQYPGELLIIPTGWFHQV 1240
            PV+I  C   W A++KWT +   K +  +    K   D    +  M +  Y++++         Y+ D  F     R KL  D    K   +D FQ      RP + + + G   S + +H+DP   +  N +I G K+W LFP      L      K    +   + +  I  F       + PS  +  + +E  Q  GE + +P GW+H V
Sbjct:   74 PVVIRGCTDGWLALEKWTLARLAKKYRNQ--KFKCGEDNEGYSVKMKMKYYVEYMQSTRDDSPLYIFDSSFGEHHRRRKLLDDYVVPKYFRDDLFQYCGENRRPPYRWFVMGPARSGTGIHIDPLGTSAWNTLIRGHKRWCLFPTQTPKEL-----LKVTSAMGGKQRDEAITWFSTIYPRTQLPSWPEQYRPIEVLQGAGETVFVPGGWWHVV 280          
BLAST of JmjC domain-containing protein vs. Ensembl Fly
Match: PSR (gene:FBgn0038948 transcript:FBtr0084239)

HSP 1 Score: 63.1586 bits (152), Expect = 2.799e-10
Identity = 55/214 (25.70%), Postives = 88/214 (41.12%), Query Frame = 2
Query:  611 PVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKTMADGVSENFAMPLDIYMQHLHKGYPKQWTYLNDELFIP--SRPKLQSDLGTCKEIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPPGQDNLLHVKLETKYKFPININKYNSKIDCFDP-NAHIEYPSL-KSAKVLEFYQYPGELLIIPTGWFHQV 1240
            PV+I  C   W A++KWT +   K +  +    K   D    +  M +  Y++++         Y+ D  F     R KL  D    K   +D FQ      RP + + + G   S + +H+DP   +  N +I G K+W LFP      L      K    +   + +  I  F       + PS  +  + +E  Q  GE + +P GW+H V
Sbjct:   74 PVVIRGCTDGWLALEKWTLARLAKKYRNQ--KFKCGEDNEGYSVKMKMKYYVEYMQSTRDDSPLYIFDSSFGEHHRRRKLLDDYVVPKYFRDDLFQYCGENRRPPYRWFVMGPARSGTGIHIDPLGTSAWNTLIRGHKRWCLFPTQTPKEL-----LKVTSAMGGKQRDEAITWFSTIYPRTQLPSWPEQYRPIEVLQGAGETVFVPGGWWHVV 280          
BLAST of JmjC domain-containing protein vs. Ensembl Fly
Match: JMJD7 (gene:FBgn0036366 transcript:FBtr0075825)

HSP 1 Score: 59.3066 bits (142), Expect = 3.107e-9
Identity = 68/273 (24.91%), Postives = 109/273 (39.93%), Query Frame = 2
Query:  572 SIEEYRDIYSGKWPVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKTM----ADGVS-----ENFAMPLDIYMQ-------------HLHKGYPKQWTYLNDELFIPSRPKLQSDLGTCK-EIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPPGQDNLLHVKLETKYKFPININKYNS----------------------KIDCFDPNAHIEYPSLKSAKVLEFYQYPGELLIIPTGWFHQVKFTSK 1255
            ++E  R+ YS   PV+I    + WPA+ KWT  Y +++ G   V V       ADG++     E F +PL+  M+              +H    KQ + L+ +L     P+L +DL     +  +  F   P  +  W      G   + + +H DPY       VISG K + L PP Q     +    +  +P  + K +                        +D   P+   +YP    AK L+   + G++L +P  WFH V  + K
Sbjct:   33 ALEFCREFYSKNQPVVIRK-ALNWPAIGKWTPKYLIEALGDRSVDVAITPNGYADGLATQNGQEYFVLPLETKMKLSEVVRRLDDPTGAVHY-IQKQNSNLSVDL-----PELAADLRVSDLDFAQQSFNKPPDAVNFW-----LGDERAVTSMHKDPYE--NVYCVISGHKDFVLIPPHQ-----LSCVPRGIYPTGVYKTSDSGQFYIEPLRDEEGSDQFTEWVSVDPLSPDL-AKYPEYARAKPLKVRVHAGDILYLPNYWFHHVSQSHK 285          
BLAST of JmjC domain-containing protein vs. Ensembl Zebrafish
Match: jmjd6 (jumonji domain containing 6, arginine demethylase and lysine hydroxylase [Source:NCBI gene;Acc:266962])

HSP 1 Score: 72.0182 bits (175), Expect = 4.136e-13
Identity = 73/301 (24.25%), Postives = 124/301 (41.20%), Query Frame = 2
Query:  509 VNMKKYKFNYSWTDIDRRGDLSIEEYRDIYSGKW-PVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKTMADGVSENFAMPLDIYMQHLHKGYPKQWTYLNDELF--IPSRPKLQSDLGTCKEIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPPGQDNLLHVKLE-TKYKFPININKYNSKIDCFDPNAHIEYPSLKSA------KVLEFYQYPGELLIIPTGWFHQVKFTSKPLKSVAGQLMNSENYLYVLEEIFKGGDLQRGPYYSDLKNKSP 1381
            ++ +  K N    D+ R   LS EE+   +   + PV++ +    WPA +KWT     + +  +        DG S    M +  Y+++L   +     Y+ D  F     R KL  D        +D FQ    + RP + + + G   S + +H+DP   +  N ++ G K+W LFP       H   E  K       N+ +  I  F+    + YP  + +      + LE  Q PGE + +P GW+H V      + +V     ++ N+  V  +  +G       +Y  LK + P
Sbjct:   37 LSHRSVKDNVERADVQR---LSPEEFIQRFEKPYKPVVLLNVEDSWPAREKWTLERLKRKYRNQKFKCGEDNDGYS--VKMKMKYYVEYLESTHDDSPLYIFDSSFGEHAKRRKLLEDYQVPLFFRDDLFQFAGEKRRPPYRWFVMGPARSGTGIHIDPLGTSAWNALVQGHKRWCLFP------THTPRELIKVTRDEGGNQQDEAITWFN----VIYPRTQQSTWPDEFRPLEILQRPGETVFVPGGWWHVVLNLDTTI-AVTQNFASTTNFPIVWHKTVRGRPKLSRKWYRILKQERP 321          
BLAST of JmjC domain-containing protein vs. Ensembl Zebrafish
Match: jmjd7 (jumonji domain containing 7 [Source:ZFIN;Acc:ZDB-GENE-050417-86])

HSP 1 Score: 60.8474 bits (146), Expect = 1.288e-9
Identity = 68/253 (26.88%), Postives = 104/253 (41.11%), Query Frame = 2
Query:  584 YRDIYSGKWPVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKT----MADGVSEN-FAMP----------LDIYMQHLHKG----YPKQWTYLNDELFIPSRPKLQSDLGTCKEIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPPGQDNLLHVKL--ETKYK------FPININKYNS------KIDCFDPNAHIEYPSLKSAKVLEFYQYPGELLIIPTGWFHQVK 1243
            YRD      P II +    WPA+ KW  +Y  +  G ++++V       AD V+ N F MP          LDI    +         KQ + L +E+     P+L  D+ T    M +     P  +  W      G   + + +H D Y       VISG K++ L PP     +  +L     Y+      F I +++ NS       +D   P+    +PS + AK L      GE+L +P+ WFH V+
Sbjct:   37 YRDWIGPNKPCIIRNAFNDWPALSKWNPTYLREKVGSKVISVAVTPNGFADAVNGNRFVMPEERQMSFSSLLDIVEGKIKSSAVFYVQKQCSNLMEEI-----PELTGDVQTHIPWMSEALGKLPDAVNFW-----LGEESAVTSMHKDHYE--NLYCVISGQKEFVLLPPTDRPFIPYELYQPATYRQKDDGTFEI-VDEENSPKVPWIPLDPLKPDFE-RFPSYRHAKALHCTVKAGEMLYLPSLWFHHVR 275          
BLAST of JmjC domain-containing protein vs. Ensembl Xenopus
Match: jmjd6 (jumonji domain containing 6 [Source:NCBI gene;Acc:548957])

HSP 1 Score: 77.411 bits (189), Expect = 1.350e-14
Identity = 73/295 (24.75%), Postives = 119/295 (40.34%), Query Frame = 2
Query:  569 LSIEEYRDIYSGKW-PVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKTMADGVSENFAMPLDIYMQHLHKGYPKQWTYLNDELF--IPSRPKLQSDLGTCKEIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPPGQDNLLHVKLETKYKFPININKYNSKIDCFDPNAHIEYPSLK------SAKVLEFYQYPGELLIIPTGWFHQVKFTSKPLKSVAGQLMNSENYLYVLEEIFKGGDLQRGPYYSDLKNKSPQEKVKEVLLGITEKT 1426
             +IEE+ + Y   + PV+I +    WPA +KWT     + +  +        DG S    M +  Y+++L         Y+ D  +   P R KL  D    K   +D FQ    + RP + + + G   S + +H+DP   +  N ++ G K+W LFP      L      K       N+ +  I  F     + YP  +        K LE  Q PGE + +P GW+H V      + +V     +  N+  V  +  +G       +Y  LK + P+       + + E T
Sbjct:   54 FTIEEFIERYEKPYKPVVILNATADWPAQEKWTLERLKRKYRNQKFKCGEDNDGYS--VKMKMKYYIEYLEGTRDDSPLYIFDSSYGEHPKRKKLLEDYEVPKYFRDDLFQFAGEKRRPPYRWFVMGPARSGTGIHIDPLGTSAWNSLVHGHKRWCLFPTNVPREL-----IKVTRDEGGNQQDEAITWFT----VIYPRTQLPSWPPDFKPLEILQKPGETVFVPGGWWHVVLNLDTAI-AVTQNFASCSNFPVVWHKTVRGRPKLSRKWYRILKQERPELAALADTVDLQEST 336          
BLAST of JmjC domain-containing protein vs. Ensembl Xenopus
Match: jmjd7 (jumonji domain containing 7 [Source:NCBI gene;Acc:496732])

HSP 1 Score: 57.3806 bits (137), Expect = 2.463e-8
Identity = 72/262 (27.48%), Postives = 102/262 (38.93%), Query Frame = 2
Query:  584 YRDIYSGKWPVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKTM----ADGVSEN-FAMP----------LDI-----------YMQHLHKGYPKQWTYLNDELFIPSRPKLQSDLGTCKEIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPPG----------QDNLLHVKLETKYKFPININKYNSK------IDCFDPNAHIEYPSLKSAKVLEFYQYPGELLIIPTGWFHQVK 1243
            +RD  S   P II +    WPA+ KWT  Y     G + V+V       AD V +N F MP          LDI           Y+Q       KQ + L +E      P+L  D+      M +     P  +  W      G   + + LH D Y       VISG K + L PP           Q    HV  +  +K    ++  +++      +D  +P+  I YPS K  K L      GE+L +P+ WFH V+
Sbjct:   41 HRDWVSPNRPCIIRNAFTHWPALHKWTFGYLRTHIGSKKVSVAVTPNGYADAVYKNRFVMPEERTMFLSDFLDIVEKKSNTPGVFYIQ-------KQCSNLTEEF-----PELVEDVENHIPWMSETLGKSPDAVNFW-----LGESAAITSLHKDHYE--NLYCVISGEKHFILHPPSDRPFIPYEMFQPATYHVYEDGSFKV---VDHESAEKVPWIPLDPLEPDL-IRYPSYKQTKPLHCTVRAGEMLYLPSLWFHHVR 279          
BLAST of JmjC domain-containing protein vs. Ensembl Xenopus
Match: lman2 (lectin, mannose-binding 2 [Source:Xenbase;Acc:XB-GENE-5934286])

HSP 1 Score: 50.8322 bits (120), Expect = 4.371e-6
Identity = 34/109 (31.19%), Postives = 54/109 (49.54%), Query Frame = 2
Query:  926 FLLWGTRYSRSHLHMD---PYNWTGTNMVISGLKQWKLFPPGQDNLLHVKLETKYKFPININKYNSKIDCFDPNAHIEYPSL-KSAKVLEFYQYPGELLIIPTGWFHQV 1240
            F+  G + S +  H D    Y+W+     + G K+W LFPPGQ+  L    ++    P ++     +    DP   I+YP L +  +  E  Q  G+++ IP+GW HQV
Sbjct:  155 FVYMGPKGSWTPFHADVFRSYSWSAN---VCGRKKWLLFPPGQEEHLR---DSHGNLPYDVTSAGLR----DP---IQYPHLSQCCRPSEVIQEAGQVIFIPSGWHHQV 250          
BLAST of JmjC domain-containing protein vs. Ensembl Xenopus
Match: lman2 (lectin, mannose-binding 2 [Source:Xenbase;Acc:XB-GENE-5934286])

HSP 1 Score: 50.447 bits (119), Expect = 4.894e-6
Identity = 34/109 (31.19%), Postives = 54/109 (49.54%), Query Frame = 2
Query:  926 FLLWGTRYSRSHLHMD---PYNWTGTNMVISGLKQWKLFPPGQDNLLHVKLETKYKFPININKYNSKIDCFDPNAHIEYPSL-KSAKVLEFYQYPGELLIIPTGWFHQV 1240
            F+  G + S +  H D    Y+W+     + G K+W LFPPGQ+  L    ++    P ++     +    DP   I+YP L +  +  E  Q  G+++ IP+GW HQV
Sbjct:  155 FVYMGPKGSWTPFHADVFRSYSWSAN---VCGRKKWLLFPPGQEEHLR---DSHGNLPYDVTSAGLR----DP---IQYPHLSQCCRPSEVIQEAGQVIFIPSGWHHQV 250          
BLAST of JmjC domain-containing protein vs. Ensembl Xenopus
Match: lman2 (lectin, mannose-binding 2 [Source:Xenbase;Acc:XB-GENE-5934286])

HSP 1 Score: 50.447 bits (119), Expect = 4.974e-6
Identity = 34/109 (31.19%), Postives = 54/109 (49.54%), Query Frame = 2
Query:  926 FLLWGTRYSRSHLHMD---PYNWTGTNMVISGLKQWKLFPPGQDNLLHVKLETKYKFPININKYNSKIDCFDPNAHIEYPSL-KSAKVLEFYQYPGELLIIPTGWFHQV 1240
            F+  G + S +  H D    Y+W+     + G K+W LFPPGQ+  L    ++    P ++     +    DP   I+YP L +  +  E  Q  G+++ IP+GW HQV
Sbjct:  155 FVYMGPKGSWTPFHADVFRSYSWSAN---VCGRKKWLLFPPGQEEHLR---DSHGNLPYDVTSAGLR----DP---IQYPHLSQCCRPSEVIQEAGQVIFIPSGWHHQV 250          
BLAST of JmjC domain-containing protein vs. Ensembl Mouse
Match: Jmjd6 (jumonji domain containing 6 [Source:MGI Symbol;Acc:MGI:1858910])

HSP 1 Score: 75.0998 bits (183), Expect = 5.790e-14
Identity = 72/296 (24.32%), Postives = 124/296 (41.89%), Query Frame = 2
Query:  569 LSIEEYRDIYSGKW-PVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKTMADGVSENFAMPLDIYMQHLHKGYPKQWTYLNDELF--IPSRPKLQSDLGTCKEIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPPGQ-DNLLHVKLETKYKFPININKYNSKIDCFDPNAHIEYPSLK------SAKVLEFYQYPGELLIIPTGWFHQVKFTSKPLKSVAGQLMNSENYLYVLEEIFKGGDLQRGPYYSDLKNKSPQEKVKEVLLGITEKT 1426
            LS++E+ + Y   + PV++ +    W A +KWT     + +  +        DG S    M +  Y++++         Y+ D  +   P R KL  D    K   +D FQ    + RP + + + G   S + +H+DP   +  N ++ G K+W LFP      L+ V  E         N+ +  I  F+    + YP  +        K LE  Q PGE + +P GW+H V      + ++     +S N+  V  +  +G       +Y  LK + P+  V    + + E T
Sbjct:   54 LSVKEFVERYERPYKPVVLLNAQEGWSAQEKWTLERLKRKYRNQKFKCGEDNDGYS--VKMKMKYYIEYMESTRDDSPLYIFDSSYGEHPKRRKLLEDYKVPKFFTDDLFQYAGEKRRPPYRWFVMGPPRSGTGIHIDPLGTSAWNALVQGHKRWCLFPTNTPRELIKVTREE------GGNQQDEAITWFN----VIYPRTQLPTWPPEFKPLEILQKPGETVFVPGGWWHVVLNLDTTI-AITQNFASSTNFPVVWHKTVRGRPKLSRKWYRILKQEHPELAVLADAVDLQEST 336          
BLAST of JmjC domain-containing protein vs. Ensembl Mouse
Match: Jmjd6 (jumonji domain containing 6 [Source:MGI Symbol;Acc:MGI:1858910])

HSP 1 Score: 70.4774 bits (171), Expect = 7.211e-13
Identity = 65/264 (24.62%), Postives = 112/264 (42.42%), Query Frame = 2
Query:  569 LSIEEYRDIYSGKW-PVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKTMADGVSENFAMPLDIYMQHLHKGYPKQWTYLNDELF--IPSRPKLQSDLGTCKEIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPPGQDN-LLHVKLETKYKFPININKYNSKIDCFDPNAHIEYPSLK------SAKVLEFYQYPGELLIIPTGWFHQVKFTSKPLKSVAGQLMNSENYLYVLEEIFKG 1330
            LS++E+ + Y   + PV++ +    W A +KWT     + +  +        DG S    M +  Y++++         Y+ D  +   P R KL  D    K   +D FQ    + RP + + + G   S + +H+DP   +  N ++ G K+W LFP      L+ V  E         N+ +  I  F+    + YP  +        K LE  Q PGE + +P GW+H V      + ++     +S N+  V  +  +G
Sbjct:    6 LSVKEFVERYERPYKPVVLLNAQEGWSAQEKWTLERLKRKYRNQKFKCGEDNDGYS--VKMKMKYYIEYMESTRDDSPLYIFDSSYGEHPKRRKLLEDYKVPKFFTDDLFQYAGEKRRPPYRWFVMGPPRSGTGIHIDPLGTSAWNALVQGHKRWCLFPTNTPRELIKVTREE------GGNQQDEAITWFN----VIYPRTQLPTWPPEFKPLEILQKPGETVFVPGGWWHVVLNLDTTI-AITQNFASSTNFPVVWHKTVRG 256          
BLAST of JmjC domain-containing protein vs. Ensembl Mouse
Match: Jmjd6 (jumonji domain containing 6 [Source:MGI Symbol;Acc:MGI:1858910])

HSP 1 Score: 70.4774 bits (171), Expect = 8.628e-13
Identity = 65/264 (24.62%), Postives = 112/264 (42.42%), Query Frame = 2
Query:  569 LSIEEYRDIYSGKW-PVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKTMADGVSENFAMPLDIYMQHLHKGYPKQWTYLNDELFI--PSRPKLQSDLGTCKEIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPPGQDN-LLHVKLETKYKFPININKYNSKIDCFDPNAHIEYPSLK------SAKVLEFYQYPGELLIIPTGWFHQVKFTSKPLKSVAGQLMNSENYLYVLEEIFKG 1330
            LS++E+ + Y   + PV++ +    W A +KWT     + +  +        DG S    M +  Y++++         Y+ D  +   P R KL  D    K   +D FQ    + RP + + + G   S + +H+DP   +  N ++ G K+W LFP      L+ V  E         N+ +  I  F+    + YP  +        K LE  Q PGE + +P GW+H V      + ++     +S N+  V  +  +G
Sbjct:   11 LSVKEFVERYERPYKPVVLLNAQEGWSAQEKWTLERLKRKYRNQKFKCGEDNDGYS--VKMKMKYYIEYMESTRDDSPLYIFDSSYGEHPKRRKLLEDYKVPKFFTDDLFQYAGEKRRPPYRWFVMGPPRSGTGIHIDPLGTSAWNALVQGHKRWCLFPTNTPRELIKVTREE------GGNQQDEAITWFN----VIYPRTQLPTWPPEFKPLEILQKPGETVFVPGGWWHVVLNLDTTI-AITQNFASSTNFPVVWHKTVRG 261          
BLAST of JmjC domain-containing protein vs. Ensembl Mouse
Match: Jmjd7 (jumonji domain containing 7 [Source:MGI Symbol;Acc:MGI:3845785])

HSP 1 Score: 61.6178 bits (148), Expect = 7.370e-10
Identity = 66/251 (26.29%), Postives = 97/251 (38.65%), Query Frame = 2
Query:  584 YRDIYSGKWPVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKTMADGVS-----ENFAMPLD--IYMQHL---------HKG---YPKQWTYLNDELFIPSRPKLQSDLGTCKEIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPPGQDNLLHVKLETKYKFPININKYNSKID----------CFDPNAH--IEYPSLKSAKVLEFYQYPGELLIIPTGWFHQVK 1243
            YRD      P II +    WPA++KW+ SY   + G   V+V    DG +     + F MP +  + + H+         H G     KQ + L  EL     P+L SD+ +      +     P  +  W      G   + + LH D Y       V+SG K + L PP     +   L T   + +        +D            DP A    +YPS   A+ L      GE+L +P  WFH V+
Sbjct:   42 YRDWVCPNRPCIIRNALQHWPALQKWSLSYLRATVGSTEVSVAVTPDGYADAVRGDRFVMPAERRLPISHVLDVLEGRAQHPGVLYVQKQCSNLPTEL-----PQLLSDIESHVPWASESLGKMPDAVNFW-----LGDASAVTSLHKDHYE--NLYCVVSGEKHFLLHPPSDRPFIPYNLYTPATYQLTEEGTFRVVDEEAMEKVPWIPLDPLAPDLTQYPSYSQAQALHCTVRAGEMLYLPALWFHHVQ 280          
BLAST of JmjC domain-containing protein vs. Ensembl Mouse
Match: Jmjd6 (jumonji domain containing 6 [Source:MGI Symbol;Acc:MGI:1858910])

HSP 1 Score: 60.8474 bits (146), Expect = 8.376e-10
Identity = 57/227 (25.11%), Postives = 96/227 (42.29%), Query Frame = 2
Query:  569 LSIEEYRDIYSGKW-PVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKTMADGVSENFAMPLDIYMQHLHKGYPKQWTYLNDELF--IPSRPKLQSDLGTCKEIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPPGQ-DNLLHVKLETKYKFPININKYNSKIDCFDPNAHIEYPSLK------SAKVLEFYQYPGELLIIP 1219
            LS++E+ + Y   + PV++ +    W A +KWT     + +  +        DG S    M +  Y++++         Y+ D  +   P R KL  D    K   +D FQ    + RP + + + G   S + +H+DP   +  N ++ G K+W LFP      L+ V  E         N+ +  I  F+    + YP  +        K LE  Q PGE + +P
Sbjct:   54 LSVKEFVERYERPYKPVVLLNAQEGWSAQEKWTLERLKRKYRNQKFKCGEDNDGYS--VKMKMKYYIEYMESTRDDSPLYIFDSSYGEHPKRRKLLEDYKVPKFFTDDLFQYAGEKRRPPYRWFVMGPPRSGTGIHIDPLGTSAWNALVQGHKRWCLFPTNTPRELIKVTREE------GGNQQDEAITWFN----VIYPRTQLPTWPPEFKPLEILQKPGETVFVP 268          
BLAST of JmjC domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9M9E8|FB92_ARATH (F-box protein At1g78280 OS=Arabidopsis thaliana OX=3702 GN=At1g78280 PE=2 SV=3)

HSP 1 Score: 97.0561 bits (240), Expect = 1.075e-19
Identity = 65/272 (23.90%), Postives = 126/272 (46.32%), Query Frame = 2
Query:  530 FNYSWTDIDRRGDLSIEEYRDIYSGKWPVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKTMADGVSENFAMPLDIYMQHLHKGYPKQWTYLNDELFIPSRPKLQSDLGTCKEIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPPGQDNLLHVKLETKYKFPININKYNSKIDCFDPNA----HIEYPSLKSA-KVLEFYQYPGELLIIPTGWFHQVKFTSKPLKSVAGQLMNSENYLYVLEEIFKG 1330
            F++   +++RR ++S++E+   Y  K PV+++     WPA   WT     + +G     +   +       +M    Y+ ++     +   Y+ D+ F  + P+L  D        ED+F++   E RP + +L+ G   S +  H+DP   +  N ++ G K+W L+PPG+  L            +++N+ +  +    P++       YP L    K +E    PGE + +P+GW+H +    +P  +V    +N EN+ +V  ++  G
Sbjct:  120 FSFDNGNVERRRNISLDEFSKEYDAKKPVLLSGLADSWPASNTWTIDQLSEKYGEVPFRISQRS---PNKISMKFKDYIAYMKTQRDEDPLYVFDDKFGEAAPELLKDYSVPHLFQEDWFEILDKESRPPYRWLIVGPERSGASWHVDPALTSAWNTLLCGRKRWALYPPGKVPL---------GVTVHVNEDDGDVSIDTPSSLQWWLDYYPLLADEDKPIECTLLPGETIYVPSGWWHCI-LNLEPTVAVTQNFVNKENFGFVCLDMAPG 378          
BLAST of JmjC domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6GND3|JMD6A_XENLA (Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6-A OS=Xenopus laevis OX=8355 GN=jmjd6-a PE=2 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 1.464e-15
Identity = 77/304 (25.33%), Postives = 125/304 (41.12%), Query Frame = 2
Query:  548 DIDRRGD--LSIEEYRDIYSGKW-PVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKTMADGVSENFAMPLDIYMQHLHKGYPKQWTYLNDELF--IPSRPKLQSDLGTCKEIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPPGQDNLLHVKLETKYKFPININKYNSKIDCFDPNAHIEYPSLK------SAKVLEFYQYPGELLIIPTGWFHQVKFTSKPLKSVAGQLMNSENYLYVLEEIFKGGDLQRGPYYSDLKNKSPQEKVKEVLLGITEKT 1426
            +++R  D  LSIEE+ D Y   + PV+I +    WPA +KWT     + +  +        DG S    M +  Y+ ++         Y+ D  +   P R KL  D    K   +D FQ    + RP + + + G   S + +H+DP   +  N ++ G K+W LFP      L      K       N+ +  I  F+    + YP  +        K LE  Q PGE + +P GW+H V      + +V     +  N+  V  +  +G       +Y  LK + P+       + + E T
Sbjct:   45 NVERADDAHLSIEEFIDRYEKPYKPVVIVNATADWPAQEKWTLERLKRKYRNQKFKCGEDNDGYS--VKMKMKYYIDYMEGTRDDSPLYIFDSSYGEHPKRKKLLEDYEVPKYFRDDLFQFAGEKRRPPYRWFVMGPARSGTGIHIDPLGTSAWNSLVHGHKRWCLFPTNTPREL-----IKVTRDEGGNQQDEAITWFN----VIYPRTQLPSWPPEFKPLEILQKPGETVFVPGGWWHVVLNLDTAI-AVTQNFASCSNFPVVWHKTVRGRPKLSRKWYRILKQERPELAALADTVDLQEAT 336          
BLAST of JmjC domain-containing protein vs. UniProt/SwissProt
Match: sp|Q58DS6|JMJD6_BOVIN (Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Bos taurus OX=9913 GN=JMJD6 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.053e-13
Identity = 74/296 (25.00%), Postives = 124/296 (41.89%), Query Frame = 2
Query:  569 LSIEEYRDIYSGKW-PVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKTMADGVSENFAMPLDIYMQHLHKGYPKQWTYLNDELFI--PSRPKLQSDLGTCKEIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPPGQ-DNLLHVKLETKYKFPININKYNSKIDCFDPNAHIEYPSLK------SAKVLEFYQYPGELLIIPTGWFHQVKFTSKPLKSVAGQLMNSENYLYVLEEIFKGGDLQRGPYYSDLKNKSPQEKVKEVLLGITEKT 1426
            LS+EE+ + Y   + PV++ +    W A +KWT     + +  +        DG S    M +  Y++++         Y+ D  +   P R KL  D    K   +D FQ    + RP + + + G   S + +H+DP   +  N ++ G K+W LFP      L+ V  E         N+ +  I  F+    I YP  +        K LE  Q PGE + +P GW+H V      + ++     +S N+  V  +  +G       +Y  LK + P+  V    + + E T
Sbjct:   54 LSVEEFVERYERPYKPVVLLNAQEGWSAQEKWTLERLKRKYRNQKFKCGEDNDGYS--VKMKMKYYIEYMESTRDDSPLYIFDSSYGEHPKRRKLLEDYKVPKFFTDDLFQYAGEKRRPPYRWFVMGPPRSGTGIHIDPLGTSAWNALVQGHKRWCLFPTSTPRELIKVTREE------GGNQQDEAITWFN----IIYPRTQLPTWPPEFKPLEILQKPGETVFVPGGWWHVVLNLDTTI-AITQNFASSTNFPVVWHKTVRGRPKLSRKWYRILKQEHPELAVLADSVDLQEST 336          
BLAST of JmjC domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5R6G2|JMJD6_PONAB (Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Pongo abelii OX=9601 GN=JMJD6 PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 3.236e-13
Identity = 72/295 (24.41%), Postives = 122/295 (41.36%), Query Frame = 2
Query:  569 LSIEEYRDIYSGKW-PVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKTMADGVSENFAMPLDIYMQHLHKGYPKQWTYLNDELF--IPSRPKLQSDLGTCKEIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPPGQDNLLHVKLETKYKFPININKYNSKIDCFDPNAHIEYPSLK------SAKVLEFYQYPGELLIIPTGWFHQVKFTSKPLKSVAGQLMNSENYLYVLEEIFKGGDLQRGPYYSDLKNKSPQEKVKEVLLGITEKT 1426
            LS+EE+ + Y   + PV++ +    W A +KWT     + +  +        DG S    M +  Y++++         Y+ D  +   P R KL  D    K   +D FQ    + RP + + + G   S + +H+DP   +  N ++ G K+W LFP      L      K       N+ +  I  F+    + YP  +        K LE  Q PGE + +P GW+H V      + ++     +S N+  V  +  +G       +Y  LK + P+  V    + + E T
Sbjct:   54 LSVEEFVERYERPYKPVVLLNAQEGWSAQEKWTLERLKRKYRNQKFKCGEDNDGYS--VKMKMKYYIEYMESTRDDSPLYIFDSSYGEHPKRRKLLEDYKVPKFFTDDLFQYAGEKRRPPYRWFVMGPPRSGTGIHIDPLGTSAWNALVQGHKRWCLFPTSTPREL-----IKVTRDEGGNQQDEAITWFN----VIYPRTQLPTWPPEFKPLEILQKPGETVFVPGGWWHVVLNLDTTI-AITQNFASSTNFPVVWHKTVRGRPKLSRKWYRILKQEHPELAVLADSVDLQEST 336          
BLAST of JmjC domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6NYC1|JMJD6_HUMAN (Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Homo sapiens OX=9606 GN=JMJD6 PE=1 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 3.236e-13
Identity = 72/295 (24.41%), Postives = 122/295 (41.36%), Query Frame = 2
Query:  569 LSIEEYRDIYSGKW-PVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKTMADGVSENFAMPLDIYMQHLHKGYPKQWTYLNDELF--IPSRPKLQSDLGTCKEIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPPGQDNLLHVKLETKYKFPININKYNSKIDCFDPNAHIEYPSLK------SAKVLEFYQYPGELLIIPTGWFHQVKFTSKPLKSVAGQLMNSENYLYVLEEIFKGGDLQRGPYYSDLKNKSPQEKVKEVLLGITEKT 1426
            LS+EE+ + Y   + PV++ +    W A +KWT     + +  +        DG S    M +  Y++++         Y+ D  +   P R KL  D    K   +D FQ    + RP + + + G   S + +H+DP   +  N ++ G K+W LFP      L      K       N+ +  I  F+    + YP  +        K LE  Q PGE + +P GW+H V      + ++     +S N+  V  +  +G       +Y  LK + P+  V    + + E T
Sbjct:   54 LSVEEFVERYERPYKPVVLLNAQEGWSAQEKWTLERLKRKYRNQKFKCGEDNDGYS--VKMKMKYYIEYMESTRDDSPLYIFDSSYGEHPKRRKLLEDYKVPKFFTDDLFQYAGEKRRPPYRWFVMGPPRSGTGIHIDPLGTSAWNALVQGHKRWCLFPTSTPREL-----IKVTRDEGGNQQDEAITWFN----VIYPRTQLPTWPPEFKPLEILQKPGETVFVPGGWWHVVLNLDTTI-AITQNFASSTNFPVVWHKTVRGRPKLSRKWYRILKQEHPELAVLADSVDLQEST 336          
BLAST of JmjC domain-containing protein vs. TrEMBL
Match: A0A1S3HCH1 (bifunctional arginine demethylase and lysyl-hydroxylase JMJD6-like OS=Lingula unguis OX=7574 GN=LOC106154044 PE=4 SV=1)

HSP 1 Score: 324.324 bits (830), Expect = 7.347e-102
Identity = 172/408 (42.16%), Postives = 256/408 (62.75%), Query Frame = 2
Query:  266 RRKNKNPSL--TEITILLFGMFGVPVFYFCYWTLISIYHWTIAFNTEQLLSAPPKSVSMDTAFNPFYFNPLSISIKEIIENRLVNMKKYKFNYSWTDIDRRGDLSIEEYRDIYSGKWPVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKTMADGV---SENFAMPLDIYMQHLHKGYPKQWTYLNDELFIPSRPKLQSDLGTCKEIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPPGQDNLLHVKLETKYKFPININKYNSKIDCFDPNAHIEYPSLKSAKVLEFYQYPGELLIIPTGWFHQVKFTSKPLKSVAGQLMNSENYLYVLEEIFKGGDLQRGPYYSDLKNKSPQEKVKEVLLGITEKTRTQGREATEFIYNQLK 1474
            +R+   P +    + +L+F +  VP+               +A+N + L     + +  +  F  F F+ LS      +  R +NMKKY +NYS T ID+R +LS +E+ D+Y G WPVIITD   KW A   W+K + +K +G++ +T+K + DG    +E+ A+PL++Y +H H+G  ++WTY+ DELFIP+RP+L+ D+G C+ + EDYFQ+FP E+RPW + LLWGT +SRS LH+DPYNWTGTN VI G KQWKL PPGQD+LL+VK      FP+  +KYNS +D +D + +  YP +     +E  Q PGELLIIP GWFHQ  +  +   +V+ Q+MNS NY  VLEEI K G++ R  +   L   SPQE+V+EV+  + ++   +G+  T+ + +Q++
Sbjct:   47 KRQKHEPHIHWDRLCLLVFTVVNVPL---------------LAWNWKHLKQKYLEYMEPEYEFKTFSFDHLSA-----LSQREMNMKKYAYNYSTTHIDKRANLSRQEFTDVYDGAWPVIITDVVPKWGAYH-WSKQFLLKYYGKDRITMKAV-DGRLDNAESLALPLELYFKHAHEGTFRRWTYVEDELFIPTRPQLRRDVGDCEYLKEDYFQLFPEEVRPWNAMLLWGTPHSRSSLHIDPYNWTGTNAVIKGRKQWKLIPPGQDHLLYVKEGKMSGFPLECHKYNSPVDLYDLDLNT-YPLVSQLVTIEVDQLPGELLIIPPGWFHQA-YNPEETLAVSSQVMNSVNYRVVLEEILKAGNVPRTGWNPSLPYSSPQEQVQEVMSRLPKQLLKRGQAVTDDMQDQIQ 430          
BLAST of JmjC domain-containing protein vs. TrEMBL
Match: A0A433TUQ1 (JmjC domain-containing protein (Fragment) OS=Elysia chlorotica OX=188477 GN=EGW08_006950 PE=4 SV=1)

HSP 1 Score: 301.982 bits (772), Expect = 7.009e-94
Identity = 147/295 (49.83%), Postives = 195/295 (66.10%), Query Frame = 2
Query:  539 SWTDIDRRGDLSIEEYRDIYSGKWPVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKTMADGVSENFAMPLDIYMQHLHKGYPKQWTYLNDELFIPSRPKLQSDLGTCKEIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPPGQDNLLHVKLETKYKFPININKYNSKIDCFDPN-AHIEYPSLKSAKVLEFYQYPGELLIIPTGWFHQVKFTSKPLKSVAGQLMNSENYLYVLEEIFKGGDLQRGPYYSDLKNKSPQEKVKEVLLGITE 1420
            S   +D+R  LS++E+ D+Y GKWPVI+TD    WPAM  WT  +F K +GR  VT+ T A+     F++PL+I++ HLH   P+ WTYL DELF+   PKL++ +     + ED+FQ+ P  +RPW   LLWGT +SRS LH+DPYNWTGTN VISGLK+WKL PPGQD LL V    +  FP+   KYNS++D FDP+ AH    SL   K LE  Q PGE+L IP GWFHQ    + P  +VAGQLMNS N+  VLEE+FKGG L+R    +++ N +P++ V+ V + + E
Sbjct:  120 SCGKVDKRQKLSLQEFHDVYDGKWPVIVTDVMSTWPAMN-WTADFFKKQYGRSRVTMTTYANSEKSGFSVPLEIFLDHLHMSTPRTWTYLQDELFLIQNPKLRAHILQPIYVEEDFFQLLPASVRPWDCMLLWGTAHSRSSLHIDPYNWTGTNAVISGLKRWKLLPPGQDKLLSVTPGRRCGFPLECVKYNSELDLFDPDQAH----SLSKIKYLEVDQGPGEMLFIPPGWFHQAN-NAVPTLAVAGQLMNSNNFQTVLEEMFKGGSLERSSLPNNIDNMAPEDVVRSVEITLVE 408          
BLAST of JmjC domain-containing protein vs. TrEMBL
Match: A0A1I8IRL8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 322.013 bits (824), Expect = 7.308e-93
Identity = 142/311 (45.66%), Postives = 204/311 (65.59%), Query Frame = 2
Query:  551 IDRRGDLSIEEYRDIYSGKWPVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKTMADGV--SENFAMPLDIYMQHLHKGYPKQWTYLNDELFIPSRPKLQSDLGTCKEIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPPGQDNLLHVKLETKYKFPININKYNSKIDCFDPNAHIEYPSLKSAKVLEFYQYPGELLIIPTGWFHQVKFTSKPLKSVAGQLMNSENYLYVLEEIFKGGDLQRGPYYSDLKNKSPQEKVKEVLLGITEKTRTQGREATEFIYNQLKQ 1477
            I+RR  LS+EE+   Y  KWPV+I DC  +WPA + W + +F   +G   VT+  ++  +  ++  A+P  +++ HL++  P  WTYL DELF+P+RP+L + +GTC  + ED+F ++P   RPWW+FLLWGTRYSRS LH+DPYNWTGTN V+ G K+WKL+PPGQD+LL+ +     K+P+   KYNS  D FDP A   +P L  AK LEF Q PGELLIIPTGWFHQ  F  +P  +++GQLMN  NY  VLEE+ K G+  R  Y ++ ++ SP ++ +E L  +      +    T+ + +Q+++
Sbjct: 1350 IERRNGLSLEEFYRDYDAKWPVLIADCVPEWPAAQLWNEEFFNTRYGSARVTMSAVSGRLDNAQQLALPFGMFISHLNQSSPTSWTYLQDELFLPTRPELLAQVGTCAPLREDFFSLYPETTRPWWAFLLWGTRYSRSQLHIDPYNWTGTNAVLRGRKRWKLYPPGQDHLLYPRGVYTGKYPLRSRKYNSYADAFDPQAADRFPLLAQAKCLEFVQQPGELLIIPTGWFHQA-FNEEPTLAISGQLMNRGNYRAVLEELAKAGNFPRDGYPANFESLSPAKQTQECLARLYPSAMAEAAATTKDVLDQVER 1659          
BLAST of JmjC domain-containing protein vs. TrEMBL
Match: A0A2T7P818 (JmjC domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_08818 PE=4 SV=1)

HSP 1 Score: 278.485 bits (711), Expect = 7.791e-85
Identity = 147/351 (41.88%), Postives = 213/351 (60.68%), Query Frame = 2
Query:  422 KSVSMDTAFNPFYFNPLSISIKEIIENRLVNMKKYKFNYSWTDIDRRGDLSIEEYRDIYSGKWPVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKTMADGVSENFAMPLDIYMQHLHKGYPKQWTYLNDELFIPSRPKLQSDLGTCKEIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPPGQDNLLHVKLETKYKFPININKYNSKIDCFDPNAHIEYPSLKSAKVLEFYQYPGELLIIPTGWFHQVKFTSKPLKSVAGQLMNSENYLYVLEEIFKGGDLQRGPYYSDLKNKSPQEKVKEVLLGITEKTRTQGREATEFIYNQLK 1474
            K + + T  +P Y      ++KE    R   +KKYK +   T ++RR +LS++E+ D+Y  KWPVIITD    WPA  KWT  +F  ++G E V    +    SE F++PL  ++++++   P  W Y+ DE+FI SRP+L   +       ED+F++FP EIRPW   LLWG+ YS+S LH+DPYNWTGTN VI G K+WKLFPPGQD+LL+V  E    FP+   KYNS I+ F P+   +YP    A  +E  Q  GE+LIIPTGWFHQV  T + L +++ Q+MN  NY YVL+EI K G+L       +  N SP+ +V+ ++  + ++   +G + ++   N +K
Sbjct:   48 KKLPIQTDKHPEYVLDFQAALKE----REEQLKKYKHDLQTTGVERRSNLSLQEFWDLYDAKWPVIITDVVNTWPA-SKWTTEFFNLTYGNENVATSIVEGTTSEGFSVPLHGFIKYINYATPTSWMYVMDEVFIVSRPELHKQILPSIYTEEDFFKLFPKEIRPWDCMLLWGSAYSQSPLHIDPYNWTGTNAVIKGTKKWKLFPPGQDHLLYVIPEAMCGFPLECYKYNSPINTFAPD-QTQYPLYNLATYIEVEQKAGEMLIIPTGWFHQVYNTEETL-AISNQVMNRNNYRYVLKEILKAGNLLHKHLPDNFHNLSPKHQVRILMSLLPKRVLQEGEKRSQDYINSIK 391          
BLAST of JmjC domain-containing protein vs. TrEMBL
Match: A0A210R763 (JmjC domain-containing protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT21679 PE=4 SV=1)

HSP 1 Score: 278.485 bits (711), Expect = 1.939e-84
Identity = 145/345 (42.03%), Postives = 217/345 (62.90%), Query Frame = 2
Query:  452 PFYFNPLSISIKEIIENRLVNMKKYKF-NYSWTDIDRRGDLSIEEYRDIYSGKWPVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKTMADGV--SENFAMPLDIYMQHLHKGYPKQWTYLNDELFIPSRPKLQSDLGTCKEIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPPGQDNLLHVKLETKYKFPININKYNSKIDCFDPNAHIEYPSLKSAKVLEFYQYPGELLIIPTGWFHQVKFTSKPLKSVAGQLMNSENYLYVLEEIFKGGDLQRGPYYSDLKNKSPQEKVKEVLLGITEKTRTQGREATEFIYNQLKQ 1477
            P+ FN   +++KE    R  N++ Y+   ++W  ++RR  LS+ E+ D Y  KWPVI+TD   KWPA+  WTK  F++ +G+E V +K +  G+  +   A+PL++++ HL++     WTYL DELF+  RP+L+ D+G  +   E++F +FP  +RPW   +LWGT +SRS LHMDPYNWTG + V+ G K+WKL PPGQD+LL+V  E +  FP+   KYNS ID FD +   +YP  K  +VLE   Y GE+LIIPTGW+HQ  F  +   +++ Q+MN  NYL +LEEI K G+L+R    +      P ++VK ++  + +K    G + T+ I  Q+K+
Sbjct:   72 PYTFNH-EMAMKE----REYNLEYYQRPQHNWK-VERRSGLSVSEFFDTYDAKWPVILTDVVSKWPAIN-WTKEVFIQKYGKERVVMKAVVGGLQHATGHALPLEVFIDHLNEASFDTWTYLEDELFLVMRPELRKDIGQNEYAEENFFNLFPEMVRPWDCMMLWGTAHSRSTLHMDPYNWTGISAVLQGHKKWKLIPPGQDHLLYVDPEARCGFPLECRKYNSPIDAFDVDTK-KYPRFKRLQVLEADVYSGEMLIIPTGWYHQA-FNVEQTLALSQQMMNRNNYLAILEEIIKAGNLKRKKLPTYFSTLLPPDQVKVLMSLLPKKVLQHGHDVTKDILEQIKK 407          
BLAST of JmjC domain-containing protein vs. Ensembl Cavefish
Match: jmjd6 (jumonji domain containing 6, arginine demethylase and lysine hydroxylase [Source:NCBI gene;Acc:103029547])

HSP 1 Score: 70.4774 bits (171), Expect = 1.171e-12
Identity = 63/266 (23.68%), Postives = 107/266 (40.23%), Query Frame = 2
Query:  611 PVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKTMADGVSENFAMPLDIYMQHLHKGYPKQWTYLNDELF--IPSRPKLQSDLGTCKEIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPPGQDNLLHVKLE-TKYKFPININKYNSKIDCFDPNAHIEYPSLKSA------KVLEFYQYPGELLIIPTGWFHQVKFTSKPLKSVAGQLMNSENYLYVLEEIFKGGDLQRGPYYSDLKNKSP 1381
            PV++ +C   WP  +KWT     + +  +        DG S    M +  Y++++         Y+ D  +     R KL  D        +D FQ    + RP + + + G   S + +H+DP   +  N ++ G K+W LFP       H   E  K       N+ +  I  F     + YP  +        + LE  Q+PGE + +P GW+H V      + +V     ++ N+  V  +  +G       +Y  LK + P
Sbjct:   69 PVVLLNCQESWPGREKWTLERLKRKYRNQKFKCGEDNDGYS--VKMKMKYYVEYMESSRDDSPLYIFDSSYGEHAKRRKLLEDYQVPVFFRDDLFQFAGEKRRPPYRWFVMGPARSGTGIHIDPLGTSAWNALVQGHKRWCLFP------THTPRELIKVTRDEGGNQQDEAITWFS----VIYPRTQQPTWPAEFRPLEILQHPGETVFVPGGWWHVVLNLDTAI-AVTQNFASTTNFPIVWHKTVRGRPKLSRKWYRILKQERP 321          
BLAST of JmjC domain-containing protein vs. Ensembl Cavefish
Match: jmjd7 (jumonji domain containing 7 [Source:NCBI gene;Acc:103032045])

HSP 1 Score: 60.4622 bits (145), Expect = 1.363e-9
Identity = 71/267 (26.59%), Postives = 110/267 (41.20%), Query Frame = 2
Query:  563 GDLS-IEEYRDIYSGKWPVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKTMADGVS-----ENFAMP----------LDI-----------YMQHLHKGYPKQWTYLNDELFIPSRPKLQSDLGTCKEIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPPGQDNLLHVKL--ETKYK------FPININKYNSKI-----DCFDPNAHIEYPSLKSAKVLEFYQYPGELLIIPTGWFHQVK 1243
            G LS ++ YRD  S   P II +    WPA+ KW  +Y     G ++++V    +G +     + F +P          LDI           Y+Q       KQ + L +EL     P+L  D+ T    M +     P  +  W      G  ++ + +H D Y       VISG K++ L PP     +  +L     YK      F I   + + K+     D  +P+    YPS + A+ L      GE+L +P+ WFH V+
Sbjct:   39 GSLSPLQFYRDWISPNKPCIIRNAFSDWPALSKWNPAYLRDVVGSKVISVAVTPNGYADAVNGDRFVIPEERQMTFSSLLDIIEGKEKSNGVFYVQ-------KQCSNLTEEL-----PELTGDVQTHIPWMSEALGKLPDAVNFW-----LGEEHAVTSMHKDHYE--NLYCVISGEKRFILIPPTDRPFIPYELYQPATYKQKQDGSFEIVDEEDSEKVPWIPLDPLNPDLE-RYPSYRLAQPLYCTVKAGEMLYLPSLWFHHVR 285          
BLAST of JmjC domain-containing protein vs. Ensembl Cavefish
Match: jmjd7 (jumonji domain containing 7 [Source:NCBI gene;Acc:103032045])

HSP 1 Score: 60.4622 bits (145), Expect = 1.419e-9
Identity = 71/267 (26.59%), Postives = 110/267 (41.20%), Query Frame = 2
Query:  563 GDLS-IEEYRDIYSGKWPVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKTMADGVS-----ENFAMP----------LDI-----------YMQHLHKGYPKQWTYLNDELFIPSRPKLQSDLGTCKEIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPPGQDNLLHVKL--ETKYK------FPININKYNSKI-----DCFDPNAHIEYPSLKSAKVLEFYQYPGELLIIPTGWFHQVK 1243
            G LS ++ YRD  S   P II +    WPA+ KW  +Y     G ++++V    +G +     + F +P          LDI           Y+Q       KQ + L +EL     P+L  D+ T    M +     P  +  W      G  ++ + +H D Y       VISG K++ L PP     +  +L     YK      F I   + + K+     D  +P+    YPS + A+ L      GE+L +P+ WFH V+
Sbjct:   29 GSLSPLQFYRDWISPNKPCIIRNAFSDWPALSKWNPAYLRDVVGSKVISVAVTPNGYADAVNGDRFVIPEERQMTFSSLLDIIEGKEKSNGVFYVQ-------KQCSNLTEEL-----PELTGDVQTHIPWMSEALGKLPDAVNFW-----LGEEHAVTSMHKDHYE--NLYCVISGEKRFILIPPTDRPFIPYELYQPATYKQKQDGSFEIVDEEDSEKVPWIPLDPLNPDLE-RYPSYRLAQPLYCTVKAGEMLYLPSLWFHHVR 275          
BLAST of JmjC domain-containing protein vs. Ensembl Cavefish
Match: jmjd7 (jumonji domain containing 7 [Source:NCBI gene;Acc:103032045])

HSP 1 Score: 60.4622 bits (145), Expect = 1.419e-9
Identity = 71/267 (26.59%), Postives = 110/267 (41.20%), Query Frame = 2
Query:  563 GDLS-IEEYRDIYSGKWPVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKTMADGVS-----ENFAMP----------LDI-----------YMQHLHKGYPKQWTYLNDELFIPSRPKLQSDLGTCKEIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPPGQDNLLHVKL--ETKYK------FPININKYNSKI-----DCFDPNAHIEYPSLKSAKVLEFYQYPGELLIIPTGWFHQVK 1243
            G LS ++ YRD  S   P II +    WPA+ KW  +Y     G ++++V    +G +     + F +P          LDI           Y+Q       KQ + L +EL     P+L  D+ T    M +     P  +  W      G  ++ + +H D Y       VISG K++ L PP     +  +L     YK      F I   + + K+     D  +P+    YPS + A+ L      GE+L +P+ WFH V+
Sbjct:   29 GSLSPLQFYRDWISPNKPCIIRNAFSDWPALSKWNPAYLRDVVGSKVISVAVTPNGYADAVNGDRFVIPEERQMTFSSLLDIIEGKEKSNGVFYVQ-------KQCSNLTEEL-----PELTGDVQTHIPWMSEALGKLPDAVNFW-----LGEEHAVTSMHKDHYE--NLYCVISGEKRFILIPPTDRPFIPYELYQPATYKQKQDGSFEIVDEEDSEKVPWIPLDPLNPDLE-RYPSYRLAQPLYCTVKAGEMLYLPSLWFHHVR 275          
BLAST of JmjC domain-containing protein vs. Ensembl Sea Lamprey
Match: jmjd6 (jumonji domain containing 6, arginine demethylase and lysine hydroxylase [Source:NCBI gene;Acc:266962])

HSP 1 Score: 59.3066 bits (142), Expect = 9.967e-10
Identity = 66/279 (23.66%), Postives = 110/279 (39.43%), Query Frame = 2
Query:  575 IEEYRDIYSGKWPVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKTMADGVSENFAMPLDI-YMQHLHKGYPKQWTYLNDELFI--PSRPKLQSDLGTCKEIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPPGQ-DNLLHVKLETKYKFPININKYNSKIDCFDPNAHIEYPSLKSA------KVLEFYQYPGELLIIPTGWFHQVKFTSKPLKSVAGQLMNSENYLYVLEEIFKGGDLQRGPYYSDLKNKSP 1381
            IE+Y  +Y    P ++ +C   W A +KWT     + +  +        DG S    M   I Y++  +   P    Y+ D  F     + KL  D        +D F+    + RP + + + G   S + +H+DP   +  N ++ G K+W LFP      L+ V  E          + +  I  F     + YP  +        + LE  Q PGE + +P GW+H V      + +V     +  N+  V  +  +G       +Y  LK + P
Sbjct:   62 IEKYERLYK---PCVLLNCQKTWAANEKWTLDRLKRKYRNQKFKCGEDNDGYSVKLKMKYYIDYVETTNDDSP---LYIFDSSFGDHAKKGKLLEDYEIPVYFKDDLFKYAGEKRRPPYRWFVMGPARSGTGIHIDPLGTSAWNALVKGHKRWCLFPTNTPRELIKVAREE------GGIQQDEAITWFS----VIYPRTQEPSWPPEFRPLEILQKPGETVFVPGGWWHVVLNLENTI-AVTQNFASVTNFPVVWHKTVRGRPKLSRKWYRILKQEFP 323          
BLAST of JmjC domain-containing protein vs. Ensembl Nematostella
Match: EDO47823 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL91])

HSP 1 Score: 196.438 bits (498), Expect = 5.327e-58
Identity = 118/312 (37.82%), Postives = 158/312 (50.64%), Query Frame = 2
Query:  542 WTDIDRRGDLSIEEYRDIYSGKWPVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKTMADGVSENFAMPLDIYMQHLHKGYPKQWTYLNDELFIPSRPKLQSDLGTCKEIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPPGQDNLLHVKLETKYKFPININKYNSKIDCFDPNAHIEYPSLKSAKVLEFYQYPGELLIIPTGWFHQVKFTSKPLKSVAGQLMNSENYLYVLEEIFKGGDLQRGPYYSDLKNKSPQEKVKEVLLGITEKTRTQGREATEFIYNQLKQ 1477
            WT IDRR +LS+EE+   Y GK       C +    M +                        +E+ A+   ++ +H H+G P  WTY+ DELFI + P+L+  L     + ED+FQ FP ++RPW + LLWGT YSRS LH+DPYNWTGTN V SG K WK+ P                           +D F P+   ++P    AK L F Q  GELLIIPTGWFHQ  F  +   +V+ Q+MNS+NY   LEEIFK G++          N SP ++V  V   I      +GR+ TE +  QLK+
Sbjct:   91 WT-IDRRRNLSLEEFIQRYDGKRSS--ETCNVYGGTMNQ------------------------AESLAVNAKLFAEHAHEGKPWLWTYVEDELFIQTHPELKDHLQNPIYLKEDFFQFFPKDVRPWNAMLLWGTAYSRSSLHIDPYNWTGTNAVFSGKKMWKVHP---------------------------VDAFAPDLE-KFPLFLKAKALSFTQNAGELLIIPTGWFHQA-FNPEETIAVSSQIMNSQNYKICLEEIFKAGEVDLRKIPEGFDNLSPVDQVVTVTRLIPINVIRKGRQLTENLLKQLKK 346          
BLAST of JmjC domain-containing protein vs. Ensembl Nematostella
Match: EDO41023 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5J7])

HSP 1 Score: 60.8474 bits (146), Expect = 6.086e-10
Identity = 65/268 (24.25%), Postives = 108/268 (40.30%), Query Frame = 2
Query:  611 PVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKTMADGVSENFAMPL-DIYMQHLHKGYPKQWTYLNDELF--IPSRPKLQSDLGTCKEIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPP-GQDNLLHVKLETKYKFPININKYNSKIDCFDPNAHIEYPSLKSA------KVLEFYQYPGELLIIPTGWFHQVKFTSKPLKSVAGQLMNSENYLYVLEEIFKGGDLQRGPYYSDLKNKSPQ 1384
            PV++T     W A +KWT     +    +   V    DG +    M     Y+QH     P    Y+ D  F   P + KL  +    +   +D F+    + RP + + + G   S + +H+DP   +  N V+SG K+W +FP      +L V      K      + +  I  F    H+ YP  + +      K +E  Q PGE + +P GW+H V      + +V     +  N+  V  +  +G       +   LK + P+
Sbjct:   69 PVVLTHAIDHWQASRKWTLERLARKFRHQKFKVGEDDDGYAVKMKMKYYSEYIQHNKDDSP---LYIFDSSFGEHPVKKKLLEEYEVPRFFADDLFRYAGEKRRPPYRWFVMGPARSGTGIHIDPLGTSAWNSVVSGHKRWAMFPTFVPQEMLKVPSSEGGK------QRDEAITWF---THV-YPKTQLSSWPEEYKPVEVLQGPGETVFVPGGWWHVVVNLDAAI-AVTQNFSSPVNFPVVWHKTVRGRPKLSKKWLKRLKKQRPE 322          
BLAST of JmjC domain-containing protein vs. Ensembl Nematostella
Match: EDO45314 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT05])

HSP 1 Score: 59.6918 bits (143), Expect = 8.275e-10
Identity = 66/261 (25.29%), Postives = 98/261 (37.55%), Query Frame = 2
Query:  584 YRDIYSGKWPVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKTMADG-----VSENFAMP----------LDIYMQHLHKG----YPKQWTYLNDELFIPSRPKLQSDLGTCKEIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPPGQDNLL--------HVKLETKYKFPININKYNSK--------------IDCFDPNAHIEYPSLKSAKVLEFYQYPGELLIIPTGWFHQVK 1243
            YR+  +   PVII +    WPA+K W   Y  K  G + +TV    +G     V + F MP          LDI  + +         KQ +   DE       ++ SD  T      + F   P  +  W      G   + + +H DPY       VISG K++ L PP     +          K    Y+F I     NS+              +D  +P+    +P    A+ L      GE+L +P+ WFH V+
Sbjct:   40 YREWVAPNRPVIIRNAINHWPALKLWNSQYLKKCIGEKTITVAVTPNGYADAIVGDRFVMPEERLMKFGHFLDILEKRVEANGVFYVQKQNSNFTDEF-----SEIISDAETELPWASEAFGNTPDAVNFW-----MGDERAITSMHKDPYE--NLYCVISGYKKFNLIPPTDLPFIPYGLYKPSKYKSTNDYEFEIADIVENSELGDDESAQLVPWISVDPLEPDL-TRFPDFAKARPLSCTVQAGEMLYLPSLWFHHVQ 287          
BLAST of JmjC domain-containing protein vs. Ensembl Nematostella
Match: EDO44721 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV46])

HSP 1 Score: 50.8322 bits (120), Expect = 7.461e-7
Identity = 57/219 (26.03%), Postives = 86/219 (39.27%), Query Frame = 2
Query:  611 PVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKTMADGVSENFAMPLDIYMQHLHK----GYPKQWTYLNDELFIPSRPKLQSDLGTCKEIMEDYFQM----FPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPPGQDNLLHVKLETKYKFPININKYNSKIDCFDPNAHIEYPSLKSAKVLEFYQYPGELLIIPTGWFHQVK 1243
            PVI+      WPAM+KW   Y     G   V ++       E +   L    + + K        Q  YL         P+L+ D+     I+ DY  +      V I  W+     G + + S LH DPYN     +V  G K  +L+   Q + L       Y     +    S+ID   P+   ++P+   A   E    PG++L IP G +H V+
Sbjct:  190 PVILDGMMEAWPAMRKWGLEYLKDIAGYRTVPIELGLRYTDEEWTQKLMTISEFVDKYVSCSNSSQVAYLAQHQLFDQIPELRRDI-----IIPDYCCLGDDDRDVMINAWF-----GPKGTVSPLHHDPYNNLLAQVV--GEKYLRLYSKDQTDKL-------YPHETTLLHNTSQIDVEAPDL-AQFPAFYKASYQECILRPGQMLFIPPGHWHYVR 388          
BLAST of JmjC domain-containing protein vs. Ensembl Nematostella
Match: EDO45976 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRA5])

HSP 1 Score: 49.6766 bits (117), Expect = 2.243e-6
Identity = 62/263 (23.57%), Postives = 98/263 (37.26%), Query Frame = 2
Query:  509 VNMKKYKFNYSWTDIDRRGDLSIEEY-RDIYSGKWPVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVK--------------TMADGVSENFAMPLDIYMQHLHKGYPKQWTYLNDELFIPSRPKLQSDLGTCKEIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPPGQDNLLHVKLETKYKFPININKYNSKI------DCFDPNAHIEYPSLKSAKV-LEFYQYPGELLIIPTGWF 1231
            +NM  Y  +     I R  + S EE+  +  +   P IIT     WPAM  W    F K  G     VK              ++   ++ +   P  ++M   H  YP+    +      P                 DY Q    +I+P    L    + S  H  ++ YN +  + ++ G K+W L+PP               FP  +   N +       + F   AH + P L++ +   E  Q PGE+L IP+GW+
Sbjct:  179 INMSDYWPSSVHCTIKRVSNPSREEFLENFINPGIPAIITQAIDDWPAMTMWD---FDKLEGHLTKGVKVNILDHPSPYKRWNSLRQNLAASLRDPPQVHMTDFHTVYPQLMADVRQMDIFPDN--------------ADYMQFVDEDIKPAQLSLQMAPQRSGYHWRVEQYNGSLWSALVRGHKRWGLYPPS------------VYFPPGVVHNNHRAQDSQSSEPFTWWAHTQ-PRLRADRRPSECVQKPGEILYIPSGWW 411          
BLAST of JmjC domain-containing protein vs. Ensembl Medaka
Match: jmjd6 (jumonji domain containing 6, arginine demethylase and lysine hydroxylase [Source:NCBI gene;Acc:101161943])

HSP 1 Score: 69.707 bits (169), Expect = 2.024e-12
Identity = 65/266 (24.44%), Postives = 106/266 (39.85%), Query Frame = 2
Query:  611 PVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKTMADGVSENFAMPLDIYMQHLHKGYPKQWTYLNDELF--IPSRPKLQSDLGTCKEIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPPGQ-DNLLHVKLETKYKFPININKYNSKIDCFDPNAHIEYPSLKSA------KVLEFYQYPGELLIIPTGWFHQVKFTSKPLKSVAGQLMNSENYLYVLEEIFKGGDLQRGPYYSDLKNKSP 1381
            PV++  C   W A +KWT     + +  +        DG S    M +  YM++L         Y+ D  +     R KL  D        +D FQ    + RP + + + G   S + +H+DP   +  N ++ G K+W LFP      L+ V  E         N+ +  I  F     + YP  +        + LE  Q PGE + +P GW+H V      + +V     ++ N+  V  +  +G       +Y  LK + P
Sbjct:   69 PVVLLHCQDSWAAREKWTLERLKRKYRNQKFKCGEDNDGYS--VKMKMKYYMEYLESTKDDSPLYIFDSSYGEHAKRQKLLEDYEVPVFFRDDLFQFAGEKRRPPYRWFVMGPARSGTGIHIDPLGTSAWNALVQGHKRWCLFPTNTPRELIKVTREE------GGNQQDEAITWFS----VVYPRSQQPTWPQEFRPLEILQRPGETVFVPGGWWHVVLNLDTTI-AVTQNFASTTNFPIVWHKTVRGRPKLSRKWYRVLKQERP 321          
BLAST of JmjC domain-containing protein vs. Ensembl Medaka
Match: jmjd7 (jumonji domain containing 7 [Source:NCBI gene;Acc:101158565])

HSP 1 Score: 58.151 bits (139), Expect = 8.293e-9
Identity = 62/255 (24.31%), Postives = 104/255 (40.78%), Query Frame = 2
Query:  584 YRDIYSGKWPVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKTMADG-----VSENFAMP----------LDIYMQHLHKG----YPKQWTYLNDELFIPSRPKLQSDLGTCKEIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPPG----------QDNLLHVKLETKYKFPININKYNSK------IDCFDPNAHIEYPSLKSAKVLEFYQYPGELLIIPTGWFHQVK 1243
            YRD      P II D    W A+ +WT  Y  +  G ++++V    +G     V + F MP          LDI    + +       KQ + L  EL     P+L  D+      M       P  +  W      G   + + +H DPY       V+SG K++ L PP           Q  + H++ + +++    +++ +SK      +D  DP+    +P  + A+ +      GE+L +P+ WFH V+
Sbjct:   37 YRDWIGQNKPCIIRDAFRHWAALSRWTPEYLRQKIGSKVISVAVTPNGFADAVVGDRFVMPEERQMSVASVLDIIEGKVQEPGVFYVQKQCSNLLQEL-----PELLGDVEPDVSWMSAALGRSPDAVNFW-----LGDGNAVTSMHKDPYE--NLYCVVSGEKRFVLLPPTDRPFIPYDMYQPAIYHLRDDGEFEI---VDQGDSKKVPWIPLDPLDPDLE-RFPQYRWARPVCCSVKAGEMLYLPSLWFHHVR 275          
BLAST of JmjC domain-containing protein vs. Ensembl Medaka
Match: jmjd4 (jumonji domain containing 4 [Source:NCBI gene;Acc:101156282])

HSP 1 Score: 49.6766 bits (117), Expect = 5.270e-6
Identity = 31/108 (28.70%), Postives = 51/108 (47.22%), Query Frame = 2
Query:  926 FLLWGTRYSRSHLHMD---PYNWTGTNMVISGLKQWKLFPPGQDNLLHVKLETKYKFPININKYNSKIDCFDPNAHIEYPSLKSAKVLEFYQYPGELLIIPTGWFHQV 1240
            F+  G + S +  H D    Y+W+     I G K+W L+PPGQ++ L    +T    P ++     +     P         ++ + LE  Q  GE++ +P+GW HQV
Sbjct:  173 FVYMGPKGSWTPFHADVFRSYSWSAN---ICGRKKWLLYPPGQEDFLR---DTHGNLPYDVTSAELRDSGLFPRFE------EACQPLEIIQEAGEIMFVPSGWHHQV 268          
BLAST of JmjC domain-containing protein vs. Planmine SMEST
Match: SMESG000053108.1 (SMESG000053108.1)

HSP 1 Score: 840.877 bits (2171), Expect = 0.000e+0
Identity = 405/414 (97.83%), Postives = 407/414 (98.31%), Query Frame = 2
Query:  320 MFGVPVFYFCYWTLISIYHWTIAFNTEQLLSAPPKSVSMDTAFNPFYFNPLSISIKEIIENRLVNMKKYKFNYSWTDIDRRGDLSIEEYRDIYSGKWPVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKTMADGVSENFAMPLDIYMQHLHKGYPKQWTYLNDELFIPSRPKLQSDLGTCKEIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPPGQDNLLHVKLETKYKFPININKYNSKIDCFDPNAHIEYPSLKSAKVLEFYQYPGELLIIPTGWFHQVKFTSKPLKSVAGQLMNSENYLYVLEEIFKGGDLQRGPYYSDLKNKSPQEKVKEVLLGITEKTRTQGREATEFIYNQLKQLAESSGLPVPPSILDLINSQKHKTDNLP 1561
            MFGVPVFYFCYWTLISIYHWTIAFNTEQLLSAPPKSVSMDTAFNPFYFNPLSISIKEIIENRLVNMKKYKFNYSWTDIDRRGDLSIEEYRDIYSGKWPVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKTMADGVSENFAMPLDIYMQHLHKGYPKQWTYLNDELFIPSRPKLQSDLGTCKEIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPPGQDNLLHVKLETKYKFPININKYNSKIDCFDPNAHIEYPSLKSAKVLEFYQYPGELLIIPTGWFHQ  F  +   +VAGQLMNSENYLYVLEEIFKGGDLQRGPYYSDLKNKSPQEKVKEVLLGITEKTRTQGREATEFIYNQLKQLAESSGLPVPPSILDLINSQKHKTDNLP
Sbjct:    1 MFGVPVFYFCYWTLISIYHWTIAFNTEQLLSAPPKSVSMDTAFNPFYFNPLSISIKEIIENRLVNMKKYKFNYSWTDIDRRGDLSIEEYRDIYSGKWPVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKTMADGVSENFAMPLDIYMQHLHKGYPKQWTYLNDELFIPSRPKLQSDLGTCKEIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPPGQDNLLHVKLETKYKFPININKYNSKIDCFDPNAHIEYPSLKSAKVLEFYQYPGELLIIPTGWFHQA-FNEEITLAVAGQLMNSENYLYVLEEIFKGGDLQRGPYYSDLKNKSPQEKVKEVLLGITEKTRTQGREATEFIYNQLKQLAESSGLPVPPSILDLINSQKHKTDNLP 413          
BLAST of JmjC domain-containing protein vs. Planmine SMEST
Match: SMESG000022043.1 (SMESG000022043.1)

HSP 1 Score: 78.5666 bits (192), Expect = 2.228e-15
Identity = 73/281 (25.98%), Postives = 115/281 (40.93%), Query Frame = 2
Query:  560 RGDLSIEEYRDIYSGKW-PVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKTMADGVSENFAMPLDI-YMQHLHKGYPKQWTYLNDELF--IPSRPKLQSDLGTCKEIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPPGQ-DNLLHVKLETKYKFPININKYNSKI--DCFDPNAHIEYPSLKSAKVLEFYQYPGELLIIPTGWFHQVKFTSKPLKSVAGQLMNSENYLYVLEEIFKGGDLQRGPYYSDLKNKSP 1381
            R  +S +E+R  Y   + PV++ D    W A KKW+     K +  +        DG      M   + YM   +   P    Y+ D  F   P R +L  D        ED F++     RP + + + G+  S + +H+DP   +  N ++ G K+W LFPP     LL +     +K       + S +   C  PN   E+      K++E  Q PGE + +P GW+H V        +V     +S N+  V  +  +G       +Y  LK   P
Sbjct:   61 RNKVSQQEFRTKYENNYIPVVVLDDQKNWLAHKKWSLERLKKKYRNQKFRCGEDDDGYGVKIKMKYFVNYMNENNDDSP---LYIFDGNFGENPKRARLLEDYQISDYFKEDLFKLCGETRRPPYRWFVMGSARSGTGIHIDPLGTSAWNALVKGHKRWCLFPPSTPKELLKLNSNEGWKNRSEAIVWFSIVYPRCKAPNWPSEF------KMIEILQNPGETVFVPGGWWHVV-LNLDDTVAVTQNFCSSSNFPVVWYKTVRGRRKLSKKWYEKLKECRP 331          
BLAST of JmjC domain-containing protein vs. Planmine SMEST
Match: SMESG000039333.1 (SMESG000039333.1)

HSP 1 Score: 68.5514 bits (166), Expect = 3.338e-12
Identity = 59/235 (25.11%), Postives = 101/235 (42.98%), Query Frame = 2
Query:  569 LSIEEYRDIYS-GKWPVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKTMADGVSENFAMPLDIYMQHLHKGYPKQWTYLNDELFIPSRPK--LQSDLGTCKEIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPPGQDNLLHVKLETKYKFPININ--KYNSKIDCFDPNAHIEYPSL------KSAKVLEFYQYPGELLIIPTGWFHQV 1240
            LS++++ + Y     PVII +    WPA+KKW  +     +  +  + +   D      ++ +  +  ++         Y+ D     ++ K  L  D        ED F +   +IRP + + + G+  S S++H+DP   +  N ++ G K+W LFPP     L        K PIN N  +     D F    +I Y  +          + E  Q PGE + +P+GW+H V
Sbjct:   65 LSVDDFHEKYEKTNTPVIIINDQQNWPAIKKWKLANLKLKYRNQ--SFRCGDDENDRTVSIKMKYFADYMKNNNDDSPLYVFDGSLDENKKKARLLEDYQVSGYFTEDLFSILGDKIRPPFRWFVIGSARSGSNIHIDPLGTSAWNALVHGYKRWCLFPPCTPKFL-------VKPPINKNWGRLTEASDWF----NIMYKRMLLSDWPSEYAMTEAIQKPGETIFVPSGWWHVV 286          
BLAST of JmjC domain-containing protein vs. Planmine SMEST
Match: SMESG000039333.1 (SMESG000039333.1)

HSP 1 Score: 68.5514 bits (166), Expect = 3.518e-12
Identity = 59/235 (25.11%), Postives = 101/235 (42.98%), Query Frame = 2
Query:  569 LSIEEYRDIYS-GKWPVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKTMADGVSENFAMPLDIYMQHLHKGYPKQWTYLNDELFIPSRPK--LQSDLGTCKEIMEDYFQMFPVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPPGQDNLLHVKLETKYKFPININ--KYNSKIDCFDPNAHIEYPSL------KSAKVLEFYQYPGELLIIPTGWFHQV 1240
            LS++++ + Y     PVII +    WPA+KKW  +     +  +  + +   D      ++ +  +  ++         Y+ D     ++ K  L  D        ED F +   +IRP + + + G+  S S++H+DP   +  N ++ G K+W LFPP     L        K PIN N  +     D F    +I Y  +          + E  Q PGE + +P+GW+H V
Sbjct:   89 LSVDDFHEKYEKTNTPVIIINDQQNWPAIKKWKLANLKLKYRNQ--SFRCGDDENDRTVSIKMKYFADYMKNNNDDSPLYVFDGSLDENKKKARLLEDYQVSGYFTEDLFSILGDKIRPPFRWFVIGSARSGSNIHIDPLGTSAWNALVHGYKRWCLFPPCTPKFL-------VKPPINKNWGRLTEASDWF----NIMYKRMLLSDWPSEYAMTEAIQKPGETIFVPSGWWHVV 310          
BLAST of JmjC domain-containing protein vs. Planmine SMEST
Match: SMESG000065343.1 (SMESG000065343.1)

HSP 1 Score: 48.9062 bits (115), Expect = 7.056e-6
Identity = 67/267 (25.09%), Postives = 111/267 (41.57%), Query Frame = 2
Query:  461 FNPLSISIKEIIENRLVNMKKYKFNYSWTDIDRRGDLSIEEYRDIYSGKWPVIITDCGIKWPAMKK--WTKSYFMKSHGRELVTVKTMADGVSENFAMPLDIYMQHLHKGYPKQWTYLNDELFIPSRPKLQSDLGTCKEIME--DYFQMFPVEIRPWWSFLLW-GTRYSRSHLHMDPYNWTGTNMV--ISGLKQWKLFPPGQDNLLHVKLETKYKFPININKYNSKIDCFDPNAHIEYPSLKSAKVLEFYQYPGELLIIPTGWFHQV 1240
            FNPL  +I ++I+N L              ++R    SI E+ +I     P+I+T+    WPA+    W+  Y  K  G   V ++  +     N+   L + +    + Y  Q +  + + ++ ++  L S +    + +E  DY  M   + +P      W G   + S LH DP      N +  + G K  KL+   Q N L+    T         K  SKID   P+    +P   +A   + +  PGE+L IP   +H V
Sbjct:  157 FNPLQ-NIPDLIKNNL------------RPLERIQAPSISEFLNILKKSEPIILTNVISNWPALSNNLWSVGYIKKVCGFRTVPIEIGSSYAESNWTQKL-MTINDFIENYFYQSSETDSKAYL-AQHYLFSQIAELNDDIEIPDYCFMNSTDQKPEIDINGWFGPAGTVSPLHQDP----KQNFLCQVFGEKYVKLYHANQTNYLYPNSTTML-------KNTSKIDVLSPDLE-TFPLFSNAIGFDCFLKPGEILFIPPKCWHYV 396          
The following BLAST results are available for this feature:
BLAST of JmjC domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
JMJD66.738e-1424.41jumonji domain containing 6, arginine demethylase ... [more]
JMJD68.475e-1424.41jumonji domain containing 6, arginine demethylase ... [more]
JMJD67.126e-1324.71jumonji domain containing 6, arginine demethylase ... [more]
JMJD68.230e-1324.71jumonji domain containing 6, arginine demethylase ... [more]
JMJD68.230e-1324.71jumonji domain containing 6, arginine demethylase ... [more]
back to top
BLAST of JmjC domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
jmjd-42.264e-1225.00JuMonJi (Transcription factor) Domain protein [So... [more]
psr-12.719e-1227.27Bifunctional arginine demethylase and lysyl-hydrox... [more]
psr-12.771e-1227.27Bifunctional arginine demethylase and lysyl-hydrox... [more]
psr-12.334e-627.07Bifunctional arginine demethylase and lysyl-hydrox... [more]
back to top
BLAST of JmjC domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
PSR2.423e-1025.70gene:FBgn0038948 transcript:FBtr0330378[more]
PSR2.799e-1025.70gene:FBgn0038948 transcript:FBtr0084239[more]
JMJD73.107e-924.91gene:FBgn0036366 transcript:FBtr0075825[more]
back to top
BLAST of JmjC domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
jmjd64.136e-1324.25jumonji domain containing 6, arginine demethylase ... [more]
jmjd71.288e-926.88jumonji domain containing 7 [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of JmjC domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
jmjd61.350e-1424.75jumonji domain containing 6 [Source:NCBI gene;Acc:... [more]
jmjd72.463e-827.48jumonji domain containing 7 [Source:NCBI gene;Acc:... [more]
lman24.371e-631.19lectin, mannose-binding 2 [Source:Xenbase;Acc:XB-G... [more]
lman24.894e-631.19lectin, mannose-binding 2 [Source:Xenbase;Acc:XB-G... [more]
lman24.974e-631.19lectin, mannose-binding 2 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of JmjC domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Jmjd65.790e-1424.32jumonji domain containing 6 [Source:MGI Symbol;Acc... [more]
Jmjd67.211e-1324.62jumonji domain containing 6 [Source:MGI Symbol;Acc... [more]
Jmjd68.628e-1324.62jumonji domain containing 6 [Source:MGI Symbol;Acc... [more]
Jmjd77.370e-1026.29jumonji domain containing 7 [Source:MGI Symbol;Acc... [more]
Jmjd68.376e-1025.11jumonji domain containing 6 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of JmjC domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9M9E8|FB92_ARATH1.075e-1923.90F-box protein At1g78280 OS=Arabidopsis thaliana OX... [more]
sp|Q6GND3|JMD6A_XENLA1.464e-1525.33Bifunctional arginine demethylase and lysyl-hydrox... [more]
sp|Q58DS6|JMJD6_BOVIN1.053e-1325.00Bifunctional arginine demethylase and lysyl-hydrox... [more]
sp|Q5R6G2|JMJD6_PONAB3.236e-1324.41Bifunctional arginine demethylase and lysyl-hydrox... [more]
sp|Q6NYC1|JMJD6_HUMAN3.236e-1324.41Bifunctional arginine demethylase and lysyl-hydrox... [more]
back to top
BLAST of JmjC domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3HCH17.347e-10242.16bifunctional arginine demethylase and lysyl-hydrox... [more]
A0A433TUQ17.009e-9449.83JmjC domain-containing protein (Fragment) OS=Elysi... [more]
A0A1I8IRL87.308e-9345.66Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A2T7P8187.791e-8541.88JmjC domain-containing protein OS=Pomacea canalicu... [more]
A0A210R7631.939e-8442.03JmjC domain-containing protein OS=Mizuhopecten yes... [more]
back to top
BLAST of JmjC domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
jmjd61.171e-1223.68jumonji domain containing 6, arginine demethylase ... [more]
jmjd71.363e-926.59jumonji domain containing 7 [Source:NCBI gene;Acc:... [more]
jmjd71.419e-926.59jumonji domain containing 7 [Source:NCBI gene;Acc:... [more]
jmjd71.419e-926.59jumonji domain containing 7 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of JmjC domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
jmjd69.967e-1023.66jumonji domain containing 6, arginine demethylase ... [more]
back to top
BLAST of JmjC domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of JmjC domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO478235.327e-5837.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410236.086e-1024.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453148.275e-1025.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447217.461e-726.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO459762.243e-623.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of JmjC domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
jmjd62.024e-1224.44jumonji domain containing 6, arginine demethylase ... [more]
jmjd78.293e-924.31jumonji domain containing 7 [Source:NCBI gene;Acc:... [more]
jmjd45.270e-628.70jumonji domain containing 4 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of JmjC domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000053108.10.000e+097.83SMESG000053108.1[more]
SMESG000022043.12.228e-1525.98SMESG000022043.1[more]
SMESG000039333.13.338e-1225.11SMESG000039333.1[more]
SMESG000039333.13.518e-1225.11SMESG000039333.1[more]
SMESG000065343.17.056e-625.09SMESG000065343.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016779 ID=SMED30016779|Name=JmjC domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1641bp
CAATTGTGTTTTAAATTGGGTAGCAATTATAATTTCGCAATATAAATTGT
CAGAGATCCTTTTATGATTTATAATAACCAAATTTAGTGATAATACAAGG
AACATTAATCAAATTGATAAATTTTCATTCGATTGTTTTATTTAAAACAT
GTTGCCTTTACTCTCATATAAACTATACCGCTATAAAAAAGACATGATGA
TGAAACAAGATAATAAGCTGAAAACGAGCAACGGGATGAATAACCAATCT
CATGCAATGAATCAACGGAGAAAAAATAAAAACCCCTCATTGACAGAGAT
AACAATTTTACTTTTTGGGATGTTCGGAGTGCCAGTTTTTTACTTCTGTT
ACTGGACTCTCATTTCCATTTATCACTGGACAATTGCTTTCAATACAGAG
CAATTGCTCAGCGCTCCTCCAAAATCGGTTTCAATGGATACTGCTTTTAA
TCCATTTTATTTCAATCCCCTATCGATTTCCATTAAGGAAATTATTGAAA
ATCGATTGGTAAATATGAAAAAATACAAATTCAATTACAGCTGGACCGAT
ATCGATCGACGCGGAGATTTGAGCATAGAAGAGTATCGGGATATATATAG
TGGGAAATGGCCAGTAATAATTACTGATTGTGGTATAAAATGGCCAGCTA
TGAAAAAATGGACTAAATCATATTTTATGAAATCACATGGAAGGGAATTG
GTGACAGTAAAAACAATGGCGGATGGAGTTAGTGAGAACTTTGCTATGCC
TTTAGATATTTACATGCAGCATCTACACAAAGGTTATCCAAAACAATGGA
CCTATTTGAATGATGAGTTGTTCATACCTAGTCGGCCGAAATTGCAAAGC
GATCTCGGTACTTGTAAAGAAATTATGGAAGATTATTTTCAAATGTTTCC
GGTAGAGATTCGACCGTGGTGGTCATTTTTGCTATGGGGTACAAGATATT
CCCGATCTCATCTTCATATGGATCCTTACAATTGGACCGGAACTAATATG
GTAATTAGTGGTCTCAAGCAATGGAAACTTTTCCCGCCTGGACAGGATAA
TCTTCTCCACGTGAAATTAGAAACCAAATACAAATTTCCCATCAACATCA
ACAAATACAATAGTAAAATCGATTGTTTCGATCCTAATGCACATATCGAA
TACCCTTCACTGAAATCGGCAAAGGTTCTTGAGTTCTACCAATATCCAGG
CGAGTTATTAATTATTCCAACTGGATGGTTTCATCAAGTAAAATTCACTT
CCAAACCTTTGAAATCTGTCGCTGGACAGTTGATGAATTCAGAAAATTAT
TTGTATGTCCTTGAAGAAATTTTCAAAGGTGGAGACTTGCAAAGAGGACC
CTATTACTCTGACTTAAAAAATAAATCACCCCAAGAAAAAGTTAAAGAAG
TTTTGTTGGGAATCACCGAGAAAACACGAACTCAGGGCAGAGAAGCTACG
GAATTCATTTATAATCAGTTAAAGCAATTGGCTGAATCATCAGGTCTGCC
GGTTCCTCCATCCATATTGGATCTTATAAACTCACAGAAACATAAAACCG
ATAATTTACCATAATTTATTGAGTGCCTTGCTAGAAATCTGTGTAGTAAA
AGGAACCTGCCATTCCAATCTGTTCTTGCGCAATAAATTAT
back to top

protein sequence of SMED30016779-orf-1

>SMED30016779-orf-1 ID=SMED30016779-orf-1|Name=SMED30016779-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=472bp
MLPLLSYKLYRYKKDMMMKQDNKLKTSNGMNNQSHAMNQRRKNKNPSLTE
ITILLFGMFGVPVFYFCYWTLISIYHWTIAFNTEQLLSAPPKSVSMDTAF
NPFYFNPLSISIKEIIENRLVNMKKYKFNYSWTDIDRRGDLSIEEYRDIY
SGKWPVIITDCGIKWPAMKKWTKSYFMKSHGRELVTVKTMADGVSENFAM
PLDIYMQHLHKGYPKQWTYLNDELFIPSRPKLQSDLGTCKEIMEDYFQMF
PVEIRPWWSFLLWGTRYSRSHLHMDPYNWTGTNMVISGLKQWKLFPPGQD
NLLHVKLETKYKFPININKYNSKIDCFDPNAHIEYPSLKSAKVLEFYQYP
GELLIIPTGWFHQVKFTSKPLKSVAGQLMNSENYLYVLEEIFKGGDLQRG
PYYSDLKNKSPQEKVKEVLLGITEKTRTQGREATEFIYNQLKQLAESSGL
PVPPSILDLINSQKHKTDNLP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005829cytosol
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR041667Cupin_8
IPR003347JmjC_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003347JmjC domainSMARTSM00558cupin_9coord: 180..336
e-value: 0.006
score: 2.4
IPR003347JmjC domainPROSITEPS51184JMJCcoord: 158..338
score: 20.194
IPR041667Cupin-like domain 8PFAMPF13621Cupin_8coord: 87..311
e-value: 1.2E-24
score: 87.4
NoneNo IPR availableGENE3DG3DSA:2.60.120.650coord: 53..316
e-value: 3.2E-42
score: 146.8
NoneNo IPR availablePANTHERPTHR12461HYPOXIA-INDUCIBLE FACTOR 1 ALPHA INHIBITOR-RELATEDcoord: 60..382
NoneNo IPR availablePANTHERPTHR12461:SF41coord: 60..382
NoneNo IPR availableSUPERFAMILYSSF51197Clavaminate synthase-likecoord: 76..308