Protein kinase domain-containing protein

Overview
NameProtein kinase domain-containing protein
Smed IDSMED30016769
Length (bp)3339
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase domain-containing protein (SMED30016769) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30016769) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase domain-containing protein (SMED30016769) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30016769) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016769

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30016769SMESG000031104.1 SMESG000031101.1 dd_Smed_v4_6221_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30016769SMESG000031104.1 SMESG000031101.1 dd_Smed_v4_6221_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30016769SMESG000031104.1 SMESG000031101.1 dd_Smed_v4_6221_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|B2IZD3|BDLP_NOSP7 (Bacterial dynamin-like protein OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) OX=63737 GN=Npun_R6513 PE=1 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 2.051e-7
Identity = 54/205 (26.34%), Postives = 99/205 (48.29%), Query Frame = 1
Query:  325 RETKLYKEYPQIMNKLKALLKKMEKFKNSKRFKDELGEIFKLKENKIETIVKPLKKMIECKKFPILIVGEAKAGKSTFINILLNKDLMPTGMKVCNRIMCEIQNSTEQMVTFSGPDVKS-LTLGIEDL-------TXXXXXXXXXXXXXFVMANF---KYPVNFLENYTYLVDSPGIGDTLLLENMTLEYLRENSPALIFVLNST 906
            R  ++  E    +NKL   + K E   +S   K  L       E  IE I    K + +   F +L++G+ K GKSTF+N L+ ++L+P+ +  C  ++  ++   E+ VT    D KS   L  ++            K ++ + ++ F   ++   +YP+  L+    +VDSPG+ DT     ++L Y+  N  A++FV+ ++
Sbjct:   16 RVAQVRSEMSVCLNKLAETINKAELAGDSSSGKLSL-------ERDIEDITIASKNL-QQGVFRLLVLGDMKRGKSTFLNALIGENLLPSDVNPCTAVLTVLRYGPEKKVTIHFNDGKSPQQLDFQNFKYKYTIDPAEAKKLEQEKKQAFPDVDYAVVEYPLTLLQKGIEIVDSPGLNDTEARNELSLGYV-NNCHAILFVMRAS 211          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|P40983|YOR6_CALSR (Uncharacterized protein in xynA 3'region (Fragment) OS=Caldicellulosiruptor sp. (strain Rt8B.4) OX=28238 PE=4 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 1.619e-6
Identity = 45/166 (27.11%), Postives = 82/166 (49.40%), Query Frame = 1
Query:  412 KRFKDELGEIF-KLKENKIETIVKPLKKMIECKKFPILIVGEAKAGKSTFINILLNKDLMPTGMKVCNRIMCEIQNSTEQMVTFSGPDVKSLTLGIEDLTXXXXXXXXXXXXXFV-MANFKYPVNFLENYTYLVDSPGIGDTLLLE-NMTLEYLRENSPALIFVLN 900
            + F ++L EI  ++    I+ +   +K+ IE   F ++++G+ K GKST IN +L  +L+PTG+     ++ +I  S E  V           + +++L            +  V      YP +FL     +VD+PGIG       ++T E++ + S A++FVL+
Sbjct:   14 RNFTEQLQEISNEINSESIKKLAGSIKEKIEKNAFYLVVLGQFKRGKSTLINYMLGANLLPTGVLPLTSVITKIYYSPEVKVDVIFESGVKKEIPVDELDLYCTERGNPKNQKCVDTIEIGYPFDFLNKDVVIVDTPGIGSVYQHNTDVTYEFI-DKSDAVVFVLS 178          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A2B4RY20 (CBL-interacting serine/threonine-protein kinase 13 OS=Stylophora pistillata OX=50429 GN=CIPK13 PE=4 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 2.056e-29
Identity = 181/866 (20.90%), Postives = 363/866 (41.92%), Query Frame = 1
Query:  505 KKFPILIVGEAKAGKSTFINILLNKDLMPTGMKVCNRIMCEIQNSTEQMVTF--------SGPDVKSLTLG--IEDLTXX----------XXXXXXXXXXXFVMANFKYPVNFLENYTYLVDSPGIGDTLLLENMTLEYLRENSPALIFVLNSTNCYG-----LDIKTKTLIEKSKEIFCDTEHSFSNFKSPSGHIFQFEKAIFIINHMDVIINEISSQLELEAFKKKIVNKIKTLWHENIDEKRQIFFISAKKAREWQDNGIVQDVITDIRNCIRRLIVYIYEKNLQFSIKKLDLLCSKFEKKILTKLNNRVDYEYHRLTDRNNDQIICETLQK----TLTDMAERKLKIISEIRP----KFDAMAENLTEYLKSDSLENRIINSYRSKIDPDIKDIHLLVLIFQKYFENQLFQEITLWEKDSKQMETLYNYLYDSIKKNLNEICNQI-NASENILNKEYFFQFWNESCETENSNSADE--FIDRIEKVFIISTLTMLFPIVALAGVLATPLIISHIFKEKQYNEEQMLLYKNNPETFLKFQSSKIIKELTSK-IIRNFVFN--NVEKKCLYLVDKFEKAIENNLVEKTISINSFEIERRDFMEILNSLRLLLNDMETFCSELEIIKINCETVIDPGIFVLPSIYEKVINKETRITE--CLSTGQFSQLFK------NENYKSVVFKAYTKEFNKTNAHFQMLEIDLLRK--HPSDFLIRCESALFLKAENKIMIVLESVDCNLYTYLQDNQILILSHETTNNEIQSEALQFLLDISIQISFALKYLFTYEPRMVHPDLTLYSIMVRKT--SEISKIRILLGDACCNLSIKSQNKNNQSENFIMGGF-TMENVFRLGLIFYQMAC 2946
            +++ +L+ GE  AGKS+ +N++L ++L+P  +      +CE++   E+ V          +G   K  TL    E  T+                 +    +      +P   L+N   ++DSPG+G++ +++ +  EYL   + A I+VLNS N  G     L+     ++ K KE                   F  + A+F+ N  D +      + E+   K  +V K+K  W   +D + QI ++S   A   Q +GI+ +  + + N ++ ++    E  L+ + + LD L S+        + N            + D +  E L       L  + +++ +++ ++R     + D   + L++YL+SD +++   +    ++        +      K  E +L   I  WE+D+         L +  +K  N I  ++ N    + + E   +          S++ DE  F    EKV I  T  +  P+  +A V+  P++   + K K  N+ ++  Y+ +  TF+   S+  + E+  + I+++FV +  N  K CL    + E  I   +    ++    + E R   +I+   + +L++       L +  +     +D            V +KE    E   L +G F+ +++      N   ++V  K   +  +  NA   + EID L+K  HP        S L +K + K+++V+E    NL  ++  N I +    + N     E  +++ DIS  ++      F ++  +VH DL L +I++ +T  ++I+ + +  G      +I         E F    +    +++ LG++ +++ C
Sbjct:  121 REYFLLVAGETGAGKSSLVNLILGEELLPYSILSTTSTICEMRYGKERRVVIHFKDKDPETGSPTKIFTLAEPPEGATEQNYLQQISPYVHLKSDREKGSIYKKVELHWPHQLLKNGIVIIDSPGVGESDIMDEIVTEYL-PRAFAFIYVLNSANAGGVQKDRLEKLVTKVVGKQKE---------------GQEEFPPKCALFVCNKWDQV-----PKGEINEVKSHVVKKLKKCW-PGLDPESQIVYMSTMMANTAQRHGIITEDFSSLMNGVKAMVSRTIEARLEINWRWLDDLLSRITYHTTAYVKN-----------ASRDHVKSEALMALILLRLMLIKQQQNEVMEDLRSHLKDRIDKAVQKLSDYLRSDGVKSCFTSWTLDEVPKAETSWEVTKNSITKVLERRLQNIIENWEEDNHVFANTRESLLEHFQKKYNFISGELRNLQSAVTSDEVMLE----------SDAPDEESFFSLGEKVAIGVTSPLWVPLGLVAFVIGAPVVGVMVIKSKLENKSKIKKYEKDKCTFMAGASADYLDEVIKESILKSFVKHQLNAAKLCL---KQIEARIPELIQADIVACKQLKDETRSKKDIIALYKPILDEAVEIRGRLAVFGLREVRAVD------------VSSKELDWKEDDLLGSGAFASVYRGKMNTENGEERTVALKVCHEWLHPGNASLILNEIDFLKKLQHPYIVTFYGMSLLDIKGKLKVIMVMEHCKGNLKNHIFRN-INLAPANSKNVATIREGCRWVRDISAALA------FIHQHGVVHRDLKLENILLSETNSAKITDVGVSKGADDITGTIAGTPLYMAPEVFHSQLYDNKADIYSLGILMWEIWC 921          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A2B4S0F4 (Dual specificity protein kinase shkA OS=Stylophora pistillata OX=50429 GN=shkA PE=4 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 2.026e-23
Identity = 213/1058 (20.13%), Postives = 436/1058 (41.21%), Query Frame = 1
Query:  220 LKKLGIKLENVENLNDVKEVLMLKYHRNQDQNEEIRETKLYKEYPQIMNKLKALLKKMEKFKNSKRFKDELGEIFKLKENKIETIVKPLKKMIE-----CK--------KFPILIVGEAKAGKSTFINILLNKDLMPTGMKVCNRIMCEIQNSTEQMVTF--------SGPDVKSLTLGIEDLTXXXXXXXXXXXXXFVM--------ANFK-----YPVNFLENYTYLVDSPGIGDTLLLENMTLEYLRENSPALIFVLNSTNCYG-----LDIKTKTLIEKSKEIFCDTEHSFSNFKSPSGHIFQFEKAIFIINHMDVIINEISSQLELEAFKKKIVNKIKTLWHENIDEKRQIFFISAKKAREWQDNGIVQDVITDIRNCIRRLIVYIYEKNLQFSIKKLDLLCSKFEKKILTKLNNRVDYEYHRLTDRNNDQIICETLQKTLTDMAERKLKIISEIRPKFDAMAENLTEYLKSDSLENRIINSYRSKIDPDIKDIHLLVLIFQKYFENQLFQEITLWEKD----SKQMETL---YNYLYDSIKKNLNEICNQINASENILNKEYFFQFWNESCETENSNSADEFIDRIEKVFIISTLTMLFPIVALAGVLATPLIISHIFKEKQYNEEQMLLYKNNPETFLKFQSSKIIKE--LTSKIIRNFVFNNVEKKCLYLVDKFEKAIENNLVEKTISINSFEIERRDFMEILNSLRLLLNDMETFCSELEIIKINCETVIDPGIFVLPSIYEKVINKETRITECLSTGQFSQLF----KNENYK--SVVFKAYTKEFNKTNAHFQMLEIDLLRKHPSDFLIRCESALFLKAEN---KIMIVLESVDCNLYTYLQDNQILILSHETTNNEIQSEALQFLLDISIQISFALKYLFTYEPRMVHPDLTLYSIMVRK--TSEISKIRILLGDACCNLSIKSQNKNNQSENFIMGGFTME-NVFRLGLIFYQMACFRNYCKIGQMKENCENDLTSLYSFDVLMFVNP----SIIKVEELPPLV------PTGYRELIDKCVSQKPEYRPTITDIVKDLEDINNT 3183
            +  LGI  E +  L  +KE   ++   NQ  N  +   K  K +  +        KK E      RF  +  + F   ++K+E +V+  K M +     CK        ++ +L+ GE  AGKS+ +N++L ++L+P  +      +CE++   ++ V          +G   K+  L +E      +    +    +V         +++K     +P   L +   ++DSPG+G++ +++ +  EYL + + A I+V+NS N  G     L      ++ K KE                   F    A+F+ N  D +      + E++  K+ +V K++  W   +D + QI ++S   A + Q  GI+          +R +++   E  L+   + LD L S+        +NN    ++ ++  R    +I + L +  T+ ++    + S ++ + D   + L+ YL SD +++R  +    ++        ++     +    +L   +  WE+D    +   E+L   + + Y+  ++ L  + + + + E +              E +       F  R EKV I  T  +  P+  +A V+  P++     K+K   + ++  Y+ N   F+   S+  + +  L    +RNFV   ++   L L  + E  I   +    +       E R    I++  + +L++      EL +       V D   F + S+   +  KE +   C   G FS ++    K E  +  +V  K Y +  N   A     E+D+LRK    ++++      L  E+   ++M+V+E    NL +Y+  N   + ++ + N   +SE  ++    + +I+ AL Y+  ++   VH DL L +I++ +  T++I+ + +  G      ++         E +    +  + +++ LG++F++M                      L++F  L  + P      ++    P  V      P+ ++E+++ C    P+ R T     +   D++N 
Sbjct:   22 MTALGISFEGLTTLEQMKE--RIRTEMNQSLN--VPNWKAGKAFSVLSEAKDEDAKKKEILM---RFYSQGEKCFSDLDDKLEALVR--KNMGDVREKICKHQNALKKTEYFLLVAGETGAGKSSLVNLILGEELLPYSLLSTTSTICEMRYGQQREVVAHFKDKDPETGLPTKTFPL-VEPPEGATEQSYLQQISPYVHLKGDREKGSSYKKIELFWPHELLRSGVVIIDSPGVGESEIMDEIVTEYLPQ-AFAFIYVVNSANSGGVQKDRLGRLLDVVVGKRKE---------------GQEEFPARCALFVCNKWDQV-----PEKEIKEVKRHVVAKLRKCW-PGLDPRSQIVYMSTMNASKAQSYGIITRDFVSFMTGMRSMVLKSIEARLEIHWRWLDELFSRMIYHATAFVNN-ASKDHEKVAQRM--AVIRDRLMRLETEQSQVIEDLRSHLKDRTDNALKELSVYLNSDRVKSRFTSWTLDEVPKAESSWEVIKNNVTQALRGRLHDILEHWEEDMHVFANARESLLQRFQHKYNVFEEELRNLQSAVTSDEVL-------------PEGDAPEEESLFTLR-EKVVIGVTSPLWVPLGVVAVVIGAPVVGILAIKKKFEEKSKIRKYEKNKCAFMAEASADFLNDVLLDEYALRNFVKGQLKDAKLCL-RQIEARIPELIQADLMLCKQLSDETRSKEVIVDLYKPMLDEALNIRGELSMF-----VVRDVRTFGVNSL--SLDWKEDKPLGC---GSFSSVYQGKMKTETGEEINVAVKVYHEALNVQTAGLVSKEVDILRKLQHQYIVKFYGTSLLDTESSWTRVMLVMEHCKSNLKSYIFQNPDKVPAN-SKNPADRSETFRW----ATEITGALDYI--HKEGFVHRDLKLENILLAENNTAKIADVGVSKGAQEITGTLAGTPVYMAPEVYHSRRYGSKVDIYSLGIVFWEM-------------------WYGLHAFSELRSLTPIQFFERVEQNHRPKDVEGCFTPPSRWKEMMENCWKTDPQERQTAEWCNRVASDLHNA 993          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A3M6TS08 (Protein kinase domain-containing protein OS=Pocillopora damicornis OX=46731 GN=pdam_00002455 PE=4 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 6.015e-23
Identity = 202/990 (20.40%), Postives = 431/990 (43.54%), Query Frame = 1
Query:  358 IMNKLKALLKKMEKFKNSKRFKDELGEIFKLKENKIETIVKPLKKM-----------IECKKFPILIVGEAKAGKSTFINILLNKDLMPTGMKVCNRIMCEIQNSTEQMV----------------TFSGPDVKSLTLGIEDLTXXXXXXXXXXXXXFVMANFKYPVNFLENYTYLVDSPGIGDTLLLENMTLEYLRENSPALIFVLNSTNCYGLDI-KTKTLIEKSKEIFCDTEHSFSNFKSPSGHIFQFEKAIFIINHMDVIINEISSQLELEAFKKKIVNKIKTLWHENIDEKRQIFFISAKKAREWQDNGIVQDVITDIRNCIRRLIVYIYEKNLQFSIKKLDLLCSK--FEKKILTKLNNRVDYEYHRLTDRNNDQIICETLQKTLTDMAERKLKIISEIRPKFDAMAEN----LTEYLKSDSLENRIINSYRSKIDPDIKDIHLLVLIFQKYFENQLFQEITLWEKDSKQMETLYNYLYDSIKKNLNEICNQINASENILNKEYFFQFWNESCETENSNSADEFIDRIEKVFIISTLTMLFPIVALAGVLATPLIISHIFKEKQYNEEQMLLYKNNPETFLKFQSSKIIKELTSK--IIRNFVFNNVEKKCLYLVDKFEKAIENNLVEKTISINSFEIERRDFMEILNSLRLLLNDMETFCSELEIIKINCETVIDPGIFVLPSIYEKVINKE----TRITECLSTGQFSQLFK------NENYKSVVFKAYTKEFNKTNAHFQMLEIDLLR--KHPSDFLIRCESALFLKAENKIMIVLESVDCNLYTYLQDNQILILSHETTNNEIQSEALQFLLDISIQISFALKYLFTYEPRMVHPDLTLYSIMVRKTSEISKIRILLGDACCNL--SIKSQNKNNQSENFIMGGF-TMENVFRLGLIFYQM----ACFRNYCKIGQMKENCENDLTSLYSFDVLMFVNPSIIKVEELPPLVPTGYRELIDKCVSQKPEYRPTITDIVKD 3162
            +++K+K    K+++F  S  F  E+   +   ++KI+T+++  KKM           I+ K   +L   E  +GKS+ IN++L ++L+P  +      +CE++   E+ +                TF+  + K+      D          +I   +      +P   L+N   ++DSPG+G++ +++ +  EYL E + A I+V+N TN  G+   +   L+E  KE   + E             F    A+F+ +  D    ++  + E +  +  ++ K+K  + + + EK Q+  +S K A   Q+ GIV      + NC+R +++   +  L+F  + L  L S+  +  K+  K   R   E  +L +         ++   L+ + E++ +++ ++R   ++  ++    L++YL SD + ++  +    K+        +      K  EN+L + I  WE+D+     ++    +S+ ++  E CN +     IL +       +E    ++S +      + +K+ I  T  +  P+  +  V+  P +       +  ++ ++  Y  +   F++  S++ + E+T K  ++ NFV + ++   L L     K IE  + E        E +     ++L   +   +  +T+   + I++   E      +F L       I+ E       ++CL  G F+ +++      N + ++V  K +T+     NA   + EI+ L   KHP+       S L    E ++++V+E    NL   +  N     + ++ N + +++A Q++  I   +S      F ++ ++VH DL L +I++  T+E+    + +      +  ++         E F    + T  +++ LG+I ++M      FR +  I            +L++  V   + P  +K    P      +++L+++C ++KP  RP+ +  +K+
Sbjct:   63 VLSKIKEQDAKVKEFLLS--FYHEVETCYDDLDDKIQTLLQ--KKMGDVKEKMKNHQIKNKTRRLLPSSETGSGKSSLINLILGEELLPYSILSITSTICELKYGDERRIVAHYKDKDPETLLPTKTFNLVEPKASGKSYHDQIFPFVQSGREIGSVYKKVELFWPHKLLKNGVVIIDSPGVGESEIMDEIVREYLPE-AFAFIYVINCTNAGGVQKDRLGKLLEGVKEKRKEEE-------------FTSTCALFVCHKWD----QVKEKKEEKKVENHVIEKLKNFYPDIVPEK-QVVQMSTKNASIAQNYGIVTKRFVSLMNCMRSMVLRSVKARLEFYWRWLYGLLSQIVYHAKVHMKNTTREQEEILKLIN---------SVSVRLSYIEEKQNEVMKDLRNHLESRTKSAVKTLSDYLCSDDIRSQFTSWTSDKVPKTESSWEVTESNITKVMENRLQEIIKHWEEDNH----VFTDTRESLVRHFKERCNFLEGELRILQEALLS---DEIMPQDHSETGFGLTIK-DKIAIFVTSPIWVPLSLIVLVVGAPKVGVMAIMSRLEDKRRIRKYDEDKCAFMRQASTEYLNEVTKKEDVLMNFVKDQLKDAALCL-----KQIEARIPE------LIEADHSLCKQLLEEKKSTKDVRDTY---IPILEAASEIRGRLAVFGLEEGLAAGISSEILDLKGQSDCLGRGAFASVYRGMMKTENGDEQTVAVKIFTESLKADNACDIVDEIEFLEKLKHPNVVTFHGTSLLKEDGETRVILVMEYCKENLKNRIFSNPERAPA-KSKNIDAKTDACQWIKQIVTALS------FIHDQKVVHRDLKLDNILLSATNEVKITDVGVSKDVNKITGTLAGTPAYVAPEVFHSQLYDTKADIYSLGIILWEMWYGQQAFREFSDIPSH--------VALFNM-VDEGLRPKHVKGCNEP---LRRWKDLMERCWNKKPAERPSASHCLKE 979          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A2B4S0P2 (Dual specificity protein kinase shkA OS=Stylophora pistillata OX=50429 GN=shkA PE=4 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 8.011e-22
Identity = 159/753 (21.12%), Postives = 327/753 (43.43%), Query Frame = 1
Query:  784 LENYTYLVDSPGIGDTLLLENMTLEYLRENSPALIFVLNSTNCYGLDIKTKTLIEKSKEIFCDTEHSFSNFKSPSGHIFQFEKAIFIINHMDVIINEISSQLELEAFKKKIVNKIKTLWHENIDEKRQIFFISAKKAREWQDNGIVQDVITDIRNCIRRLIVYIYEKNLQFSIKKLDLLCSKFEKKILTKLNNRVDYEYHRLTDRNNDQIICETLQKTLTDMAERKLKIISEIR----PKFDAMAENLTEYLKSDSLENRIINSYRSKIDPDIKDIHLLVLIFQKYFENQLFQEITLWEKDSKQMETLYNYLYDSIKKNLNEICNQI-NASENILNKEYFFQFWNESCETENSNSADE--FIDRIEKVFIISTLTMLFPIVALAGVLATPLIISHIFKEKQYNEEQMLLYKNNPETFLKFQSS----KIIKELTSKIIRNFVFN--NVEKKCLYLVDKFEKAIENNLVEKTISINSFEIERRDFMEILNSLRLLLNDMETFCSELEIIKINCETVIDPGIFVLPSIYEKVINKETRITECLSTGQFSQLFK------NENYKSVVFKAYTKEFNKTNAHFQMLEIDLLRK--HPSDFLIRCESALFLKAENKIMIVLESVDCNLYTYLQDNQILILSHETTNNEIQSEALQFLLDISIQISFALKYLFTYEPRMVHPDLTLYSIMVRKT--SEISKIRILLGDACCNLSIKSQNKNNQSENFIMGGF-TMENVFRLGLIFYQMACFRN-YCKI 2967
            L N   ++DSPG+G++ +++ +  EYL   + A I+VLNS N  G+    K  +EK            +  +      F  + A+F+ N  D +  E     E++  K  ++ K+K  W   +D + QI ++S   A   Q +GI+ +  + + N ++ ++    E  L+   K LD L ++        + N          DR   + +   +   L  +  ++ +++ ++R     + D   + L++YL+SDS+++   +     +        +      +  E +L   I  WE+D+         L +  +K  N +  ++ N    + + E   +          S++ DE       EK+ I  T  +  P+  +A V+ +P++     K K  ++ ++  Y+ +   F+   S+    ++IKE T   + +FV +  N  K CL    + E  I   +    ++    + E R   EI+   + LL++       L I  ++    +D     L          E +  + L  G F+ +++      N   ++V  KA+ +  +  NA   + EIDLL K  HP+  +    S L +K + K+++VLE    NL +++  N  L  ++   +  I+ EA +++ DIS  ++      F ++  +VH DL L ++++ +T  ++I+ + +  G      ++         E F    + +  +++ LGL+ +++   R  +C++
Sbjct:   28 LWNRIVIIDSPGVGESDIMDEIVTEYL-PRAFAFIYVLNSANAGGVQ---KDRLEK-------LLTKVAGKRKEGQEEFPPKCALFVCNKWDQVPKE-----EVKEVKSHVIKKLKKCW-PGLDPESQIVYMSTIMADTAQRHGIITEDFSSLMNGVKAMVSRTIEARLEIHWKWLDDLLTRITYHATAYVKNAT-------RDRVKSEALMTFVLFRLLLIERQQNEVMEDLRNHLKDRTDTAVQRLSDYLRSDSVKSCFTSWTLDDVPKAESSWKVTKNSITRVLERRLRNIIENWEEDNHVFADTRESLLEHFQKKYNFVSGELRNLQSAVTSDEVILE----------SDAPDEETLFTLGEKIAIAITSPLWVPVGIVAFVIVSPVVGIMAIKSKLEDKSKIKKYEKDKRAFMAEASADYLDEVIKEST---LESFVKHQLNDAKLCL---KQIEARIPELVQADIVACKQLKDETRSKKEIIELYQPLLDEAVEIRGRLAIFGLSEVRAVDVSSRDL----------EWKEDDLLGRGAFASVYRGKMKTENGEERTVALKAFHEFLHPGNASVILNEIDLLTKLQHPNIVMFYGMSLLDIKGKLKVIMVLEHCKGNLKSHVFRNLSLAPANSKNSATIR-EACRWVKDISAALA------FIHQQGVVHRDLKLENVLLSETNSAKITDVGVSKGAHDITGTLAGTPVYMAPEVFHSQVYDSKADIYSLGLLMWEIWYRRQVFCEV 723          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A1S3JC42 (uncharacterized protein LOC106171980 OS=Lingula unguis OX=7574 GN=LOC106171980 PE=4 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 3.203e-21
Identity = 119/542 (21.96%), Postives = 235/542 (43.36%), Query Frame = 1
Query:  499 ECKKFPILIVGEAKAGKSTFINILLNKDLMPTGMKVCNRIMCEIQNSTEQ--MVTFSGPDV------------KSLTLGIEDLTXXXXXXXXXXXXXFVMANFKYPVNFLENYTYLVDSPGIGDTLLLENMTLEYLRENSPALIFVLNSTNCYGLDIKTKTLIEKSKEIFCDTEHSFSNFKSPSGHIFQFEKAIFIINHMDVIINEISSQLELEAFKKKIVNKIKTLWHENIDEKRQIFFISAKKA-REWQDNGIVQDVITDIRNCIRRLIVYIYEKNLQFSIKKLDLLCSKFEKKILTKLNNRVDYEYHRLTDRNNDQIICETLQKTLTDMAERKLKIISEIRPKFDAMAENLTEYLKSDSLENRIINSYRSKIDPDIKDIHLLVLIFQKYFENQLFQEITLWEKDSKQMETLYNYLYDSIKKNLNEICNQINASENILNKEYFFQFWNESCETENSNSADE-FIDRIEKVFIISTLTMLFPIVALAGVLATPLIISHIFKEKQYNEEQMLLYKNNPETFLKFQSSKIIKELTSKIIRNFV 2076
            EC   PIL+ GE  AGKS+ +N+LL ++++P  +      +C+++N   +  +V    PD             K+    I+D  +     K +  + +      +P+  L+   ++VDSPG+G+   +  + ++YL   + A I+V+NS N  G+    +  +EK  +I  D +            +F  E AIF+ N  D +  +     E E  +KK + K+   W + + EK Q+F++S  +A R  +      +    + + I+ L+    +  L    K ++    +    I TK+ N       +   +       + LQ+T  D+    LK+ + +  + + + + L ++L S S   R +N + +   PD  D+  +    +   +  +  E+  WE  +         LY+  K+  N +  ++   E  L  + F     +  +       DE   +  EK+ +  T  +  P+  +A ++A P+I     +EK   ++Q+  YK N    +K    + I++L S+ ++  V
Sbjct:  125 EC---PILVAGETSAGKSSLLNLLLGEEVLPYSLLSTTSTLCQLKNDDRKRAVVHLMEPDPTTGRETIEFDLKKTGDSSIQDQLQEYANSKERAADTYKFIEIFWPIPLLQGNVFIVDSPGVGENEFMNKVVMDYL-PKAFAFIYVINSGNAGGV---QEGRLEKLLKILTDPKD------RDQLQMFDPESAIFVFNKWDQVPPD-----EEEEVRKKTLEKLMRCW-QGLTEK-QVFYLSVTEAFRNLRAGAGFTEGYQKLLDGIQELVPKSLQTKLTKHHKWIEFFVGRLTYVIRTKIMNARRTMQEKQEKKEEITKRLDKLQRTSDDVL---LKMTNTLDDRIEKIVDGLHQFLSSPSTMER-LNEWNTAELPDGDDMDDIENRARTMIQKVITDEVRDWESANHNFSKARQELYEYFKREFNFLDEELRRVEGSLQDDGFS---GDGAQNALPQMTDEPLFNSTEKLVLGLTAPLWVPLALVATIIALPIIGGIAIREKVKQDKQLREYKQNKLGTMKKWFRETIEDLDSEALKERV 639          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000031104.1 (SMESG000031104.1)

HSP 1 Score: 1639.4 bits (4244), Expect = 0.000e+0
Identity = 812/835 (97.25%), Postives = 818/835 (97.96%), Query Frame = 1
Query:  754 MANFKYPVNFLENYTYLVDSPGIGDTLLLENMTLEYLRENSPALIFVLNSTNCYGLDIKTKTLIEKSKEIFCDTEHSFSNFKSPSGHIFQFEKAIFIINHMDVIINEISSQLELEAFKKKIVNKIKTLWHENIDEKRQIFFISAKKAREWQDNGIVQDVITDIRNCIRRLIVYIYEKNLQFSIKKLDLLCSKFEKKILTKLNNRVDYEYHRLTDRNNDQIICETLQKTLTDMAERKLKIISEIRPKFDAMAENLTEYLKSDSLENRIINSYRSKIDPDIKDIHLLVLIFQKYFENQLFQEITLWEKDSKQMETLYNYLYDSIKKNLNEICNQINASENILNKEYFFQFWNESCETENSNSADEFIDRIEKVFIISTLTMLFPIVALAGVLATPLIISHIFKEKQYNEEQMLLYKNNPETFLKFQSSKIIKELTSKIIRNFVFNNVEKKCLYLVDKFEKAIENNLVEKTISINSFEIERRDFMEILNSLRLLLNDMETFCSELEIIKINCETVIDPGIFVLPSIYEKVINKETRITECLSTGQFSQLFKNENYKSVVFKAYTKEFNKTNAHFQMLEIDLLRKHPSDFLIRCESALFLKAENKIMIVLESVDCNLYTYLQDNQILILSHETTNNEIQSEALQFLLDISIQISFALKYLFTYEPRMVHPDLTLYSIMVRKTSEISKIRILLGDACCNLSIKSQNKNNQSENFIMGGFTMENVFRLGLIFYQMACFRNYCKIGQMKENCENDLTSLYSFDVLMFVNPSIIKVEELPPLVPTGYRELIDKCVSQKPEYRPTITDIVKDLEDINNTIKGFIGVSNSIQASSTFEDHLSDEI 3258
            MANFKYPVNFLENYTYLVDSPGIGDTLLLENMTLEYLRENSPALIFVLNSTNCYGLDIKTKTLIEKSKEIFCDTEHSFSNFKSPSGHIFQFEKAIFIINHMDVIINEISSQLELEAFKKKIVNKIKTLWHENIDEKRQIFFISAKKAREWQDNGIVQDVITDIRNCIRRLIVYIYEKNLQFSIKKLDLLCSKFEKKILTKLNNRVDYEYHRLTDRNNDQIICE+LQKTLTDMAERKLKIISEIRPKFDAMAENLTEYLKSDSLENRIINSYRSKIDP+IKDIHLLVLIFQKYFENQLFQEITLWEKD+KQMETLYNYLYDSIKKNLNEICNQINASENILNKEYFFQFWNESCETENSNSADEFIDRIEKVFIISTLTMLFPIVALAGVLATPLIISHIFKEKQYNEEQMLLYKNNPETFLK                NFVFNNVEKKCLYLVDKFEKAIENNLVEKTISINSFEIERRDFMEILNSLRLLLNDMETFCSELEIIKINCE+VIDPGIFVLPSIYEKVINKETRITECLSTGQFSQLFKNENYKSVVFKAYTKEFNKTNAHFQMLEIDLLRKHPSDFLIRCESALFLKAENKIMIVLESVDCNLYTYLQDNQILILSHETTN EIQSEALQFLLDISIQISFALKYLFTYEPRMVHPDLTLYSIMVRKTSEISKI+ILLGDACCNLSIKSQNKNNQSENFIMGGFTMENVFRLGLIFYQMACFRNYCKIGQMKENCENDL+SLYSFDVLMFVNPSIIKVEELPPLVPTGYRELIDKCVSQKPEYRPTITDIVKDLEDINNTIKGFIGVSNSIQASSTFEDHLSDEI
Sbjct:    1 MANFKYPVNFLENYTYLVDSPGIGDTLLLENMTLEYLRENSPALIFVLNSTNCYGLDIKTKTLIEKSKEIFCDTEHSFSNFKSPSGHIFQFEKAIFIINHMDVIINEISSQLELEAFKKKIVNKIKTLWHENIDEKRQIFFISAKKAREWQDNGIVQDVITDIRNCIRRLIVYIYEKNLQFSIKKLDLLCSKFEKKILTKLNNRVDYEYHRLTDRNNDQIICESLQKTLTDMAERKLKIISEIRPKFDAMAENLTEYLKSDSLENRIINSYRSKIDPEIKDIHLLVLIFQKYFENQLFQEITLWEKDTKQMETLYNYLYDSIKKNLNEICNQINASENILNKEYFFQFWNESCETENSNSADEFIDRIEKVFIISTLTMLFPIVALAGVLATPLIISHIFKEKQYNEEQMLLYKNNPETFLK----------------NFVFNNVEKKCLYLVDKFEKAIENNLVEKTISINSFEIERRDFMEILNSLRLLLNDMETFCSELEIIKINCESVIDPGIFVLPSIYEKVINKETRITECLSTGQFSQLFKNENYKSVVFKAYTKEFNKTNAHFQMLEIDLLRKHPSDFLIRCESALFLKAENKIMIVLESVDCNLYTYLQDNQILILSHETTNKEIQSEALQFLLDISIQISFALKYLFTYEPRMVHPDLTLYSIMVRKTSEISKIKILLGDACCNLSIKSQNKNNQSENFIMGGFTMENVFRLGLIFYQMACFRNYCKIGQMKENCENDLSSLYSFDVLMFVNPSIIKVEELPPLVPTGYRELIDKCVSQKPEYRPTITDIVKDLEDINNTIKGFIGVSNSIQASSTFEDHLSDEI 819          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000031112.1 (SMESG000031112.1)

HSP 1 Score: 571.622 bits (1472), Expect = 0.000e+0
Identity = 332/794 (41.81%), Postives = 494/794 (62.22%), Query Frame = 1
Query:  847 MTLEYLRENSPALIFVLNSTNCYGLDIKTKTLIEKSKEIFCDTEHSF----SNFKSPSGHIFQFEKAIFIINHMDVIINEISSQLELEAFKKKIVNKIKTLWHENIDEKRQIFFISAKKAREWQDNGIVQDVITDIRNCIRRLIVYIYEKNLQFSIKKLDLLCSKFEKKILTKLNNRVDYEYHRLTDRNNDQIICETLQKTLTDMAERKLKIISEIRPKFDAMAENLTEYLKSDSLENRIINSYRSKIDPDIKDIHLLVLIFQKYFENQLFQEITLWEKDSKQMETLYNYLYDSIKKNLNEICNQINASENILNKEYFFQFWNESCETENSNSADEFIDRIEKVFIISTLTMLFPIVALAGVLATPLIISHIFKEKQYNEEQMLLYKNNPETFLKFQSSKIIKELTSKIIRNFVFNNVEKKCLYLVDKFEKAIENNLVEKTISINSFEIERRDFMEILNSLRLLLNDMETFCSELEIIKINCETVIDPGIFVLPSIYEKVINKETRITECLSTGQFSQLFKNENYKSVVFKAYTKEFNKTNAHFQMLEIDLLRKHPSDFLIRCESALFLKAENKIMIVLESVDCNLYTYLQDNQILILSHETTNNEIQSEALQFLLDISIQISFALKYLFTYEPRMVHPDLTLYSIMVRKTSEISKIRILLGDACCNL----SIKSQNKNNQSE--NFIMGGFTMENVFRLGLIFYQMACFRNYCKIGQMKENCENDLTSLYSFDVL-----MFVNPSIIKVEELPPLVPTGYRELIDKCVSQKPEYRPTITDIVKDLEDINNT 3183
            MT +YL+  +PA IFVLN+TNC GL+IK   LI+K+K         +    SN        FQ+ KAIFI+NH D I     S  E+E  ++KI+ +IK LWHE+++E  QIFFISA +A EWQ N IVQ  I +IRNCI++L+V +Y+KN+  S++  +++    E KIL K+N  VD +Y RL D+ + + +CE L+  +T+M  RK KI  +++PKFD MAE LT++LKS  +ENRI+     +I+   +++ L+ ++ +K  E ++++EI +WE+ +KQME LY++L    +KNL+EI N+I  S  ++NKE   + WN S + E S+     I +IE VFIIST+T+LFP+VALAG+LATPLI++H+FKE++ NE+++L YK+NP  +LK   S  +++L++  +R   FNNV+KKC   +  FEK +   + EK   I   + E R+  EIL S+ +L  ++E+   E   ++   E   D  + V    YEK+I+ E R TE L  G+ S +FKN +Y S VFKAY  +F + NA +QM EI LL K PSD ++RC+    L+ E K+++VL+ VDCNL  +L +N+ LI   +  + E   +A  F+LD+SIQI   L++L +YEPRMVHPDL L +I++RK +   K+ I + DA  NL    +++   K  ++E   F MGG+T  N+F+LG IFY++A F    +I Q       +L +L S D L     +  +P I    E    VP  Y ELI +CVS KPE RP I  +++ L +I+ T
Sbjct:    1 MTFDYLKNCAPAFIFVLNATNCSGLNIKAHELIKKAKADLTKEAEKYITDLSNINQVKEVYFQYHKAIFILNHWDTIKKNAGSIEEVENVRQKIIKEIKRLWHESVEENEQIFFISALQANEWQKNKIVQTEIINIRNCIKKLVVNLYKKNILNSLQLFNIVLYNIESKILQKINTTVDKKYCRLYDKKHAEWLCEKLESIITEMEHRKFKIKEQLQPKFDTMAEALTKHLKSPEVENRILEISLKQINVH-ENMELINIVLKKILETKIYEEIKIWEEKNKQMENLYSFLNGLFEKNLDEISNEIKISNTLINKESLIKAWNMSNQVEVSDIDKNLISKIETVFIISTITLLFPVVALAGLLATPLIMNHMFKEQRTNEKKLLEYKDNPSKYLKNLISTNLQKLSAAEVRKSFFNNVQKKCEDHIKSFEKFLTLEINEKKQLILDIDNEDRETPEILKSMCILFRNIESCYGEYHSLRNLYEFSRDCCLIVPGYHYEKLIDSENRETETLINGKHSTVFKNHHYPSFVFKAYDSKFLQYNARYQMQEILLLIKAPSDGILRCQHICLLEKEEKVLLVLDEVDCNLEKFLMENKKLIPGKQKRDTEPWKKACSFILDVSIQICQGLQHLHSYEPRMVHPDLRLDTILIRKVNNSEKLEIFICDASSNLINKRNLRKSGKYPETEENTFDMGGYTKGNIFKLGEIFYKLAQFEERMEISQ-------NLVTLSSIDPLDPLDSIESSPEIDWENEKHLNVPNEYNELIKECVSYKPENRPNIDIVIEKLRNIHVT 786          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000031101.1 (SMESG000031101.1)

HSP 1 Score: 360.533 bits (924), Expect = 1.527e-117
Identity = 180/182 (98.90%), Postives = 182/182 (100.00%), Query Frame = 1
Query:  142 MDISSNCFPSEEDIKKIPTYRKGNDILKKLGIKLENVENLNDVKEVLMLKYHRNQDQNEEIRETKLYKEYPQIMNKLKALLKKMEKFKNSKRFKDELGEIFKLKENKIETIVKPLKKMIECKKFPILIVGEAKAGKSTFINILLNKDLMPTGMKVCNRIMCEIQNSTEQMVTFSGPDVKSLT 687
            MDISSNCFPSEEDIKKIPTYRKGNDILKKLGIKLENVENLNDVKEVLMLKYHRNQDQNEEIRETKLYKEYPQIM+KLKALLKKMEKFKNSKRFKDELGEIFKLKENKIETIVKPLKKMIECKKFPILIVGEAKAGKSTFINILLNKDLMPTGMKVCNRIMCEIQNSTEQMVTFSGPDVKSL+
Sbjct:    1 MDISSNCFPSEEDIKKIPTYRKGNDILKKLGIKLENVENLNDVKEVLMLKYHRNQDQNEEIRETKLYKEYPQIMDKLKALLKKMEKFKNSKRFKDELGEIFKLKENKIETIVKPLKKMIECKKFPILIVGEAKAGKSTFINILLNKDLMPTGMKVCNRIMCEIQNSTEQMVTFSGPDVKSLS 182          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000031118.1 (SMESG000031118.1)

HSP 1 Score: 357.066 bits (915), Expect = 4.881e-110
Identity = 232/621 (37.36%), Postives = 360/621 (57.97%), Query Frame = 1
Query: 1333 EKKILTKLNNRVDYEYHRLTDRNNDQIICETLQKTLTDMAERKLKIISEIRPKFDAMAENLTEYLKSDSLENRIINSYRSKIDPDIKDIHLLVLIFQKYFENQLFQEITLWEKDSKQMETLYNYLYDSIKKNLNEICNQINASENILNKEYFFQFWNESCETENSNSADEFIDRIEKVFIISTLTMLFPIVALAGVLATPLIISHIFKEKQYNEEQMLLYKNNPETFLKFQSSKIIKELTSKIIRNFVFNNVEKKCLYLVDKFEKAIENNLVEKTISINSFEIERRDFMEILNSLRLLLNDMETFCSELEIIKINCETVIDPGIFVLPSIYEKVINKETRITECLSTGQFSQLFKNENYKSVVFKAYTKEFNKTNAHFQMLEIDLLRKHPSDFLIRCESALFLKAENKIMIVLESVDCNLYTYLQDNQILILSHETTNNEIQSEALQFLLDISIQISFALKYLFTYEPRMVHPDLTLYSIMVRKTSEISKIRILLGDACCNL----SIKSQNKNNQSENFIMGGFTMENVFRLGLIFYQMACFRNYCKIGQMKENCENDLTSLYSFDVLMFV--NPSIIKVEELPPLVPTGYRELIDKCVSQKPEYRPTITDIVKDLEDIN 3177
            E KIL K+N  VD +Y RL D+ + + +CE L+  +T+M  RK KI  +++ KFD MAE LT+YLKS  +ENRI+     +I+   +++ L+ ++ +K  E ++++EI +WE+++KQME LY++L    +KNL+EI N+I  S  ++NKE   + WN S + E S+     ID+              PI  L       LI++H+FKE++ NE+++L YK+NP  ++K   S  +++L++  +R   FNNV+KKC  L+  FEK     + EK   I   + E R+  EIL S+ +L  ++E+   E   ++   E   D  + V    YEK+I+ + R  E L+ G+ S +FKN +Y S VFKAY  +F + NA +QM EI LL K PS+ ++RC+    L+ E K+++VL+ VDCNL  +L +N+ LI   +  + E   +A  F+LD+SIQI   L+ L +YEPRMVHPDL L  +++RK +   K+ I + DA  NL    +++   K  ++E  I    T  N+F+LG IFY++A F    +I Q       +L +L   D L  +  +P I    E    VP  Y ELI +CVS KPE RP I  +++ L +I+
Sbjct:   32 ESKILQKINTTVDKKYCRLYDKKHAEWLCEKLESIITEMEHRKFKIKEQLQSKFDTMAEALTKYLKSPEVENRILEISLKQINVH-ENMELINIVLKKILETKIYEEIKIWEENNKQMENLYSFLNGLFEKNLDEISNEIKISNTLINKESLIKAWNMSNQVEVSD-----IDK-------------NPISKLI------LIMNHMFKEQRTNEKKLLEYKDNPSKYIKNFISTDLQKLSAAEVRKSFFNNVQKKCEDLIKSFEKFFTLEINEKKQLILDIDNEDRETPEILKSMCILFRNIESCYGEYHSLRNLYEFSRDCCLIVPGYHYEKLIDSDKREMEILTNGKHSTVFKNHHYPSFVFKAYDSKFLQYNARYQMQEILLLSKAPSNGILRCQHICLLEKEEKVLLVLDEVDCNLEKFLMENKKLIPGKQKRDTEPWKKACLFILDVSIQICQGLQNLNSYEPRMVHPDLRLGRVLIRKVNNSEKLEIFICDASSNLIFKRNLRKSGKYTETEENIFD--TKGNIFKLGEIFYKLAQFEERMEITQ-------NLVTLSPIDPLDSIESSPEIDWKNEKHLNVPNEYNELIKECVSYKPENRPNIDIVIEKLRNIH 618          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000031118.1 (SMESG000031118.1)

HSP 1 Score: 357.066 bits (915), Expect = 1.029e-109
Identity = 232/621 (37.36%), Postives = 360/621 (57.97%), Query Frame = 1
Query: 1333 EKKILTKLNNRVDYEYHRLTDRNNDQIICETLQKTLTDMAERKLKIISEIRPKFDAMAENLTEYLKSDSLENRIINSYRSKIDPDIKDIHLLVLIFQKYFENQLFQEITLWEKDSKQMETLYNYLYDSIKKNLNEICNQINASENILNKEYFFQFWNESCETENSNSADEFIDRIEKVFIISTLTMLFPIVALAGVLATPLIISHIFKEKQYNEEQMLLYKNNPETFLKFQSSKIIKELTSKIIRNFVFNNVEKKCLYLVDKFEKAIENNLVEKTISINSFEIERRDFMEILNSLRLLLNDMETFCSELEIIKINCETVIDPGIFVLPSIYEKVINKETRITECLSTGQFSQLFKNENYKSVVFKAYTKEFNKTNAHFQMLEIDLLRKHPSDFLIRCESALFLKAENKIMIVLESVDCNLYTYLQDNQILILSHETTNNEIQSEALQFLLDISIQISFALKYLFTYEPRMVHPDLTLYSIMVRKTSEISKIRILLGDACCNL----SIKSQNKNNQSENFIMGGFTMENVFRLGLIFYQMACFRNYCKIGQMKENCENDLTSLYSFDVLMFV--NPSIIKVEELPPLVPTGYRELIDKCVSQKPEYRPTITDIVKDLEDIN 3177
            E KIL K+N  VD +Y RL D+ + + +CE L+  +T+M  RK KI  +++ KFD MAE LT+YLKS  +ENRI+     +I+   +++ L+ ++ +K  E ++++EI +WE+++KQME LY++L    +KNL+EI N+I  S  ++NKE   + WN S + E S+     ID+              PI  L       LI++H+FKE++ NE+++L YK+NP  ++K   S  +++L++  +R   FNNV+KKC  L+  FEK     + EK   I   + E R+  EIL S+ +L  ++E+   E   ++   E   D  + V    YEK+I+ + R  E L+ G+ S +FKN +Y S VFKAY  +F + NA +QM EI LL K PS+ ++RC+    L+ E K+++VL+ VDCNL  +L +N+ LI   +  + E   +A  F+LD+SIQI   L+ L +YEPRMVHPDL L  +++RK +   K+ I + DA  NL    +++   K  ++E  I    T  N+F+LG IFY++A F    +I Q       +L +L   D L  +  +P I    E    VP  Y ELI +CVS KPE RP I  +++ L +I+
Sbjct:   62 ESKILQKINTTVDKKYCRLYDKKHAEWLCEKLESIITEMEHRKFKIKEQLQSKFDTMAEALTKYLKSPEVENRILEISLKQINVH-ENMELINIVLKKILETKIYEEIKIWEENNKQMENLYSFLNGLFEKNLDEISNEIKISNTLINKESLIKAWNMSNQVEVSD-----IDK-------------NPISKLI------LIMNHMFKEQRTNEKKLLEYKDNPSKYIKNFISTDLQKLSAAEVRKSFFNNVQKKCEDLIKSFEKFFTLEINEKKQLILDIDNEDRETPEILKSMCILFRNIESCYGEYHSLRNLYEFSRDCCLIVPGYHYEKLIDSDKREMEILTNGKHSTVFKNHHYPSFVFKAYDSKFLQYNARYQMQEILLLSKAPSNGILRCQHICLLEKEEKVLLVLDEVDCNLEKFLMENKKLIPGKQKRDTEPWKKACLFILDVSIQICQGLQNLNSYEPRMVHPDLRLGRVLIRKVNNSEKLEIFICDASSNLIFKRNLRKSGKYTETEENIFD--TKGNIFKLGEIFYKLAQFEERMEITQ-------NLVTLSPIDPLDSIESSPEIDWKNEKHLNVPNEYNELIKECVSYKPENRPNIDIVIEKLRNIH 648          
The following BLAST results are available for this feature:
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|B2IZD3|BDLP_NOSP72.051e-726.34Bacterial dynamin-like protein OS=Nostoc punctifor... [more]
sp|P40983|YOR6_CALSR1.619e-627.11Uncharacterized protein in xynA 3'region (Fragment... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2B4RY202.056e-2920.90CBL-interacting serine/threonine-protein kinase 13... [more]
A0A2B4S0F42.026e-2320.13Dual specificity protein kinase shkA OS=Stylophora... [more]
A0A3M6TS086.015e-2320.40Protein kinase domain-containing protein OS=Pocill... [more]
A0A2B4S0P28.011e-2221.12Dual specificity protein kinase shkA OS=Stylophora... [more]
A0A1S3JC423.203e-2121.96uncharacterized protein LOC106171980 OS=Lingula un... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000031104.10.000e+097.25SMESG000031104.1[more]
SMESG000031112.10.000e+041.81SMESG000031112.1[more]
SMESG000031101.11.527e-11798.90SMESG000031101.1[more]
SMESG000031118.14.881e-11037.36SMESG000031118.1[more]
SMESG000031118.11.029e-10937.36SMESG000031118.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016769 ID=SMED30016769|Name=Protein kinase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3339bp
ATTTTTATAACAATGCACACGTCACAATTAAAACATTCAAAGATCAATTG
TTTATGATATCAGTTAATATAAACAATTGTAATAATAAATCAATAATCAC
AGATAATTACAAAATTATTTGATCTCAGATCATTTCTGCTTATGGATATT
AGTTCAAATTGTTTTCCCTCGGAAGAAGATATAAAGAAAATTCCCACTTA
TAGAAAAGGAAACGATATATTGAAAAAGCTTGGAATTAAATTGGAAAATG
TCGAAAATCTTAACGATGTAAAAGAAGTGCTGATGTTAAAATATCATCGG
AACCAAGATCAAAATGAGGAGATTCGAGAAACCAAACTTTATAAAGAATA
TCCTCAAATAATGAATAAACTTAAAGCCTTATTGAAAAAAATGGAAAAAT
TCAAGAATTCTAAAAGATTTAAAGATGAGCTTGGAGAAATATTTAAACTT
AAAGAAAACAAAATCGAAACAATTGTCAAACCGTTAAAAAAAATGATTGA
ATGCAAGAAATTTCCTATCTTAATTGTGGGAGAAGCCAAAGCGGGTAAAA
GCACTTTTATTAATATATTATTAAATAAAGATTTAATGCCAACTGGTATG
AAGGTCTGTAATCGGATTATGTGTGAAATACAAAATTCTACAGAACAGAT
GGTTACATTTTCTGGACCCGACGTTAAATCTTTAACTTTGGGAATAGAAG
ATTTGACAAAAATAAAAAAGATAATTAAAGGGAAAATAGAAGAAGGCTTC
GTTATGGCAAATTTTAAATATCCAGTCAATTTTTTGGAGAATTACACTTA
CTTGGTTGATAGTCCTGGAATTGGAGATACTTTACTTTTGGAAAATATGA
CTTTAGAATATTTGCGCGAAAATTCGCCGGCTTTGATATTTGTTTTAAAT
TCCACAAATTGTTATGGTCTAGATATCAAAACAAAAACTTTAATTGAAAA
ATCCAAAGAGATATTTTGCGACACAGAACATTCGTTCTCAAATTTTAAAA
GCCCGAGTGGGCATATTTTTCAATTTGAAAAAGCAATTTTTATTATTAAT
CACATGGATGTGATTATAAATGAAATTTCTTCACAACTTGAACTTGAGGC
TTTCAAAAAGAAAATAGTGAATAAAATAAAAACACTTTGGCACGAGAATA
TTGATGAAAAAAGACAAATATTTTTTATTTCTGCTAAAAAGGCCCGTGAA
TGGCAGGATAATGGCATTGTGCAAGACGTTATTACTGATATTCGAAACTG
CATCCGGAGGCTAATTGTTTATATATATGAGAAAAATTTACAATTTTCTA
TTAAAAAATTAGACTTGCTTTGTTCTAAATTTGAGAAGAAAATTCTTACA
AAATTAAACAATAGAGTTGACTATGAATATCACCGACTGACTGATAGGAA
CAATGATCAAATCATTTGTGAGACTTTGCAGAAAACCTTAACTGATATGG
CCGAGAGAAAACTTAAAATTATATCAGAAATAAGACCGAAATTCGATGCA
ATGGCGGAGAATTTAACCGAATATTTGAAAAGTGATTCCCTGGAAAATCG
AATAATAAATTCATATCGATCGAAAATAGATCCCGACATTAAAGATATTC
ATCTTTTGGTGTTGATTTTCCAAAAGTACTTCGAAAATCAATTGTTTCAG
GAAATAACTTTGTGGGAAAAAGATAGCAAACAAATGGAAACCCTGTATAA
TTATCTCTATGATTCTATAAAAAAGAATTTGAATGAAATTTGCAACCAAA
TCAATGCCTCTGAAAATATATTAAATAAAGAATATTTCTTCCAGTTCTGG
AATGAGAGCTGCGAGACAGAGAATTCCAATTCGGCTGATGAATTCATTGA
TAGAATTGAAAAGGTCTTTATTATTTCAACACTTACCATGCTATTTCCCA
TTGTCGCTTTGGCCGGAGTATTGGCGACCCCGTTGATTATTTCACACATA
TTCAAAGAAAAACAGTACAATGAAGAACAAATGCTTTTATATAAAAACAA
CCCAGAAACCTTTCTCAAGTTTCAATCATCAAAAATTATCAAAGAGCTTA
CATCGAAAATCATTAGAAATTTCGTGTTCAACAACGTTGAAAAAAAATGT
CTCTATCTCGTTGATAAATTTGAAAAGGCAATTGAAAATAACCTCGTAGA
AAAAACGATCTCTATTAATAGCTTCGAAATTGAAAGGAGAGATTTTATGG
AAATTCTTAATTCTTTGAGACTTCTCTTGAATGACATGGAAACCTTCTGT
TCAGAATTGGAAATCATTAAGATCAATTGTGAGACAGTTATAGATCCGGG
GATTTTTGTTTTACCCTCGATATACGAAAAGGTAATTAATAAGGAAACTC
GAATAACGGAATGTTTGAGCACTGGCCAATTTAGTCAGTTATTCAAGAAT
GAGAACTATAAATCGGTTGTTTTCAAAGCTTACACTAAAGAATTCAATAA
AACAAATGCCCACTTTCAAATGCTGGAAATTGATTTATTAAGAAAACATC
CAAGTGATTTTTTGATAAGATGTGAATCTGCGCTGTTTTTGAAAGCAGAA
AATAAAATAATGATTGTTCTTGAAAGTGTTGACTGTAATTTATATACTTA
TTTACAAGATAATCAAATTTTGATTCTTTCTCATGAAACAACAAACAACG
AGATTCAGAGCGAAGCGCTTCAATTTCTATTGGATATATCTATTCAAATC
AGCTTTGCGTTGAAATATCTTTTCACATACGAACCAAGAATGGTTCATCC
GGATTTAACATTGTATTCAATAATGGTTAGGAAGACTTCAGAAATCAGTA
AAATAAGAATTTTATTAGGTGATGCTTGTTGCAATCTGTCTATAAAAAGT
CAAAACAAAAATAATCAGTCTGAAAATTTTATCATGGGTGGGTTTACAAT
GGAAAATGTCTTTCGTCTTGGTTTAATATTTTATCAGATGGCGTGCTTTC
GAAATTACTGTAAAATTGGTCAAATGAAAGAGAATTGTGAGAATGATCTT
ACATCATTATACTCGTTTGACGTGTTAATGTTTGTGAATCCGTCTATAAT
CAAAGTAGAAGAACTACCGCCATTAGTGCCAACAGGTTACAGAGAACTGA
TTGATAAATGCGTTTCACAGAAACCAGAATATAGGCCAACTATCACAGAT
ATTGTAAAAGATTTGGAAGATATAAATAATACAATAAAGGGTTTCATTGG
GGTTTCAAATTCAATTCAGGCGTCGTCAACATTTGAAGACCATCTTAGTG
ACGAAATTTAATTATTCAATTATTTTATTAACTATTATTAATGAGGATTT
TTTCAATTAATTCCTTTGGGAGACTGTAATTTAAAATTA
back to top

protein sequence of SMED30016769-orf-1

>SMED30016769-orf-1 ID=SMED30016769-orf-1|Name=SMED30016769-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1040bp
MDISSNCFPSEEDIKKIPTYRKGNDILKKLGIKLENVENLNDVKEVLMLK
YHRNQDQNEEIRETKLYKEYPQIMNKLKALLKKMEKFKNSKRFKDELGEI
FKLKENKIETIVKPLKKMIECKKFPILIVGEAKAGKSTFINILLNKDLMP
TGMKVCNRIMCEIQNSTEQMVTFSGPDVKSLTLGIEDLTKIKKIIKGKIE
EGFVMANFKYPVNFLENYTYLVDSPGIGDTLLLENMTLEYLRENSPALIF
VLNSTNCYGLDIKTKTLIEKSKEIFCDTEHSFSNFKSPSGHIFQFEKAIF
IINHMDVIINEISSQLELEAFKKKIVNKIKTLWHENIDEKRQIFFISAKK
AREWQDNGIVQDVITDIRNCIRRLIVYIYEKNLQFSIKKLDLLCSKFEKK
ILTKLNNRVDYEYHRLTDRNNDQIICETLQKTLTDMAERKLKIISEIRPK
FDAMAENLTEYLKSDSLENRIINSYRSKIDPDIKDIHLLVLIFQKYFENQ
LFQEITLWEKDSKQMETLYNYLYDSIKKNLNEICNQINASENILNKEYFF
QFWNESCETENSNSADEFIDRIEKVFIISTLTMLFPIVALAGVLATPLII
SHIFKEKQYNEEQMLLYKNNPETFLKFQSSKIIKELTSKIIRNFVFNNVE
KKCLYLVDKFEKAIENNLVEKTISINSFEIERRDFMEILNSLRLLLNDME
TFCSELEIIKINCETVIDPGIFVLPSIYEKVINKETRITECLSTGQFSQL
FKNENYKSVVFKAYTKEFNKTNAHFQMLEIDLLRKHPSDFLIRCESALFL
KAENKIMIVLESVDCNLYTYLQDNQILILSHETTNNEIQSEALQFLLDIS
IQISFALKYLFTYEPRMVHPDLTLYSIMVRKTSEISKIRILLGDACCNLS
IKSQNKNNQSENFIMGGFTMENVFRLGLIFYQMACFRNYCKIGQMKENCE
NDLTSLYSFDVLMFVNPSIIKVEELPPLVPTGYRELIDKCVSQKPEYRPT
ITDIVKDLEDINNTIKGFIGVSNSIQASSTFEDHLSDEI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001245Ser-Thr/Tyr_kinase_cat_dom
IPR027417P-loop_NTPase
IPR022812Dynamin_SF
IPR000719Prot_kinase_dom
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane