Cytochrome P450 2W1

Overview
NameCytochrome P450 2W1
Smed IDSMED30016752
Length (bp)1782
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cytochrome P450 2W1 (SMED30016752) t-SNE clustered cells

Violin plots show distribution of expression levels for Cytochrome P450 2W1 (SMED30016752) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cytochrome P450 2W1 (SMED30016752) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cytochrome P450 2W1 (SMED30016752) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016752

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30016752SMESG000059212.1 SMESG000048645.1 SmedASXL_007534SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30016752SMESG000059212.1 SMESG000048645.1 SmedASXL_003045SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30016752SMESG000059212.1 SMESG000048645.1 dd_Smed_v4_20345_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cytochrome P450 2W1 vs. Ensembl Human
Match: CYP2U1 (cytochrome P450 family 2 subfamily U member 1 [Source:HGNC Symbol;Acc:HGNC:20582])

HSP 1 Score: 125.946 bits (315), Expect = 5.229e-30
Identity = 118/460 (25.65%), Postives = 212/460 (46.09%), Query Frame = 2
Query:  422 MHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKRRGVLSSD-GQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRN------PGSIRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYI----KNVQIITSSNLTFSNAVFPLTNVPLLKYCVPSVLRIKKAMDNNV-NILTELWKESKENCETNELESSSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNF-----SDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIELTNESKLNFEEILNGENGLVFAPFCHNLKFSR 1747
            + ++YG+I+SF I +   VVL       EA        S RP   L   V+K +GV+ +  G +W   RK +   L          E  I E  K +   + ++      P SI ++ + +     II  + F    D+ + + KK +    + ++I  +S +   N        P L Y      +  + ++ ++ + L ++ K+ +E+ +          + YL  +      EEE ++ ++ +F   +      D+  AG+DT   +L WC L ++    +Q K+  EI   +        S +DK+Q+PY  + I EV R   ++P  + H   +N +  GY + +  +IL + ++ + +  IW   + F  +RF++++ + IK  +E F PFG GKR C+GE LA+ E+ L  V+L+  +   L  +SK   + +L G  GL  AP   N+  SR
Sbjct:  110 LARVYGSIFSFFIGHYLVVVLSDFHSVREALVQQAEVFSDRPRVPLISIVTKEKGVVFAHYGPVWRQQRKFSHSTLRHFGLGKLSLEPKIIEEFKYVKAEMQKHGEDPFCPFSIISNAVSN-----IICSLCFGQRFDYTNSEFKKMLGFMSRGLEICLNSQVLLVNIC------PWLYYLPFGPFKELRQIEKDITSFLKKIIKDHQESLDREN--PQDFIDMYLLHM------EEERKNNSNSSFDEEYLFYIIGDLFIAGTDTTTNSLLWCLLYMSLNPDVQEKVHEEIERVIGANRAP--SLTDKAQMPYTEATIMEVQRLTVVVPLAIPHMTSENTVLQGYTIPKGTLILPNLWSVHRDPAIWEKPEDFYPNRFLDDQGQLIK--KETFIPFGIGKRVCMGEQLAKMELFLMFVSLMQSFAFALPEDSK---KPLLTGRFGLTLAPHPFNITISR 543          
BLAST of Cytochrome P450 2W1 vs. Ensembl Human
Match: CYP2J2 (cytochrome P450 family 2 subfamily J member 2 [Source:HGNC Symbol;Acc:HGNC:2634])

HSP 1 Score: 117.472 bits (293), Expect = 2.418e-27
Identity = 116/450 (25.78%), Postives = 190/450 (42.22%), Query Frame = 2
Query:  428 KIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKRRGVLSSDGQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNPGSIRTSNL-FHSMTLTIIFKIVFNINTDFDD---EKIKKYIKNVQIITSSNLTFSNAVFPLTNVPLLKYCVPSVLRIKKAMDNNVNILTELWKE---------SKENCETNELESSSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTVHRPMK-NLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIELTNESKLNFEEILNGENGLVFAPFCHNL 1735
            K YGN++S  + +   V++    L  EA  H       RP+T + +++ K+ G++ S GQ W   R+ T  AL       +  E+ I E  + L   I    G     +   ++    II  I F    ++ D   +++ K +  V  + +S       VFP                I K +      L   WK+          K   + N  E+    + YLK  +++K         ++ N I +  D+  AG++T + TL W  L +A   +IQ K+++EI+  +        S + +  +PY  + I EV R   IIP  V R +  +    GY L +  +IL +    + +   W   D F  D F+EN + K +   E F PF  GKR C+GE LAR E+ +   +L+  +     N  KL+    L    G+  +P  H L
Sbjct:   73 KKYGNLFSLELGDISAVLITGLPLIKEALIHMDQNFGNRPVTPMREHIFKKNGLIMSSGQAWKEQRRFTLTALRNFGLGKKSLEERIQEEAQHLTEAIKEENGQPFDPHFKINNAVSNIICSITFGERFEYQDSWFQQLLKLLDEVTYLEASKTCQLYNVFPW---------------IMKFLPGPHQTLFSNWKKLKLFVSHMIDKHRKDWNPAETRDFIDAYLK--EMSKHTGNPTSSFHEENLICSTLDLFFAGTETTSTTLRWALLYMALYPEIQEKVQAEIDRVIGQGQQP--STAARESMPYTNAVIHEVQRMGNIIPLNVPREVTVDTTLAGYHLPKGTMILTNLTALHRDPTEWATPDTFNPDHFLENGQFKKR---EAFMPFSIGKRACLGEQLARTELFIFFTSLMQKFTFRPPNNEKLS----LKFRMGITISPVSHRL 496          
BLAST of Cytochrome P450 2W1 vs. Ensembl Human
Match: CYP2E1 (cytochrome P450 family 2 subfamily E member 1 [Source:HGNC Symbol;Acc:HGNC:2631])

HSP 1 Score: 112.464 bits (280), Expect = 1.124e-25
Identity = 109/445 (24.49%), Postives = 211/445 (47.42%), Query Frame = 2
Query:  377 NLFRIK-SNENKFFMEMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKR-RGVLSSDGQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNPG-SIRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYI----KNVQIITSSNLTFSNAVFPLTNVPLLKYCVPSVLRIKKAMDNNVNI---LTELWKESKENCETNELESSSIGEFYLKQLQLTKVYEEEH--QHLNDMNFIR-NFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIELTNESK 1669
            NLF+++  N  K F  + + +G +++  + +QR VV+   +   EA        SGR   +L  + + R RG++ ++G  W   R+ +   L       +G E  I      LL  + +  G     + L       +I  I+F  + D++DEK  + +    +N  ++++  L   N      N P   + +P   R  K + N   +   ++E  KE  ++ + N           L    L ++ +E+H  + L  M+ I    +D+  AG++T + TL +  L+L    +I+ KL  EI+  +    +   +  D+ ++PY+ + + E+ R+ T++P  + H   ++ IF GY + +  +++    +  ++   +P+ +KF  + F+ N+  K K+  + F PF TGKR C GE LAR E+ L L A++ H+ ++   + K
Sbjct:   44 NLFQLELKNIPKSFTRLAQRFGPVFTLYVGSQRMVVMHGYKAVKEALLDYKDEFSGR--GDLPAFHAHRDRGIIFNNGPTWKDIRRFSLTTLRNYGMGKQGNESRIQREAHFLLEALRKTQGQPFDPTFLIGCAPCNVIADILFRKHFDYNDEKFLRLMYLFNENFHLLSTPWLQLYN------NFPSFLHYLPGSHR--KVIKNVAEVKEYVSERVKEHHQSLDPNCPRD-------LTDCLLVEMEKEKHSAERLYTMDGITVTVADLFFAGTETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRIP--AIKDRQEMPYMDAVVHEIQRFITLVPSNLPHEATRDTIFRGYLIPKGTVVVPTLDSVLYDNQEFPDPEKFKPEHFL-NENGKFKY-SDYFKPFSTGKRVCAGEGLARMELFLLLCAILQHFNLKPLVDPK 467          
BLAST of Cytochrome P450 2W1 vs. Ensembl Human
Match: CYP2E1 (cytochrome P450 family 2 subfamily E member 1 [Source:HGNC Symbol;Acc:HGNC:2631])

HSP 1 Score: 112.464 bits (280), Expect = 1.124e-25
Identity = 109/445 (24.49%), Postives = 211/445 (47.42%), Query Frame = 2
Query:  377 NLFRIK-SNENKFFMEMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKR-RGVLSSDGQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNPG-SIRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYI----KNVQIITSSNLTFSNAVFPLTNVPLLKYCVPSVLRIKKAMDNNVNI---LTELWKESKENCETNELESSSIGEFYLKQLQLTKVYEEEH--QHLNDMNFIR-NFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIELTNESK 1669
            NLF+++  N  K F  + + +G +++  + +QR VV+   +   EA        SGR   +L  + + R RG++ ++G  W   R+ +   L       +G E  I      LL  + +  G     + L       +I  I+F  + D++DEK  + +    +N  ++++  L   N      N P   + +P   R  K + N   +   ++E  KE  ++ + N           L    L ++ +E+H  + L  M+ I    +D+  AG++T + TL +  L+L    +I+ KL  EI+  +    +   +  D+ ++PY+ + + E+ R+ T++P  + H   ++ IF GY + +  +++    +  ++   +P+ +KF  + F+ N+  K K+  + F PF TGKR C GE LAR E+ L L A++ H+ ++   + K
Sbjct:   44 NLFQLELKNIPKSFTRLAQRFGPVFTLYVGSQRMVVMHGYKAVKEALLDYKDEFSGR--GDLPAFHAHRDRGIIFNNGPTWKDIRRFSLTTLRNYGMGKQGNESRIQREAHFLLEALRKTQGQPFDPTFLIGCAPCNVIADILFRKHFDYNDEKFLRLMYLFNENFHLLSTPWLQLYN------NFPSFLHYLPGSHR--KVIKNVAEVKEYVSERVKEHHQSLDPNCPRD-------LTDCLLVEMEKEKHSAERLYTMDGITVTVADLFFAGTETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRIP--AIKDRQEMPYMDAVVHEIQRFITLVPSNLPHEATRDTIFRGYLIPKGTVVVPTLDSVLYDNQEFPDPEKFKPEHFL-NENGKFKY-SDYFKPFSTGKRVCAGEGLARMELFLLLCAILQHFNLKPLVDPK 467          
BLAST of Cytochrome P450 2W1 vs. Ensembl Human
Match: CYP2W1 (cytochrome P450 family 2 subfamily W member 1 [Source:HGNC Symbol;Acc:HGNC:20243])

HSP 1 Score: 111.309 bits (277), Expect = 2.770e-25
Identity = 102/429 (23.78%), Postives = 185/429 (43.12%), Query Frame = 2
Query:  377 NLFRIKSNENKFFMEMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKRRGVLSSDGQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNPGSIRTSNLFHSMTLTIIFKIVFNINTDFDDE---KIKKYIKNVQI-ITSSNLTFSNAVFPLTNVPLLKYCVPSVLRIKKAMDNNVNILTELWKESKEN-CETNELESSSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTVHRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKI 1648
            +L R+ S +++  ME+ + YG +++  +  Q+ VVL   E   EA    G  L+ RP   +++ + +  G+  S G  W   R+ T +ALH +        D I + +K L   +D   G      L       I F ++F    D+ D     +   I  V + + S  L   N V+P     LL+   P + +I++       IL  L +  + + C  + + S      Y+  L      ++      + N +    D+V AG++T +ATL W  LL+     +Q +++ E++  +           D+  LPY  + + EV R+ T++P        +    G+ L +   ++    +   +   W    +F    F++     +K  +E F PF  G+R C+GE LAR E+ L    L+  Y++
Sbjct:   45 HLLRL-SQQDRSLMELSERYGPVFTVHLGRQKTVVLTGFEAVKEALAGPGQELADRPPIAIFQLIQRGGGIFFSSGARWRAARQFTVRALHSLGVGREPVADKILQELKCLSGQLDGYRGRPFPLALLGWAPSNITFALLFGRRFDYRDPVFVSLLGLIDEVMVLLGSPGLQLFN-VYPWLGA-LLQLHRPVLRKIEEVR----AILRTLLEARRPHVCPGDPVCS------YVDALIQQGQGDDPEGLFAEANAVACTLDMVMAGTETTSATLQWAALLMGRHPDVQGRVQEELDRVLGPGRTP--RLEDQQALPYTSAVLHEVQRFITLLPHVPRCTAADTQLGGFLLPKGTPVIPLLTSVLLDETQWQTPGQFNPGHFLDANGHFVK--REAFLPFSAGRRVCVGERLARTELFLLFAGLLQRYRL 456          
BLAST of Cytochrome P450 2W1 vs. Ensembl Celegans
Match: cyp-33C2 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:O44706])

HSP 1 Score: 110.538 bits (275), Expect = 1.528e-25
Identity = 106/472 (22.46%), Postives = 215/472 (45.55%), Query Frame = 2
Query:  368 LFKNLFRIKSNENKF--FMEMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGR---PLTELYKYVSKRRGVLSSDGQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNPGS-IRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYIKNVQIITSSNLTFSNA-VFPLTNVPLLKYCVPSVL---RIKKAMDNNVNILTELWKESKENCETNEL--ESSSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIELTNESKLNFEEILNGENGLVFAP--FCHNLK 1738
            +F NL  I +    +  F    K YG+I++F I N  ++++   +   E +     T + +   P  +L++      G++ S+G  W  +R+     + +        ++ I   ++ +   +D   GS      +F      ++ +++F     F   K  +Y +  +II +    F    +F   N+P++   +P  +     K   D       +  +  ++  + N+L  ES+   E +LK+ Q  +  E + +  +++       D+  AG +T   T+ W    +    ++Q+K+  E+++ +    +I  + +DK+ LPY  +FI E  R   I+P  + H   ++ + +G+K+ +   ++    T  +N +++P+   F  DRF++ +  K+K ++E   PF  GKR+C GE LAR E+ L +   +  YKI  + E   +    ++  NG + AP  F   LK
Sbjct:   34 VFGNLLSIANPPPGYEAFERWTKKYGDIYTFWIGNTPHIMINTWDKIKETYIRDAETYTNKVRLPALDLFR--GGEYGIIDSNGATWREHRRFALSTMRDFGLGKNLMQENILMEVQDVFARLDAKLGSETDIPEVFDHAVANVVNQLLFGYR--FVGPKESEYQELKRIIEAPTDLFGKPHMFLAMNIPVIAKLMPEFMYEGPFKDFRDTAFAFFNKQIEAHRQEVDLNDLNSESTDFVETFLKE-QKRRESEGDSETFSNVQLSNVCMDLWFAGLNTTTNTITWAISYILHHPEVQDKVHEEMDKVIGSDRLI--TTADKNDLPYFNAFINEAQRGINIVPLNLQHATTRDTVINGFKIPKGTGVVAQISTVMNNEEVFPDPHTFNPDRFID-EHGKLKRVEE-LAPFSVGKRSCPGEGLARMELFLFIANFLNRYKIYPSKEGPPS----MDKSNGALIAPRLFSATLK 492          
BLAST of Cytochrome P450 2W1 vs. Ensembl Celegans
Match: cyp-33D1 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:O45659])

HSP 1 Score: 109.768 bits (273), Expect = 2.938e-25
Identity = 106/440 (24.09%), Postives = 202/440 (45.91%), Query Frame = 2
Query:  368 LFKNLFRIKSNENKFFMEMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKRR-GVLSSDGQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNPG------SIRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYIKNVQIITSSNLTFSNAVFPLTN--VPLLKYCVPSVLRIKKAMDNNVNIL-TELWKESKENCETNELESSSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIP-RTVHRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIEL 1654
            L  NL +++      F +  K +G +++F + ++ ++ + + E+  E F   G T + + L ++ K   +R  GVL ++G++W  +R+ T   L ++       ++ I   I+     I+ + G      S+    + + + LT+ F   F  N   +   +K  I  ++ + S    F   + P ++  +P      P++    K M   +++   +  +E ++  + + +ES    E YLK+ Q  +  + +H+   +        D+  AG  T   TL W          +Q K+R E++  +    +I  + +DK+ LPYL +FI E  R   IIP   +H   ++ +  GY + +   ++    T   +  I+P+A  F   RF+EN   K+K + E   PF  GKR C+GE LAR E+ L    +   Y ++L
Sbjct:   34 LVGNLLQLQKFGYDIFHKWKKEFGPVFTFWLADRPFIFITSYEVMKETFVKDGDTFADKQLNQIDKKKLQRNYGVLDTNGEMWREHRRFTLSQLRDLGLGKDLMQEKILLEIEEQFKDINSHLGEEIDLPSVLDRGVGNVINLTL-FNKRFETNQRDEFTYLKSLIDGLRDVASEFRYFIQFLVPWSSKIIP-----GPTLGDKTKGMKEELDVFFVKQVEEHRKEIDFDTVESYDYVEAYLKE-QKKREADGDHETFCNKQLYAMCFDLWMAGLQTTTVTLTWGFSFYLHNADVQLKIREELDRVIGNDRLI--TTADKNCLPYLTAFINETQRCANIIPFNLLHVATRDTVIEGYPVKKGTGVIAQIGTVMSDEQIFPDAHCFNPGRFIENG--KLKKVDE-VIPFSIGKRQCLGEGLARMELFLFFANIFNRYDVQL 461          
BLAST of Cytochrome P450 2W1 vs. Ensembl Celegans
Match: cyp-33D3 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:G5EE22])

HSP 1 Score: 104.76 bits (260), Expect = 1.355e-23
Identity = 104/419 (24.82%), Postives = 185/419 (44.15%), Query Frame = 2
Query:  413 FMEMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYK-YVSKRRGVLSSDGQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNPGS-IRTSNLFHSMTLTIIFKIVFNINTDFD--DE--KIKKYIKNVQIITSSNLTFSNAVFPLTNVPLLKYCVPSVLRIKKAMDNNVNILTELWKESKENCETNELESSSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIP-RTVHRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKI 1648
            F    K YG I++F + N+ +V++ + E   E F   G T   + LT   K  + +  GVL ++G +W  +R+ T   L ++       ++ I   ++ L   +D + G  I    L       +I   +FN   D D  DE   +K  I  ++ +TS        + P T+  L    +   +R K+   ++         E +   + +  E+    E YLK+ Q  +  + + +   +        D+  AG  T   T+ W         ++Q K+R E+++ +    +I  S +DK+ LPYL +F+ E  R   IIP   +H   ++ +  G+ + +   ++    T  ++  ++P   KF  +RF+EN   K K + E   PF  GKR C+GE LAR E+ L    +   Y +
Sbjct:   51 FSNWKKEYGPIFTFWMANKPFVIIASYEKMKETFVKDGDTYVDKQLTHTEKERLGENYGVLDTNGHMWKEHRRFTLTQLRDLGLGKDLMQEKILMEVEELFKELDAHGGEEIDLPKLIDRSVGNVINLTLFNKRFDMDKRDEFAHLKSLIDGMRNVTSQFRYLIQYLVPWTSTVLPGPTLSEKVRAKREELDD--FFYSQIDEHRNEIDFDNTENLDFVEAYLKE-QKKREEDGDFKTFCNKQLCAMLFDLWIAGLMTTTMTMTWGLSYYLYNPEVQRKIREELDKVIGNDRLI--STADKNDLPYLQAFVTETQRTANIIPLNLIHMTTRDTVIDGFPIQKGTGVIAQISTVMYDEKVFPEPYKFKPERFIENG--KFKKVDE-VIPFSIGKRQCLGEGLARIELFLFFANIFNRYDV 461          
BLAST of Cytochrome P450 2W1 vs. Ensembl Celegans
Match: cyp-33C1 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:O44704])

HSP 1 Score: 103.219 bits (256), Expect = 4.693e-23
Identity = 107/464 (23.06%), Postives = 208/464 (44.83%), Query Frame = 2
Query:  368 LFKNLFRIKSNEN--KFFMEMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGR---PLTELYKYVSKRRGVLSSDGQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNPGS-IRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYIKNVQIITSSNLTFSNA-VFPLTNVPLLKYCVPSVL---RIKKAMDNNVNILTELWKESKENCETNEL--ESSSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIELTNESKLNFEEILNGENGLVFAP 1720
            +F NL  I +     K F    K YG++++F I N  ++++   +   E F     T + +   P+  L +      G++ S+G +W  +R+     + +        ++ I   ++ +   +D   GS      +F      ++ +++F     F   K  +Y +   II S    F    +F   N+P+    +P  L    IK   D  +    +  +  +   +  +L  ES+   E +LK+ Q  +  E + +  +++  +    D+  AG +T   T+ W    +    ++Q+K+  E+++ +    +I  + +DK+ LPY  + I E  R   I+P  + H   ++ +  G+K+ +   ++    T  +N +++P+   F  DRF++ +  K+K + E   PF  GKR+C GE LAR E+ L +   +  YKI   + SK     +  G +G V AP
Sbjct:   34 VFGNLLSIANPPPGYKAFERWTKKYGDVYTFWIGNTPHIMINTWDKIKETFIRDADTYTNKVVLPMVTLSR--GGEYGIIDSNGAMWREHRRFALSTMRDFGLGKNLMQENILMEVQDVFARLDAKLGSETDVPEVFDHAVANVVNQLLFGYR--FMGPKENEYQELKHIIDSPAEIFGKLHIFLAMNIPIFAKLLPESLYEGPIKTFRDTTLAFFNKQIEAHRHRIDFEDLNSESTDFVETFLKE-QKRRESEGDSETYSNIQLLNVCIDLWFAGLNTTTNTITWAISYVLHHPEVQDKIHEELDKVIGSDRLI--TTADKNDLPYFNASINESQRGINILPLNLQHATTRDTVIDGFKIPKGTGVVAQISTVMNNEEVFPDPYTFNPDRFID-ENGKLKKVDE-LAPFSVGKRSCPGEGLARMELFLFIANFLNRYKI---HPSKEGLPSMAKG-SGPVVAP 484          
BLAST of Cytochrome P450 2W1 vs. Ensembl Celegans
Match: cyp-33C3 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:O16670])

HSP 1 Score: 100.523 bits (249), Expect = 3.231e-22
Identity = 96/425 (22.59%), Postives = 186/425 (43.76%), Query Frame = 2
Query:  413 FMEMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGR-PLTELYKYVSKRRGVLSSDGQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNPG-----SIRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYIKNVQIITSSNLTFSNAVFPLTNVPLLKYCVPSVLRIKKAMDNNVNILTELWKESKENCETNELESSSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIELTNES 1666
            F    K YG++++F +    YV++ + +L  + F   G T   + P     K      G++ S+G +W  +R+     L +         + I   ++ +    D   G     S+  +N   ++    IF   F  + + D +K+++ ++  +   ++   +  A  P     L    +  +L  ++  DN  +      +  ++  + +  ES    E YLK+ Q  +    E +  ++        D+  AG  T   T+ W    + +  ++  K+RSE++E V      F + +DK+ LPY+ + I EV R   ++P  V H   ++ + +GY + +   ++    T   +  ++P+  KF  DRF++   + IK   E   PF  G+R C GE LAR E+ L +     HY+I  ++E 
Sbjct:   51 FRNWTKKYGDVYTFWMGKTPYVMISSYDLLKDTFVRDGDTYKDKYPQPFNQKIRGGNYGIVESNGHLWNTHRRFALTTLRDFGLGKDLMHEKILIEVENIFKKFDAQLGLEQDVSVVMNNAIANVINQNIFGYRFEGDKEEDFKKLRELMEYQETAFATFKVYVEAFIPKVGALLPGRSLDVLL--EEWRDNFYSFFDTQIENHRKKIDFDSQESLDYAEAYLKE-QRKQEALGEFELFSNKQLSNTCLDLWSAGLSTTYTTVTWALAYVLNSPEVLEKMRSELDEVVGKDR--FVTTADKNDLPYMNAAINEVQRCANLLPVNVAHATTRDTVINGYAIKKGTGVIAQISTVMLDEKVFPDPYKFNPDRFIDEHGKLIK--VEQLIPFSIGRRQCPGEGLARMEIFLFVANFFNHYQISPSSEG 468          
BLAST of Cytochrome P450 2W1 vs. Ensembl Fly
Match: Cyp18a1 (gene:FBgn0010383 transcript:FBtr0074610)

HSP 1 Score: 96.2857 bits (238), Expect = 1.228e-20
Identity = 102/470 (21.70%), Postives = 208/470 (44.26%), Query Frame = 2
Query:  380 LFRIKSNENKFFMEMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKRRGVLSSDGQIW-----VLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNPG---------SIRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYIKNVQIITSSNLTFSNAVFPLTNVPLLKYCVPSVLRIKKAMDNNVNILTELWKE----SKENCETNELESSSIGEFYLKQLQLTKVYEEEHQHLNDMN----FIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIP-RTVHRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIELTNESKLNFEEILNGENGLVFAP 1720
            L  + S ++  FME+ K YG+++S R+ +Q  VV+   ++  E F+    T  GRP T   + ++   G+++S G++W      L+ KL    +  + +  +  +  I   +   + ++  + G         S+  SN+  S+ ++  F I        DD K +++      +    +     +  +  +P ++ C PS+   K  +  N   +   +++     K + + N +    + +FYL +++  K    + +  +  N     ++   D+  AG +T+  TL W  + +    K   +++ E+++ V    +   +  D   LP   S I E  R  +I+P  T H P +++  +GY +     ++    + + + ++W   ++F   RF++  E K++   E F PFG G+R C+G+ LAR E+ L   + +  + I L     L     L G  G    P
Sbjct:   66 LLFMGSEKHTRFMELAKQYGSLFSTRLGSQLTVVMSDYKMIRECFRREEFT--GRPDTPFMQTLNGY-GIINSTGKLWKDQRRFLHDKLRQFGMTYMGNGKQQMQKRIMTEVHEFIGHLHASDGQPVDMSPVISVAVSNVICSLMMSTRFSI--------DDPKFRRF----NFLIEEGMRLFGEIHTVDYIPTMQ-CFPSISTAKNKIAQNRAEMQRFYQDVIDDHKRSFDPNNIRD--LVDFYLCEIEKAKAEGTDAELFDGKNHEEQLVQVIIDLFSAGMETIKTTLLWINVFMLRNPKEMRRVQDELDQVVGRHRLP--TIEDLQYLPITESTILESMRRSSIVPLATTHSPTRDVELNGYTIPAGSHVIPLINSVHMDPNLWEKPEEFRPSRFIDT-EGKVRK-PEYFIPFGVGRRMCLGDVLARMELFLFFASFMHCFDIALPEGQPL---PSLKGNVGATITP 510          
BLAST of Cytochrome P450 2W1 vs. Ensembl Fly
Match: Cyp18a1 (gene:FBgn0010383 transcript:FBtr0074609)

HSP 1 Score: 96.2857 bits (238), Expect = 1.228e-20
Identity = 102/470 (21.70%), Postives = 208/470 (44.26%), Query Frame = 2
Query:  380 LFRIKSNENKFFMEMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKRRGVLSSDGQIW-----VLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNPG---------SIRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYIKNVQIITSSNLTFSNAVFPLTNVPLLKYCVPSVLRIKKAMDNNVNILTELWKE----SKENCETNELESSSIGEFYLKQLQLTKVYEEEHQHLNDMN----FIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIP-RTVHRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIELTNESKLNFEEILNGENGLVFAP 1720
            L  + S ++  FME+ K YG+++S R+ +Q  VV+   ++  E F+    T  GRP T   + ++   G+++S G++W      L+ KL    +  + +  +  +  I   +   + ++  + G         S+  SN+  S+ ++  F I        DD K +++      +    +     +  +  +P ++ C PS+   K  +  N   +   +++     K + + N +    + +FYL +++  K    + +  +  N     ++   D+  AG +T+  TL W  + +    K   +++ E+++ V    +   +  D   LP   S I E  R  +I+P  T H P +++  +GY +     ++    + + + ++W   ++F   RF++  E K++   E F PFG G+R C+G+ LAR E+ L   + +  + I L     L     L G  G    P
Sbjct:   66 LLFMGSEKHTRFMELAKQYGSLFSTRLGSQLTVVMSDYKMIRECFRREEFT--GRPDTPFMQTLNGY-GIINSTGKLWKDQRRFLHDKLRQFGMTYMGNGKQQMQKRIMTEVHEFIGHLHASDGQPVDMSPVISVAVSNVICSLMMSTRFSI--------DDPKFRRF----NFLIEEGMRLFGEIHTVDYIPTMQ-CFPSISTAKNKIAQNRAEMQRFYQDVIDDHKRSFDPNNIRD--LVDFYLCEIEKAKAEGTDAELFDGKNHEEQLVQVIIDLFSAGMETIKTTLLWINVFMLRNPKEMRRVQDELDQVVGRHRLP--TIEDLQYLPITESTILESMRRSSIVPLATTHSPTRDVELNGYTIPAGSHVIPLINSVHMDPNLWEKPEEFRPSRFIDT-EGKVRK-PEYFIPFGVGRRMCLGDVLARMELFLFFASFMHCFDIALPEGQPL---PSLKGNVGATITP 510          
BLAST of Cytochrome P450 2W1 vs. Ensembl Fly
Match: Cyp305a1 (gene:FBgn0036910 transcript:FBtr0074925)

HSP 1 Score: 87.8113 bits (216), Expect = 6.134e-18
Identity = 84/375 (22.40%), Postives = 161/375 (42.93%), Query Frame = 2
Query:  563 KYVSKRRGVLSSDGQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNP-GSIRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYIKNVQIITSSNLTFSNAVFPLTNVPLLKYCVPSVLRIKKAMDNNVNILTELW--------KESKENCETNELESSSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSY-SDKSQLPYLCSFIEEVHRYFTIIPRT-VHRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIEL 1654
            + +  R+G+  +DGQ+W  +R    K +  + +     E  I    + LL  ++R     I          L +++ ++        ++   + + ++    S        +  L   P L++  P   R    +   +N  TEL+        +  ++  +      S +   YL++++  +    E    N+   +    D   AGS T + T+    ++LA R  +Q KL S++   V   S   F + S +    Y+ +FI EV R+F I P T   R +      GY + +N  IL    + + + + W +  +F  +RF+++  +  K   E F PFG G+R C+G++LAR  +   LV ++ H+ + L
Sbjct:  110 RTMGTRKGITCTDGQLWYEHRHFAMKQMRNVGYGRSQMEHHIELEAEELLGQLERTEEQPIEPVTWLAQSVLNVLWCLIAGKRIARQEDGTLRRLLDLMNRRSKLFDICGGL--LAQFPWLRHVAPD--RTGYNLIQQLN--TELYGFFMDTIEEHRRQLAKDPSPAESDLIYAYLQEMK-DRSAGGESSTFNETQLVMTILDFFIAGSQTTSNTINLALMVLAMRPDVQEKLFSQVTASVAAASTDAFPHLSRREAFDYMDAFIMEVQRFFHITPITGPRRALWATKLGGYDIPKNATILISLRSVHLDKEHWKDPLEFRPERFIDSAGKCFK--DEYFMPFGMGRRRCLGDALARACIFSFLVRIVQHFSVVL 475          
BLAST of Cytochrome P450 2W1 vs. Ensembl Fly
Match: Cyp303a1 (gene:FBgn0001992 transcript:FBtr0343812)

HSP 1 Score: 77.0258 bits (188), Expect = 1.605e-14
Identity = 93/392 (23.72%), Postives = 178/392 (45.41%), Query Frame = 2
Query:  533 LSGRPLTELYKY--VSKRRGVLSSDGQIWVLYRKLTTKALHEISHKTRGFEDVI-TENIKLLLNYIDR--NPGSIRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYIKNVQIITS---------SNLTFSNAVFPLTNVPLLKYCVPSVLRIKKAMDNNVNILTELWKESKENCET--NELESSSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTI----IPRTVHRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKI 1648
            + GRP    Y+    + R GVL +DG++WV  R+   + L        G  D++  E   LL +  D+    G  +T    H +T       V+ +NT +     ++Y      IT           N+    A+F  ++ PLL++  P+       ++++ ++ T + KE + +  T  N  E   + + YL+         +E    +D + +    D+  AGS+T   +L +C + L  + +IQ +   EI E V ++ +  +S  D+++LPY  +   E  R F +    IP   HR + +    GY++ ++ +++        N   +P+ + F  DR++ +   K   L E F PFG G+  C+G+ L R+ + +    ++ ++K+
Sbjct:   98 IDGRPDGIFYRLRTFNSRLGVLLTDGEMWVEQRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLT------SVYVLNTLWCMLSGRRYEPGSPEITQLLETFFELFKNIDMVGALF--SHFPLLRFIAPNFSGYNGFVESHRSLYTFMSKEIELHRLTYKNYDEPRDLMDSYLRA---QDEGNDEKGMFSDQSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWS-RDRTKLPYCEAITLEAVRMFMLHTFGIP---HRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYLFDGHLK---LPEAFNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKM 471          
BLAST of Cytochrome P450 2W1 vs. Ensembl Fly
Match: Cyp303a1 (gene:FBgn0001992 transcript:FBtr0080828)

HSP 1 Score: 77.0258 bits (188), Expect = 1.605e-14
Identity = 93/392 (23.72%), Postives = 178/392 (45.41%), Query Frame = 2
Query:  533 LSGRPLTELYKY--VSKRRGVLSSDGQIWVLYRKLTTKALHEISHKTRGFEDVI-TENIKLLLNYIDR--NPGSIRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYIKNVQIITS---------SNLTFSNAVFPLTNVPLLKYCVPSVLRIKKAMDNNVNILTELWKESKENCET--NELESSSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTI----IPRTVHRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKI 1648
            + GRP    Y+    + R GVL +DG++WV  R+   + L        G  D++  E   LL +  D+    G  +T    H +T       V+ +NT +     ++Y      IT           N+    A+F  ++ PLL++  P+       ++++ ++ T + KE + +  T  N  E   + + YL+         +E    +D + +    D+  AGS+T   +L +C + L  + +IQ +   EI E V ++ +  +S  D+++LPY  +   E  R F +    IP   HR + +    GY++ ++ +++        N   +P+ + F  DR++ +   K   L E F PFG G+  C+G+ L R+ + +    ++ ++K+
Sbjct:   98 IDGRPDGIFYRLRTFNSRLGVLLTDGEMWVEQRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLT------SVYVLNTLWCMLSGRRYEPGSPEITQLLETFFELFKNIDMVGALF--SHFPLLRFIAPNFSGYNGFVESHRSLYTFMSKEIELHRLTYKNYDEPRDLMDSYLRA---QDEGNDEKGMFSDQSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWS-RDRTKLPYCEAITLEAVRMFMLHTFGIP---HRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYLFDGHLK---LPEAFNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKM 471          
BLAST of Cytochrome P450 2W1 vs. Ensembl Zebrafish
Match: cyp2x7 (cytochrome P450, family 2, subfamily X, polypeptide 7 [Source:ZFIN;Acc:ZDB-GENE-110114-2])

HSP 1 Score: 124.02 bits (310), Expect = 8.850e-30
Identity = 114/438 (26.03%), Postives = 207/438 (47.26%), Query Frame = 2
Query:  368 LFKNLFRIKS-NENKFFMEMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKRRGVLSSD-GQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNPG-SIRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYIKNVQIITSSNLTFSNAVFPLT--NVPLLKYCVPSVLRIKKAMDNNVNILTELWKESKENCETNEL--ESSSIGEFYLKQLQLTK----VYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYK 1645
            +F NL +I   +  K F  + + YGNI+S    ++  V L   E+  EA        SGRP   +  +++  +GV+ +D G +W  +R+     L       +  E+ I   I  +++++D+N G ++    +FH++   +I  ++F    D+++E ++ YI+ +    + NL   N  + +     PLL+  +P  L  KKA DN V I+  + ++  +  ++  +  +     + YL +L   K     + E+         I N  D+  AG+DT + TL    L L +  ++Q K + EI++ +E K  +  +Y D+  +PY  + I EV R   I+P +V H   ++    GY + +  +I+ +          W    +F    F+  + +  K   E F PF TG R C+GE LAR E+ L  V L+  ++
Sbjct:   36 IFGNLLQINMVDPLKEFERLAEKYGNIFSLYTGSKPAVFLNNFEVIKEALVTKAQDFSGRPQDLMISHLTGNKGVVLADYGPLWKDHRRFALMTLRNFGLGKQSMEERILGEISHIVDFLDKNTGKTVDPQIMFHNIASNVINLVLFGCRFDYNNEFLRGYIQRI----AENLRILNGPWNMIYDTFPLLR-ILP--LPFKKAFDN-VKIIKSMNRKLIDEHKSTRVPGQPRDFIDCYLDELDKVKNCVSTFSEDQ-------LIMNIMDMSFAGTDTTSNTLLAAFLYLMNHPEVQVKCQQEIDDVLEGKDQV--TYEDRHNMPYTLAVIHEVQRVANIVPLSVLHCTTRDTELMGYSIPKGTVIIPNLTVVLKEEGQWKFPHEFNPANFLNEQGQFEK--PEAFIPFSTGPRVCLGEGLARMELFLIFVTLLRRFQ 454          
BLAST of Cytochrome P450 2W1 vs. Ensembl Zebrafish
Match: cyp2x7 (cytochrome P450, family 2, subfamily X, polypeptide 7 [Source:ZFIN;Acc:ZDB-GENE-110114-2])

HSP 1 Score: 123.635 bits (309), Expect = 1.205e-29
Identity = 114/438 (26.03%), Postives = 206/438 (47.03%), Query Frame = 2
Query:  368 LFKNLFRIKS-NENKFFMEMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKRRGVLSSD-GQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNPG-SIRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYIKNVQIITSSNLTFSNAVFPLT--NVPLLKYCVPSVLRIKKAMDNNVNILTELWKESKENCETNEL--ESSSIGEFYLKQLQLTK----VYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYK 1645
            +F NL +I   +  K F  + + YGNI+S    ++  V L   E+  EA        SGRP   +  +++  +GV+ +D G +W  +R+     L       +  E+ I   I  +++++D+N G ++    +FH++   +I  ++F    D+++E ++ YI+ +    + NL   N  + +     PLL+  +P  L  KKA DN V I+  + ++  +  ++  +  +     + YL +L   K     + E+         I N  D+  AG+DT + TL    L L +   +Q K + EI++ +E K  +  +Y D+  +PY  + I EV R   I+P +V H   ++    GY + +  +I+ +          W    +F    F+  + +  K   E F PF TG R C+GE LAR E+ L  V L+  ++
Sbjct:   36 IFGNLLQINMVDPLKEFERLAEKYGNIFSLYTGSKPAVFLNNFEVIKEALVTKAQDFSGRPQDLMISHLTGNKGVVLADYGPLWKDHRRFALMTLRNFGLGKQSMEERILGEISHIVDFLDKNTGKTVDPQIMFHNIASNVINLVLFGCRFDYNNEFLRGYIQRI----AENLRILNGPWNMIYDTFPLLR-ILP--LPFKKAFDN-VKIIKSMNRKLIDEHKSTRVPGQPRDFIDCYLDELDKVKNCVSTFSEDQ-------LIMNIMDMSFAGTDTTSNTLLAAFLYLMNHPDVQVKCQQEIDDVLEGKDQV--TYEDRHNMPYTLAVIHEVQRVANIVPLSVLHCTTRDTELMGYSIPKGTVIIPNLTVVLKEEGQWKFPHEFNPANFLNEQGQFEK--PEAFIPFSTGPRVCLGEGLARMELFLIFVTLLRRFQ 454          
BLAST of Cytochrome P450 2W1 vs. Ensembl Zebrafish
Match: cyp2x9 (cytochrome P450, family 2, subfamily X, polypeptide 9 [Source:ZFIN;Acc:ZDB-GENE-061027-109])

HSP 1 Score: 121.324 bits (303), Expect = 8.032e-29
Identity = 115/442 (26.02%), Postives = 195/442 (44.12%), Query Frame = 2
Query:  368 LFKNLFRIK-SNENKFFMEMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKRRGVLSSD-GQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNPG-SIRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYIKNVQIITSSNLTFSNAVFPLT--NVPLLKYCVPSVLRIKKAMDNNVN---ILTELWKESKENCETNELESSSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIELTNES 1666
            LF NL  +  +N  K F  +   YGNI+S    ++ +VVL   E   EA     +  +GRP   +   V+K  GV+ SD G  W  +R+     L       +  E+ I   +  +++ +++  G +     +FH+    II  ++F    D+DDE +K +I     + + N   +N  + +     P+ +Y     L  +KA  N      + T+L KE K+     E       + YL +L        +    ++   I    D+  AG+DT + TL    L L    ++Q K + EI++ +E K     SY D+  +PY  + I EV R    +P +V H   K+    GY + +   ++ +  ++      W    +F    F+  + E  K   E F PF  G R C+GE LAR E+ L +V L+  ++    N++
Sbjct:   36 LFGNLLELNINNPLKDFERLANRYGNIYSLYFGSKPWVVLNGFEALKEALVTKAVDFAGRPQDLMVNRVTKGGGVILSDYGPSWKEHRRFALMTLRNFGLGKQSMEERILGEVSHIIDKLEKRVGTAFDPQTMFHNAASNIICIVLFGSRYDYDDEFLKLFIH----LYTENAKIANGPWAMIYDTFPMFRYLP---LPFRKAFANASKARELSTQLVKEHKKTWVPGE--PRDFIDCYLDELDKRG---NDGSSFSEAQLILYVLDLHFAGTDTTSNTLLTGFLYLMTHPEVQAKCQQEIDDVLEDKDQA--SYEDRHSMPYTQAVIHEVQRVANTVPLSVFHCTTKDTELMGYNIPKGTFVIPNLGSALKEEGQWKFPHEFNPANFLNEQGEFEK--PEAFVPFSAGPRVCLGEGLARMELFLVMVTLLRRFQFVWPNDA 461          
BLAST of Cytochrome P450 2W1 vs. Ensembl Zebrafish
Match: cyp2x9 (cytochrome P450, family 2, subfamily X, polypeptide 9 [Source:ZFIN;Acc:ZDB-GENE-061027-109])

HSP 1 Score: 121.324 bits (303), Expect = 8.032e-29
Identity = 115/442 (26.02%), Postives = 195/442 (44.12%), Query Frame = 2
Query:  368 LFKNLFRIK-SNENKFFMEMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKRRGVLSSD-GQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNPG-SIRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYIKNVQIITSSNLTFSNAVFPLT--NVPLLKYCVPSVLRIKKAMDNNVN---ILTELWKESKENCETNELESSSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIELTNES 1666
            LF NL  +  +N  K F  +   YGNI+S    ++ +VVL   E   EA     +  +GRP   +   V+K  GV+ SD G  W  +R+     L       +  E+ I   +  +++ +++  G +     +FH+    II  ++F    D+DDE +K +I     + + N   +N  + +     P+ +Y     L  +KA  N      + T+L KE K+     E       + YL +L        +    ++   I    D+  AG+DT + TL    L L    ++Q K + EI++ +E K     SY D+  +PY  + I EV R    +P +V H   K+    GY + +   ++ +  ++      W    +F    F+  + E  K   E F PF  G R C+GE LAR E+ L +V L+  ++    N++
Sbjct:   36 LFGNLLELNINNPLKDFERLANRYGNIYSLYFGSKPWVVLNGFEALKEALVTKAVDFAGRPQDLMVNRVTKGGGVILSDYGPSWKEHRRFALMTLRNFGLGKQSMEERILGEVSHIIDKLEKRVGTAFDPQTMFHNAASNIICIVLFGSRYDYDDEFLKLFIH----LYTENAKIANGPWAMIYDTFPMFRYLP---LPFRKAFANASKARELSTQLVKEHKKTWVPGE--PRDFIDCYLDELDKRG---NDGSSFSEAQLILYVLDLHFAGTDTTSNTLLTGFLYLMTHPEVQAKCQQEIDDVLEDKDQA--SYEDRHSMPYTQAVIHEVQRVANTVPLSVFHCTTKDTELMGYNIPKGTFVIPNLGSALKEEGQWKFPHEFNPANFLNEQGEFEK--PEAFVPFSAGPRVCLGEGLARMELFLVMVTLLRRFQFVWPNDA 461          
BLAST of Cytochrome P450 2W1 vs. Ensembl Zebrafish
Match: cyp1a (cytochrome P450, family 1, subfamily A [Source:ZFIN;Acc:ZDB-GENE-011219-1])

HSP 1 Score: 117.472 bits (293), Expect = 1.740e-27
Identity = 116/447 (25.95%), Postives = 205/447 (45.86%), Query Frame = 2
Query:  368 LFKNLFRIKSNENKFFMEMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELY--KYVSKRRGVLSSDGQI--WVLYRKLTTKALHEIS---HKTRGFEDVITENIK-------LLLNYIDRNPGSIRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYIKNV----QIITSSNLTFSNAVFPLTNVPLLKYCVPSVLRIKKAMDNNVNILTELWKESKENCETNELES-SSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQ-ENFYPFGTGKRNCIGESLARKEVLLTLVALICHYK 1645
            +  N+  I +N +     M K YG ++  +I  +  VVL   ++  +A    G   SGRP  ELY  K++S  + +  S  Q+  W   RKL   AL   S    K+  +   + E+I          L+ + +  GS             +I  I F      DD+++ + +       +I+ S N        P   +P L+  +PS   +KK +D N      + +   E+ +T + ++   I +  +   +  K+ E  +  ++D   +   +D+ GAG DT++  L+W  + L    ++Q +L+ E++E +        S  D++ LP L SFI E+ R+ + +P T+ H   K+   +GY + ++  +  + +  NH+ ++W +   FI DRF+     ++  L+ E    FG GKR CIGES+ R EV L L  L+   K
Sbjct:   53 IIGNVLEIGNNPHLSLTAMSKCYGPVFQIQIGMRPVVVLSGNDVIRQALLKQGEEFSGRP--ELYSTKFISDGKSLAFSTDQVGVWRARRKLALNALRTFSTVQGKSPKYSCALEEHISNEGLYLVQRLHSVMKADGSFDPFRHIVVSVANVICGICFGRRHSHDDDELVRLVNMSDEFGKIVGSGN--------PADFIPFLRI-LPST-TMKKFLDINERFSKFMKRLVMEHYDTFDKDNIRDITDSLINHCEDRKLDENSNLQVSDEKIVGIVNDLFGAGFDTISTALSWAVVYLVHYPEVQERLQRELDEKIGKDRTPLLS--DRANLPLLESFILEIFRHSSFLPFTIPHCTSKDTSLNGYFIPKDTCVFVNQWQVNHDPELWKDPSSFIPDRFLTADGTELNKLEGEKVLVFGLGKRRCIGESIGRAEVFLFLAILLQRLK 485          
BLAST of Cytochrome P450 2W1 vs. Ensembl Xenopus
Match: slc25a36 (Xenopus tropicalis uncharacterized LOC100124950 (LOC100124950), mRNA. [Source:RefSeq mRNA;Acc:NM_001102889])

HSP 1 Score: 117.857 bits (294), Expect = 1.448e-27
Identity = 110/423 (26.00%), Postives = 193/423 (45.63%), Query Frame = 2
Query:  413 FMEMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKRRGVLSSDGQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNPGSIRTSNL-FHSMTLTIIFKIVFNINTDFDDEKIKKYIKNVQIITSSNLTFSNAVFPLTNVPLLKYCVPSVL--------RIKKAMDNNVNILTELWKESKENCETNELESSSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIE 1651
            FME+ K YG ++S ++  ++ VVL   +   +A  +     SGRP T L +  SK  G++ ++G+ W + R+ T   L +     +  ED I+E    L+     + G    + L  ++    II  I+ N   D+ D    K IK+V      N    N   P+    +L    PS++        RI  +  N  N L E++ + K+  + N+ +   +  F +KQ Q  K    +  H  D N      ++ GAG +T + TL W  LL+    +IQ K++ EI+  +            + Q+PY  + I E+ R+  ++P  V H    ++ F GY L +   +     +   +   +   D+F  + F++++   +K+  E F PF  GKR C GE+LA+ E+ L    L+ ++  +
Sbjct:   55 FMELAKKYGPVFSVQLGTKKTVVLCGTDAVKDALINYADEFSGRPKTPLSEQASKGNGIIFANGENWKVMRRFTLSTLRDFGMGKKTIEDRISEESDCLVETFKSHKGKPFDNTLILNAAVANIIVHILLNHRFDYQDPTFLKLIKSV------NDNVRNGARPII---VLYNAFPSIIRWIPGTHKRIFASSQNFFNFLKEIFMKRKDQLDVND-QRDLVDAFLVKQ-QEEKSSSTKFFH--DENLKVLIGNLFGAGMETTSTTLRWGILLMMKYPEIQKKVQDEIDRVMGSTEP---RPEHRKQMPYTDAVIHEIQRFADLVPNGVPHATTTDVTFRGYFLPKGTQVFPLLTSVLRDKAYFKKPDEFYPEHFLDSEGNFLKN--EAFLPFSAGKRICAGETLAKMELFLFFTKLLQNFTFQ 459          
BLAST of Cytochrome P450 2W1 vs. Ensembl Xenopus
Match: cyp1a1 (cytochrome P450 family 1 subfamily A member 1 [Source:NCBI gene;Acc:100037911])

HSP 1 Score: 116.701 bits (291), Expect = 5.369e-27
Identity = 118/480 (24.58%), Postives = 222/480 (46.25%), Query Frame = 2
Query:  377 NLFRIKSNENKFFMEMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKRRGV-LSSD-GQIWVLYRKLTTKALHEISHKTRGF--------EDVITENIKLLLNY---IDRNPGSIRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYIKNVQIITSSNLTFSNAVFPLTNVPLLKYCVPSVLRIKKAMDNNVNILTELWKESKENCET-NELESSSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKI-KHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIELTNESKLNFEEILNGENGLVFA-PFCH---NLKFSRISN 1756
            NL  +  N +    +M + YG+++  +I  +  +VL   E   +A        +GRP    ++ V   + +  SSD G++W   R+L   AL   +              E++ITE   L+  +   ID + G              +I  + F    + DDE++     NV  +T      + +  P   +P+L+Y   S ++  K +  N   L  + K +KE+ +T ++     I +  ++  Q  +V E  +  L++   +   +D+ GAG DT+   L+W  + L     IQ +++ E+++ +  +       SD++QLPY  +FI E+ R+ + +P T+ H   K+ + +GY + +   +L + +  NH+ ++W +  KF  +RF+ N    + K   E    FG GKR C+GE++ R EV L L  ++   +    +  KL+    ++ + GL      CH    L+F+ ++N
Sbjct:   59 NLLSLSKNPHLSLTKMSETYGDVFQIQIGTKPMLVLSGLETLRQALIRQSDEFAGRPDLFTFRLVGDGQSMTFSSDSGEVWRARRRLAQNALKTFATSPSPTSSNSCLVEENIITEAEYLIRKFKELID-DKGEFDPYRYVVVSVANVICGMCFGKRYNHDDEELL----NVVNLTDEFGAAAASGNPADFIPILQYLPNSSMKAFKEI--NQKFLAFMQKFTKEHYKTFDKNHIRDITDSLIQHSQEKRVDENSNIQLSNEKIVNIVNDLFGAGFDTITTALSWSLMYLVAHPNIQQRIQDELDQVIGRERRP--RLSDRAQLPYTEAFILEMFRHSSFMPFTIPHCTTKDTMLNGYFIPKGICVLINQWQVNHDPNLWQDPFKFCPERFLNNDGTMVNKTEMEKVMIFGLGKRRCVGEAIGRMEVFLFLTTMLQQMQFFKQDGEKLD----MSPQYGLTMKHKRCHLTAKLRFALLTN 525          
BLAST of Cytochrome P450 2W1 vs. Ensembl Xenopus
Match: cyp2f1 (cytochrome P450 2K1 [Source:NCBI gene;Acc:100490476])

HSP 1 Score: 115.161 bits (287), Expect = 1.274e-26
Identity = 109/451 (24.17%), Postives = 201/451 (44.57%), Query Frame = 2
Query:  413 FMEMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKRRGVLSSDGQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLL-NYIDRNPGSIRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYIKNVQIITSSNLTFSNAVFPLTNVPLLKYCVPSVLRIKKAMDNNV--------NILTELWKESKENCETNELESSSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIELTNESKLNFEEILNGENGLVFAPFCHNL 1735
            FME  K YG ++S ++   + +VL   +   +A  + G   SGRP   ++  +SK  GV+ +DG+ W + R+     L +     +  ED I E    L+  +          + + ++    II  I+ N   ++ D  + K IK+V    S N+  + +  P+    +L    PS++         V        N L E + + ++  + N+ +   I  F +KQ Q  K   ++  H  D N      D+  AG +T + TL W  L++     IQ K++ EI+  +            + Q+PY  + I E+ R+  ++P  + H   +++ F GY L +   ++    +   + D +   ++F  + F+++K   +K+  E F PF  GKR+C+GE+LA+ E+ L    L+ ++    T +     E  L   + L   P  H +
Sbjct:   55 FMEFSKKYGPVFSIQLGLNKAIVLCGADAVKDALINHGDEFSGRPKIPVFDQISKGYGVVFADGENWKVMRRFALSTLRDFGMGRKTIEDTIVEESGCLVETFKSHEAKPFDNTLILNAAVANIIVHILLNHRFEYQDPTLIKLIKSV----SENVKIAGS--PIV---MLYNTYPSIMGWIPGSHKTVFENFQKLSNFLKETFTKRRDQLDVND-QRDLIDAFLVKQ-QEEKSSSKKFFH--DENLKVLLGDLFAAGMETTSTTLRWGILMMMKYPDIQKKVQDEIDRVIGSAEP---RLEHRKQIPYTDAVIHEIQRFANLVPIVLPHSITEDVTFRGYFLPKGTQVIPLLISVMQDKDYFQKPEEFYPEHFLDSKGNFVKN--EAFLPFSVGKRSCVGETLAKMELFLFFTKLLQNF----TFQPPPGVEVQLTCGDALTSIPLDHQI 483          
BLAST of Cytochrome P450 2W1 vs. Ensembl Xenopus
Match: cyp2f1 (cytochrome P450 2K1 [Source:NCBI gene;Acc:100490476])

HSP 1 Score: 114.005 bits (284), Expect = 2.432e-26
Identity = 101/422 (23.93%), Postives = 190/422 (45.02%), Query Frame = 2
Query:  413 FMEMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKRRGVLSSDGQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNPG-SIRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYIKNVQIITSSNLTFSNAVFPLTNVPLLKYCVPSVLR----IKKAMDNNV----NILTELWKESKENCETNELESSSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTVHRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIE 1651
            FME+ K YG+++S ++  ++ VV+   +   +A  +     S RP   ++   SK  GV  ++G+ W + R+ T   L +     +  ED I E    L+       G     + + ++    II  I+ N   D+ D  + K I     I S N+  S A  P+    LL    PS++       K++  N+    N L E + + ++  + N+ +   I  F +KQ +         +  ND N     +D+ GAG +T + TL W  L +     IQ K++ EI++ +            + ++PY  + I E+ R   + P   H    ++ F GY + +   ++    +   + D +   ++F  + F++++   +K+  E F PF  G+R C+GE+LA+ E+ L    L+ ++  +
Sbjct:   55 FMELAKKYGSVFSIQLGPEKLVVVCGADAVKDALVNHADEFSARPTIPVFDKTSKGHGVFFANGENWKVMRRFTLSTLRDFGMGKKTIEDRICEESDFLMETFKSYKGKPFDNTMIMNAAVANIIVHILLNHRFDYQDPTLLKLIN----IVSENI--SIAAKPIV---LLYNAYPSIMEWVPGTHKSVAENMLKLYNFLRETFTQHRDQLDVND-QRDLIDVFLVKQQEEKP---SSTKFFNDQNLTVLLADLFGAGMETTSTTLRWGLLFIMKYPDIQKKVQDEIDKVIGSAQP---RLEHRKKMPYTDAVIHEIQRLGNLAPNVGHETTTDVTFRGYFIPKGTQVIILLTSVLQDKDYFKKPEEFYPEHFLDSEGNFVKN--EAFLPFSAGRRICVGETLAKMELFLFFTKLLQNFTFQ 458          
BLAST of Cytochrome P450 2W1 vs. Ensembl Xenopus
Match: gins4 (GINS complex subunit 4 (Sld5 homolog) [Source:Xenbase;Acc:XB-GENE-949838])

HSP 1 Score: 113.235 bits (282), Expect = 4.958e-26
Identity = 109/430 (25.35%), Postives = 198/430 (46.05%), Query Frame = 2
Query:  407 KFFMEMHKIYGNIWSFRIINQRYVVL-GAPELQTEAFKHSGMTLSGRPLTELYKYVSKRRGVLSSDGQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYID-RNPGSIRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYIK-NVQIITSSNLTFSNA--VFPLTNVPLLKYCVPSVLRIKKAMDNNVNILTELWKESKENCETNELESS-----SIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTI----IPRTVHRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIEL 1654
            K   +M K YG+I++  + +   VVL G   ++     HS   LSGRP+      ++  RG+ +++G  W   R+     L  +    RG E  I E  + L+  +  +N   I  S+L       +I  +VF      +D   ++ +K N  +++     +      FP     L++Y      +   A+D     +       K+  + +E+ SS      + ++YL Q++ TK   E     ++ N I+   D+  AG++T A +L W  L +    +IQ K++ E++  ++   + +  Y D+ +LP+  + I EV RY  I    IPR+    ++ +  +GY+L +N I+L +  +  H+   W    KF  + F++   +   +  E F PF  G R C+GE LAR E+ +    ++  + IEL
Sbjct:   68 KTLRKMAKSYGDIYTLWLGHTPLVVLSGCKSVRNGLITHS-EELSGRPVDGFMTALTNERGIGTTNGHTWKQQRRFGLMTLRNLGLGKRGLESRIQEEAQCLVESLAAKNGEPINPSDLIVLAVANVISAVVFGHRFSIEDPTFQEMVKCNSSLVSGLGTAWGRMYDAFPW----LMRYVPGPHQKSFAAIDYLAAFI-------KKEIKLHEINSSKDDPQDMIDYYLTQIEKTK--HELDTTFDEENMIQVVIDLFIAGTETTAISLQWALLYMVAFPEIQKKVQKELDTVLDGSPLAY--YEDRKKLPFTNAVIHEVQRYGNIASVGIPRSC---IRKVTVNGYQLNKNTIVLPNLDSVLHDQRQWETPYKFNPNHFLDKNGDFCTN--EAFLPFSAGHRVCLGEQLARFELFIFFTTILRRFSIEL 476          
BLAST of Cytochrome P450 2W1 vs. Ensembl Mouse
Match: Cyp2c29 (cytochrome P450, family 2, subfamily c, polypeptide 29 [Source:MGI Symbol;Acc:MGI:103238])

HSP 1 Score: 122.479 bits (306), Expect = 3.438e-29
Identity = 113/440 (25.68%), Postives = 203/440 (46.14%), Query Frame = 2
Query:  398 NENKFFMEMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKRRGVLSSDGQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNPGS-IRTSNLFHSMTLTIIFKIVFNINTDFDDEK----IKKYIKNVQIITSSNLTFSNAVFPLTNVPLLKYCVPSVLRIKKAMDNNVNILTELWKESKENCETNELESSSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIE-LTNESKLNFEEILNG 1696
            N ++ F    K YG +++  + ++  V+L   E   EA    G   +GR    + + + K  GV+ S+G  W   R+ T   L  +    R  ED + E  + L+  + +  GS    + +       +I  I+F    D+ D++    + K  +NV+I++S  L   N+ FP     L+ YC  S  +I K  +   + L E  KE KE+ +        I  + +KQ Q+  +   E    +  N     +D+ GAG++T + TL +  LLL     +  K++ EI+  V           D+S +PY  + I EV R+  ++P ++ H    ++ F  Y + +   ++    +  H++  +PN + F    F+       K   + F PF TGKR C GE LAR E+ L L  ++ ++K++ L +  +++   ++NG
Sbjct:   49 NISQSFTNFSKAYGPVFTLYLGSKPTVILHGYEAVKEALIDRGEEFAGRGSFPMAEKIIKGFGVVFSNGNRWKEMRRFTLMTLRNLGMGKRNIEDRVQEEAQCLVEELRKTKGSPCDPTFILSCAPCNVICSIIFQNRFDYKDKEFLILMDKINENVKILSSPWLQVCNS-FP----SLIDYCPGSHHKIVKNFNYLKSYLLEKIKEHKESLDVTN-PRDFIDYYLIKQKQVNHI---EQSEFSLENLASTINDLFGAGTETTSTTLRYALLLLLKYPDVTAKVQEEIDRVVGRHRSP--CMQDRSHMPYTDAMIHEVQRFIDLLPTSLPHAVTCDIKFRKYLIPKGTTVITSLSSVLHDSKEFPNPEMFDPGHFLNGNGNFKK--SDYFMPFSTGKRICAGEGLARMELFLILTTILQNFKLKSLVHPKEIDITPVMNG 475          
BLAST of Cytochrome P450 2W1 vs. Ensembl Mouse
Match: Cyp2c29 (cytochrome P450, family 2, subfamily c, polypeptide 29 [Source:MGI Symbol;Acc:MGI:103238])

HSP 1 Score: 121.324 bits (303), Expect = 5.473e-29
Identity = 111/430 (25.81%), Postives = 199/430 (46.28%), Query Frame = 2
Query:  428 KIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKRRGVLSSDGQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNPGS-IRTSNLFHSMTLTIIFKIVFNINTDFDDEK----IKKYIKNVQIITSSNLTFSNAVFPLTNVPLLKYCVPSVLRIKKAMDNNVNILTELWKESKENCETNELESSSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIE-LTNESKLNFEEILNG 1696
            K YG +++  + ++  V+L   E   EA    G   +GR    + + + K  GV+ S+G  W   R+ T   L  +    R  ED + E  + L+  + +  GS    + +       +I  I+F    D+ D++    + K  +NV+I++S  L   N+ FP     L+ YC  S  +I K  +   + L E  KE KE+ +        I  + +KQ Q+  +   E    +  N     +D+ GAG++T + TL +  LLL     +  K++ EI+  V           D+S +PY  + I EV R+  ++P ++ H    ++ F  Y + +   ++    +  H++  +PN + F    F+       K   + F PF TGKR C GE LAR E+ L L  ++ ++K++ L +  +++   ++NG
Sbjct:   20 KAYGPVFTLYLGSKPTVILHGYEAVKEALIDRGEEFAGRGSFPMAEKIIKGFGVVFSNGNRWKEMRRFTLMTLRNLGMGKRNIEDRVQEEAQCLVEELRKTKGSPCDPTFILSCAPCNVICSIIFQNRFDYKDKEFLILMDKINENVKILSSPWLQVCNS-FP----SLIDYCPGSHHKIVKNFNYLKSYLLEKIKEHKESLDVTN-PRDFIDYYLIKQKQVNHI---EQSEFSLENLASTINDLFGAGTETTSTTLRYALLLLLKYPDVTAKVQEEIDRVVGRHRSP--CMQDRSHMPYTDAMIHEVQRFIDLLPTSLPHAVTCDIKFRKYLIPKGTTVITSLSSVLHDSKEFPNPEMFDPGHFLNGNGNFKK--SDYFMPFSTGKRICAGEGLARMELFLILTTILQNFKLKSLVHPKEIDITPVMNG 436          
BLAST of Cytochrome P450 2W1 vs. Ensembl Mouse
Match: Cyp2b13 (cytochrome P450, family 2, subfamily b, polypeptide 13 [Source:MGI Symbol;Acc:MGI:88599])

HSP 1 Score: 120.168 bits (300), Expect = 1.931e-28
Identity = 108/424 (25.47%), Postives = 196/424 (46.23%), Query Frame = 2
Query:  407 KFFMEMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKRRGVLSSDGQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNPGS-IRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYIKNVQIITSSNLTFSNAVFPLTNVPLLKYCVPSVLR-IKKAMDNNVNILTELWKESKENCETNELESSSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIELTNESK 1669
            K F+ + + +G++++  +  +  VVL   +   EA  ++    SGR      + V +  G+  S G+ W   R+ +   + E     R  E+ I E  + L+  + +  G+ +  +  F  +T  II  IVF    D+ DE+  + +  +  I S   +FS  +F L +  LLKY  P V R I K     +N +T   +  K     +  E     + YL  L++ K     +   +  N + +   +  AG++T + TL    LL+     +  K++ EI++ +    +   +  D++++PY  + I E+ R+  I+P    HR  K+ +F GY L +N  +     ++ H+   +   D F  D F++      K   E F PF TGKR C+GES+AR E+ L   +++ ++ +     SK
Sbjct:   53 KCFIHLQEKHGDVFTVHLGPRPVVVLCGTQTIREALVNNAEAFSGRGTIAAAQLVMQDYGIFFSSGERWKTLRRFSLATMKEFGMGKRSVEERIKEEAQCLVEELKKYQGAPLDPTFFFQCVTANIICSIVFGERFDYTDEQFLRLLNLMYQIYSLLRSFSCQMFELFSG-LLKY-FPGVHRQIAKNQQEILNFITH--RVEKHRATLDPSEPRDFIDTYL--LRMEKEKSNHNTEFHHQNLMMSVLSLFFAGTETTSTTLCCGFLLMLMYPHVAEKVQKEIDQVIGSHRLP--TLDDRTKMPYTDAVIHEIQRFSDIVPTGAPHRVTKDTMFRGYLLPKNTEVYPILSSALHDPQYFEQPDSFNPDHFLDANGALKK--SEAFLPFSTGKRICLGESIARNELFLFFTSILQNFSVASPVASK 466          
BLAST of Cytochrome P450 2W1 vs. Ensembl Mouse
Match: Cyp2u1 (cytochrome P450, family 2, subfamily u, polypeptide 1 [Source:MGI Symbol;Acc:MGI:1918769])

HSP 1 Score: 119.013 bits (297), Expect = 6.970e-28
Identity = 112/466 (24.03%), Postives = 206/466 (44.21%), Query Frame = 2
Query:  398 NENKFFMEMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKRRG-VLSSDGQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNP-GSIRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYI----KNVQIITSSNLTFSNAVFPLTNVPLLKYCVPSVLRIKKAMDNNVNI-LTELWKESKENCETNELESSSIGEF---YLKQLQLTKVYEEEHQHLNDMNFIRNF-----SDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIELTNESKLNFEEILNGENGLVFAPFCHNLKFSR 1747
             ++ +   M ++YGNI+SF I ++  VVL       EA        S RP   L   ++K +G V +  G IW   R+ +   L          E  I E    +   + ++         +  +    II  + F    D+ +++ KK +    + ++I   S L   N        P   Y      +  + ++ +++  L  + +E +E+     L++S+  +F   YL  +      EEE       +F  ++      D+  AG+DT   +L WC L ++    +Q K+  EI   +        S +DK+Q+PY  + I EV R   ++P  + H   +  +  G+ + +  ++L + ++ + +  IW   D F   RF++++ + +K  +E F PFG GKR C+GE LA+ E+ L  V+L+  +   L   S+   + ++ G  GL  AP   N+  S+
Sbjct:   88 GQHVYLARMARVYGNIFSFFIGHRLVVVLSDFHSVREALVQQAEVFSDRPRMPLISIMTKEKGIVFAHYGPIWKQQRRFSHSTLRHFGLGKLSLEPRIIEEFAYVKEAMQKHGEAPFSPFPIISNAVSNIICSLCFGQRFDYTNKEFKKVLDFMSRGLEICLHSQLFLINIC------PWFYYLPFGPFKELRQIERDISCFLKNIIREHQES-----LDASNPQDFIDMYLLHM------EEEQGASRRSSFDEDYLFYIIGDLFIAGTDTTTNSLLWCLLYMSLNPDVQKKVHEEIERVIGCDRAP--SLTDKAQMPYTEATIMEVQRLSMVVPLAIPHMTSEKTVLQGFTIPKGTVVLINLWSVHRDPAIWEKPDDFCPHRFLDDQGQLLK--RETFIPFGIGKRVCMGEQLAKMELFLMFVSLMQTFTFALPEGSE---KPVMTGRFGLTLAPHPFNVTISK 529          
BLAST of Cytochrome P450 2W1 vs. Ensembl Mouse
Match: Cyp2u1 (cytochrome P450, family 2, subfamily u, polypeptide 1 [Source:MGI Symbol;Acc:MGI:1918769])

HSP 1 Score: 119.013 bits (297), Expect = 6.970e-28
Identity = 112/466 (24.03%), Postives = 206/466 (44.21%), Query Frame = 2
Query:  398 NENKFFMEMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKRRG-VLSSDGQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNP-GSIRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYI----KNVQIITSSNLTFSNAVFPLTNVPLLKYCVPSVLRIKKAMDNNVNI-LTELWKESKENCETNELESSSIGEF---YLKQLQLTKVYEEEHQHLNDMNFIRNF-----SDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIELTNESKLNFEEILNGENGLVFAPFCHNLKFSR 1747
             ++ +   M ++YGNI+SF I ++  VVL       EA        S RP   L   ++K +G V +  G IW   R+ +   L          E  I E    +   + ++         +  +    II  + F    D+ +++ KK +    + ++I   S L   N        P   Y      +  + ++ +++  L  + +E +E+     L++S+  +F   YL  +      EEE       +F  ++      D+  AG+DT   +L WC L ++    +Q K+  EI   +        S +DK+Q+PY  + I EV R   ++P  + H   +  +  G+ + +  ++L + ++ + +  IW   D F   RF++++ + +K  +E F PFG GKR C+GE LA+ E+ L  V+L+  +   L   S+   + ++ G  GL  AP   N+  S+
Sbjct:   88 GQHVYLARMARVYGNIFSFFIGHRLVVVLSDFHSVREALVQQAEVFSDRPRMPLISIMTKEKGIVFAHYGPIWKQQRRFSHSTLRHFGLGKLSLEPRIIEEFAYVKEAMQKHGEAPFSPFPIISNAVSNIICSLCFGQRFDYTNKEFKKVLDFMSRGLEICLHSQLFLINIC------PWFYYLPFGPFKELRQIERDISCFLKNIIREHQES-----LDASNPQDFIDMYLLHM------EEEQGASRRSSFDEDYLFYIIGDLFIAGTDTTTNSLLWCLLYMSLNPDVQKKVHEEIERVIGCDRAP--SLTDKAQMPYTEATIMEVQRLSMVVPLAIPHMTSEKTVLQGFTIPKGTVVLINLWSVHRDPAIWEKPDDFCPHRFLDDQGQLLK--RETFIPFGIGKRVCMGEQLAKMELFLMFVSLMQTFTFALPEGSE---KPVMTGRFGLTLAPHPFNVTISK 529          
BLAST of Cytochrome P450 2W1 vs. UniProt/SwissProt
Match: sp|P00182|CP2C3_RABIT (Cytochrome P450 2C3 OS=Oryctolagus cuniculus OX=9986 GN=CYP2C3 PE=1 SV=2)

HSP 1 Score: 129.028 bits (323), Expect = 1.110e-30
Identity = 117/469 (24.95%), Postives = 218/469 (46.48%), Query Frame = 2
Query:  377 NLFRIKSNE-NKFFMEMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKRRGVLSSDGQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDR-NPGSIRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYIK----NVQIITSSNLTFSNAVFPLTNVPLLKYCVPSVLRIKKAMDNNVNILTELWKESKENCETNELESSSIGEFYLKQLQLTKVYEEEHQHLNDM---NFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIE-LTNESKLNFEEILNGENGLVFAPFCHNLKFSRI 1750
            NL ++++ + NK    + K YG+I++     +  VVL   E   EA    G   SGR +  ++  V+K  G++ S G+ W   R+ +   L  +    +  E+ I E    L+  + + N      + L   +   +I  ++F    D+DDEK K  IK    N +++ +  +   N        P+L Y   S  ++ K +D  +  + E  +E +E+ ++N      +  F      L K+ +E+H+  ++    N I    D+  AG+DT + TL +  LLL    +I  K++ EI   +           D++++PY  + + E+ RY  ++P ++ H   +++ F+GY + +   I+    +  ++   +PN +KF    F++      K   + F PF  GKR C+GE LAR E+ L L  ++ H+ ++ L +   ++   +   ENG V  P  + L F  +
Sbjct:   41 NLLQLETKDINKSLSMLAKEYGSIFTLYFGMKPAVVLYGYEGVIEALIDRGEEFSGRGIFPVFDRVTKGLGIVFSSGEKWKETRRFSLTVLRNLGMGKKTIEERIQEEALCLIQALRKTNASPCDPTFLLFCVPCNVICSVIFQNRFDYDDEKFKTLIKYFHENFELLGTPWIQLYNIF------PILHYLPGSHRQLFKNIDGQIKFILEKVQEHQESLDSNN-PRDFVDHF------LIKMEKEKHKKQSEFTMDNLITTIWDVFSAGTDTTSNTLKFALLLLLKHPEITAKVQEEIEHVIGRHRSP--CMQDRTRMPYTDAVMHEIQRYVDLVPTSLPHAVTQDIEFNGYLIPKGTDIIPSLTSVLYDDKEFPNPEKFDPGHFLDESGNFKK--SDYFMPFSAGKRACVGEGLARMELFLLLTTILQHFTLKPLVDPKDIDPTPV---ENGFVSVPPSYELCFVPV 489          
BLAST of Cytochrome P450 2W1 vs. UniProt/SwissProt
Match: sp|Q7Z449|CP2U1_HUMAN (Cytochrome P450 2U1 OS=Homo sapiens OX=9606 GN=CYP2U1 PE=1 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 2.511e-29
Identity = 118/460 (25.65%), Postives = 212/460 (46.09%), Query Frame = 2
Query:  422 MHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKRRGVLSSD-GQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRN------PGSIRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYI----KNVQIITSSNLTFSNAVFPLTNVPLLKYCVPSVLRIKKAMDNNV-NILTELWKESKENCETNELESSSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNF-----SDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIELTNESKLNFEEILNGENGLVFAPFCHNLKFSR 1747
            + ++YG+I+SF I +   VVL       EA        S RP   L   V+K +GV+ +  G +W   RK +   L          E  I E  K +   + ++      P SI ++ + +     II  + F    D+ + + KK +    + ++I  +S +   N        P L Y      +  + ++ ++ + L ++ K+ +E+ +          + YL  +      EEE ++ ++ +F   +      D+  AG+DT   +L WC L ++    +Q K+  EI   +        S +DK+Q+PY  + I EV R   ++P  + H   +N +  GY + +  +IL + ++ + +  IW   + F  +RF++++ + IK  +E F PFG GKR C+GE LA+ E+ L  V+L+  +   L  +SK   + +L G  GL  AP   N+  SR
Sbjct:  110 LARVYGSIFSFFIGHYLVVVLSDFHSVREALVQQAEVFSDRPRVPLISIVTKEKGVVFAHYGPVWRQQRKFSHSTLRHFGLGKLSLEPKIIEEFKYVKAEMQKHGEDPFCPFSIISNAVSN-----IICSLCFGQRFDYTNSEFKKMLGFMSRGLEICLNSQVLLVNIC------PWLYYLPFGPFKELRQIEKDITSFLKKIIKDHQESLDREN--PQDFIDMYLLHM------EEERKNNSNSSFDEEYLFYIIGDLFIAGTDTTTNSLLWCLLYMSLNPDVQEKVHEEIERVIGANRAP--SLTDKAQMPYTEATIMEVQRLTVVVPLAIPHMTSENTVLQGYTIPKGTLILPNLWSVHRDPAIWEKPEDFYPNRFLDDQGQLIK--KETFIPFGIGKRVCMGEQLAKMELFLMFVSLMQSFAFALPEDSK---KPLLTGRFGLTLAPHPFNITISR 543          
BLAST of Cytochrome P450 2W1 vs. UniProt/SwissProt
Match: sp|Q0IIF9|CP2U1_BOVIN (Cytochrome P450 2U1 OS=Bos taurus OX=9913 GN=CYP2U1 PE=2 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 2.217e-28
Identity = 113/455 (24.84%), Postives = 207/455 (45.49%), Query Frame = 2
Query:  419 EMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKRRG-VLSSDGQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNP-GSIRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYI----KNVQIITSSNLTFSNAVFPLTNVPLLKYCVPSVLRIKKAMDNNVNILTELWKESKENCETNELESSSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNF-----SDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIELTNESKLNFEEILNGENGLVFAPFCHNLKFSR 1747
            ++ ++YGNI+SF I +   VVL       EA        S RP   L   ++K +G V +  G +W   RK +   L          E  I E  + +   + ++         + ++    II  + F    D+ + + K+ +    + +++  ++ L   N    L  +P   +       +++   +    L ++ K+ +E+ +          + YL  +      EEE ++ ++  F  ++      D+  AG+DT   +L WC L ++    IQ K+  EI   +        S +DK+Q+PY  + I EV R  T++P ++ H   +  +  G+ + +  IIL + ++ + +  IW   + F  DRF++++ + IK  +E F PFG GKR C+GE LA+ E+ L  V+L+  +   L  +SK     IL G+ GL  AP   N+  S+
Sbjct:  109 DLGRVYGNIFSFLIGHYLVVVLNDFHSVREALVQQAEVFSDRPRVPLTSIMTKGKGIVFAHYGPVWRQQRKFSHSTLRHFGLGKLSLEPKIIEEFRYVKEEMQKHGDAPFNPFPIVNNAVSNIICSLCFGRRFDYTNSEFKQMLNFMSRALEVCLNTQLLLVNICSWLYYLPFGPFK-----ELRQIEKDLTLFLKKIIKDHRESLDVEN--PQDFIDMYLLHV------EEEKKNNSNSGFDEDYLFYIIGDLFIAGTDTTTNSLLWCLLYMSLHPNIQEKIHEEIARVIGADRAP--SLTDKAQMPYTEATIMEVQRLSTVVPLSIPHMTSEKTVLQGFTIPKGTIILPNLWSVHRDPAIWEKPNDFYPDRFLDDQGQLIK--KETFIPFGIGKRVCMGEQLAKMELFLMFVSLMQSFTFVLPKDSK----PILTGKYGLTLAPHPFNIIISK 542          
BLAST of Cytochrome P450 2W1 vs. UniProt/SwissProt
Match: sp|Q64458|CP2CT_MOUSE (Cytochrome P450 2C29 OS=Mus musculus OX=10090 GN=Cyp2c29 PE=1 SV=2)

HSP 1 Score: 122.479 bits (306), Expect = 2.405e-28
Identity = 113/440 (25.68%), Postives = 203/440 (46.14%), Query Frame = 2
Query:  398 NENKFFMEMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKRRGVLSSDGQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNPGS-IRTSNLFHSMTLTIIFKIVFNINTDFDDEK----IKKYIKNVQIITSSNLTFSNAVFPLTNVPLLKYCVPSVLRIKKAMDNNVNILTELWKESKENCETNELESSSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIE-LTNESKLNFEEILNG 1696
            N ++ F    K YG +++  + ++  V+L   E   EA    G   +GR    + + + K  GV+ S+G  W   R+ T   L  +    R  ED + E  + L+  + +  GS    + +       +I  I+F    D+ D++    + K  +NV+I++S  L   N+ FP     L+ YC  S  +I K  +   + L E  KE KE+ +        I  + +KQ Q+  +   E    +  N     +D+ GAG++T + TL +  LLL     +  K++ EI+  V           D+S +PY  + I EV R+  ++P ++ H    ++ F  Y + +   ++    +  H++  +PN + F    F+       K   + F PF TGKR C GE LAR E+ L L  ++ ++K++ L +  +++   ++NG
Sbjct:   49 NISQSFTNFSKAYGPVFTLYLGSKPTVILHGYEAVKEALIDRGEEFAGRGSFPMAEKIIKGFGVVFSNGNRWKEMRRFTLMTLRNLGMGKRNIEDRVQEEAQCLVEELRKTKGSPCDPTFILSCAPCNVICSIIFQNRFDYKDKEFLILMDKINENVKILSSPWLQVCNS-FP----SLIDYCPGSHHKIVKNFNYLKSYLLEKIKEHKESLDVTN-PRDFIDYYLIKQKQVNHI---EQSEFSLENLASTINDLFGAGTETTSTTLRYALLLLLKYPDVTAKVQEEIDRVVGRHRSP--CMQDRSHMPYTDAMIHEVQRFIDLLPTSLPHAVTCDIKFRKYLIPKGTTVITSLSSVLHDSKEFPNPEMFDPGHFLNGNGNFKK--SDYFMPFSTGKRICAGEGLARMELFLILTTILQNFKLKSLVHPKEIDITPVMNG 475          
BLAST of Cytochrome P450 2W1 vs. UniProt/SwissProt
Match: sp|Q4V8D1|CP2U1_RAT (Cytochrome P450 2U1 OS=Rattus norvegicus OX=10116 GN=Cyp2u1 PE=1 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 3.447e-28
Identity = 113/459 (24.62%), Postives = 199/459 (43.36%), Query Frame = 2
Query:  410 FFMEMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKRRG-VLSSDGQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNP-GSIRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYI----KNVQIITSSNLTFSNAVFPLTNVPLLKYCVPSVLRIKKAMDNNVNI-LTELWKESKENCETNELESSSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNF-----SDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIELTNESKLNFEEILNGENGLVFAPFCHNLKFSR 1747
            +   + ++YGNI+SF I ++  VVL   +   EA        S RP   L   ++K +G V +  G IW   R+ +   L          E  I E    +   + ++         +  +    II  + F    D+ +++ KK +    + ++I   S L   N        P   Y      +  + ++ ++   L  + KE +E+ + N        + YL   Q      EE       NF  ++      D+  AG+DT   +L WC L ++    +Q K+  EI   +        S +DK+Q+PY  + I EV R   ++P  + H   +  +  GY + +  ++L + ++ + +  IW   D F   RF++++ + +K  +E F PFG GKR C+GE LA+ E+ L  V+L+  +   L   S+   + I+ G  GL  AP   N+  S+
Sbjct:   92 YLARLARVYGNIFSFFIGHRLVVVLSDFQSVREALVQQAEVFSDRPRMPLISILTKEKGIVFAHYGPIWKQQRRFSHSTLRHFGLGKLSLEPRIIEEFAYVKAEMQKHGEAPFSPFPVISNAVSNIICSLCFGQRFDYTNKEFKKVLDFMSRGLEICLHSQLFLINLC------PWFYYLPFGPFKELRQIERDITCFLKNIIKEHQESLDANN--PQDFIDMYLLHTQ------EEKDKCKGTNFDEDYLFYIIGDLFIAGTDTTTNSLLWCLLYMSLNPGVQKKVHEEIERVIGRDRAP--SLTDKAQMPYTEATIMEVQRLSMVVPLAIPHMTSEKTVLQGYSIPKGTVVLPNLWSIHRDPVIWEKPDDFCPHRFLDDQGQLLK--RETFIPFGIGKRVCMGEQLAKMELFLMFVSLMQSFTFALPEGSE---KPIMTGRFGLTLAPHPFNVTVSK 529          
BLAST of Cytochrome P450 2W1 vs. TrEMBL
Match: A0A1I8HTI6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013417g2 PE=3 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 1.825e-39
Identity = 117/458 (25.55%), Postives = 225/458 (49.13%), Query Frame = 2
Query:  419 EMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHS--GMTLSGRPLTELYKYVSKRRGVLSSDGQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYID-RNPGSIRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYIKNVQIITSSNLTFSN-AVFPLTNVPLLKYCVPSVLRIKKAMDNNVNILTELWKESKENCETN------ELESSS-----IGEFYLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIELTNESKLNFEEILNGENGLVFAPFCHNLKFS 1744
            +  K YG++ S+R+  +R+VVL +     EA      G   SGR  +     ++  +G++SS+G++W  +R+   K L +      G ED I + ++ L +  +      + T+ +       +I  ++F       D++ + ++   Q     NL   + A F     PLL Y +P V+R+ + +  +V ++    K +   C+        +L   S     +  F ++Q +L     ++    +D    R  +++  AG+DT + T+ W  L      + Q ++++EI+   ++       + D+ ++PY  +FI+EV R+ T+ P  V HR  +++ F GY +  +D+I+ + Y  +H+ ++W + + F  +RF+     + +   E+  PFG GKR C+GESLAR+E+ L +  ++  +   L  +S  N E+I  G +G+V AP  H + FS
Sbjct:   70 DWRKRYGDLVSYRLGARRFVVLNSYAAVKEALASQEFGDVFSGRMNSNYINSLTHGKGIVSSEGELWREHRRFALKVLRDFGFARAGTEDSIHQELQDLRDQFNTAGEAGVDTTEVLCRAIANVISVMLFGYRAGSQDDRFEAFLAATQ----ENLQGGDLARFIPVGFPLL-YQIPGVMRLLELLGVDVYVVQRNLKVTHGFCQMQIDAHRAQLAGVSSPNDFLDAFLMEQEKLNG--RKKDHTFDDFQLKRTLTELFVAGTDTTSNTIRWALLYACLYPECQARVQAEID--AQIGRNRLPEHRDRKRMPYTLAFIDEVQRFATLAPFAVLHRCTRDVEFMGYDISSDDLIMTNLYGIHHDPELWSSPEAFQPERFLAVDTGEYQP-NEHLVPFGVGKRACLGESLARQELFLFIAGILQQHSARLHPDSVKNLEDIKIGSDGIVHAPGAHRIIFS 517          
BLAST of Cytochrome P450 2W1 vs. TrEMBL
Match: A0A1I8I1X1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013417g1 PE=3 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 2.054e-39
Identity = 117/458 (25.55%), Postives = 226/458 (49.34%), Query Frame = 2
Query:  419 EMHKIYGNIWSFRIINQRYVVLGAPELQTEAF--KHSGMTLSGRPLTELYKYVSKRRGVLSSDGQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYID-RNPGSIRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYIKNVQIITSSNLTFSN-AVFPLTNVPLLKYCVPSVLRIKKAMDNNVNILTELWKESKENCETN------ELESSS-----IGEFYLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIELTNESKLNFEEILNGENGLVFAPFCHNLKFS 1744
            +  K YG++ S+R+  +R+VVL +     EA   +  G   SGR  +     ++  +G++SS+G++W  +R+   K L +      G ED I + ++ L +  +      + T+ +       +I  ++F       D++ + ++   Q     NL   + A F     PLL Y +P V+R+ + +  +V ++    K +   C+        +L   S     +  F ++Q +L     ++    +D    R  +++  AG+DT + T+ W  L      + Q ++++EI+   ++       + D+ ++PY  +FI+EV R+ T+ P  V HR  +++ F GY +  +D+I+ + Y  +H+ ++W + + F  +RF+     + +   E+  PFG GKR C+GESLAR+E+ L +  ++  +   L  +S  N E+I  G +G+V AP  H + FS
Sbjct:   70 DWRKRYGDLVSYRLGARRFVVLNSYAAVKEALVSQEFGDVFSGRMNSNYINSLTHGKGIVSSEGELWREHRRFALKVLRDFGFARAGTEDSIHQELQDLRDQFNTAGEAGVDTTEVLCRAIANVISMMLFGYRAGSQDDRFEAFLAATQ----ENLQGGDLARFIPVGFPLL-YQIPGVMRLLELLGVDVYVVQRNLKVTHGFCQMQIDAHRAQLAGVSSPNDFLDAFLMEQEKLNG--RKKDHTFDDFQLKRTLTELFVAGTDTTSNTIRWALLYACLYPECQARVQAEID--AQIGRDRLPEHRDRKRMPYTLAFIDEVQRFATLAPFAVLHRCPRDVEFMGYDISSDDLIMTNLYGIHHDPELWSSPEAFQPERFLAVDTGEYQP-NEHLVPFGVGKRACLGESLARQELFLFIAGILQQHSARLHPDSVKNLEDIKIGSDGIVHAPGAHRIIFS 517          
BLAST of Cytochrome P450 2W1 vs. TrEMBL
Match: A0A267FGF7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig002295g1 PE=3 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 1.022e-37
Identity = 124/477 (26.00%), Postives = 222/477 (46.54%), Query Frame = 2
Query:  371 FKNLFRIKSNENKFFMEMH----KIYGNIWSFRIINQRYVVLGAPELQTEAFKHS--GMTLSGRPLTELYKYVSKRRGVLSSDGQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNPGSIRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYIKNVQIITSSNLTFSN-AVFPLTNVPLLKYCVPSVLRIKKAMD-------NNVNILTELWKESKENCETNELESSSIGEF---YLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIELTNESKLNFEEILNGENGLVFAPFCHNLKFSR 1747
            F NLF +   E   F+  H    + YG++ SF   ++R+V+L +  +  EA          SGR  +     ++  +G++S++G++W  +R+   K L +      G E+ I   +  L   +D  P     + L       +I  ++FN      DE    ++    + +  NL  +N   F  T  P L Y +P  +R+ + +         N+ +     ++  +    N  E S   +F   +L + Q       +H   +D   +R  +++  AG+DT + T+ W  L  A   + Q+++ +E+       +     Y DK  + +  +FI+EV RY T+ P +V HR  +++ F GY +  ND+I+ + Y  +H+ ++W   ++F  +RF+ +  E      E   PF  GKR C+GESLAR+E+ L L  +   Y++EL  +   + ++I  G  GLV AP  H + F R
Sbjct:   51 FGNLFNL---ERPTFLVAHSKWRRQYGDLVSFTFGSRRFVILNSYAVIKEALTSPEWAEVFSGRINSPFILSMTHGKGIVSAEGELWREHRRFALKVLRDFGFARSGTEEAIHAELAELQQTLDAEP-----AELVPRAIANVISVLLFNYRAGTQDEGFTDFM----LASQENLQGNNIGRFIPTAFPGL-YSIPGFMRLLQLIGVDVFVFKRNIEVTHRFCRDQIDRHRRNLAEVSEPADFLDAFLLEQQRLNSKRSDHS-FDDFQLVRTLTELFIAGTDTTSNTIRWALLYAALHPECQDRIAAEVE--AATGNSRLPVYRDKKAMHFTMAFIDEVQRYSTLAPFSVGHRCTRDIRFKGYDISSNDLIMVNLYGVHHDPELWDQPEQFRPERFINSSGEY--ETSEFLVPFSIGKRACLGESLARQELFLFLSGIFQAYRVELHKDCYKDLKDIEVGSAGLVHAPGKHQIIFHR 509          
BLAST of Cytochrome P450 2W1 vs. TrEMBL
Match: A0A1I8I239 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 1.298e-37
Identity = 124/477 (26.00%), Postives = 222/477 (46.54%), Query Frame = 2
Query:  371 FKNLFRIKSNENKFFMEMH----KIYGNIWSFRIINQRYVVLGAPELQTEAFKHS--GMTLSGRPLTELYKYVSKRRGVLSSDGQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNPGSIRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYIKNVQIITSSNLTFSN-AVFPLTNVPLLKYCVPSVLRIKKAMD-------NNVNILTELWKESKENCETNELESSSIGEF---YLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIELTNESKLNFEEILNGENGLVFAPFCHNLKFSR 1747
            F NLF +   E   F+  H    + YG++ SF   ++R+V+L +  +  EA          SGR  +     ++  +G++S++G++W  +R+   K L +      G E+ I   +  L   +D  P     + L       +I  ++FN      DE    ++    + +  NL  +N   F  T  P L Y +P  +R+ + +         N+ +     ++  +    N  E S   +F   +L + Q       +H   +D   +R  +++  AG+DT + T+ W  L  A   + Q+++ +E+       +     Y DK  + +  +FI+EV RY T+ P +V HR  +++ F GY +  ND+I+ + Y  +H+ ++W   ++F  +RF+ +  E      E   PF  GKR C+GESLAR+E+ L L  +   Y++EL  +   + ++I  G  GLV AP  H + F R
Sbjct:   82 FGNLFNL---ERPTFLVAHSKWRRQYGDLVSFTFGSRRFVILNSYAVIKEALTSPEWAEVFSGRINSPFILSMTHGKGIVSAEGELWREHRRFALKVLRDFGFARSGTEEAIHAELAELQQTLDAEP-----AELVPRAIANVISVLLFNYRAGTQDEGFTDFM----LASQENLQGNNIGRFIPTAFPGL-YSIPGFMRLLQLIGVDVFVFKRNIEVTHRFCRDQIDRHRRNLAEVSEPADFLDAFLLEQQRLNSKRSDHS-FDDFQLVRTLTELFIAGTDTTSNTIRWALLYAALHPECQDRIAAEVE--AATGNSRLPVYRDKKAMHFTMAFIDEVQRYSTLAPFSVGHRCTRDIRFKGYDISSNDLIMVNLYGVHHDPELWDQPEQFRPERFINSSGEY--ETSEFLVPFSIGKRACLGESLARQELFLFLSGIFQAYRVELHKDCYKDLKDIEVGSAGLVHAPGKHQIIFHR 540          
BLAST of Cytochrome P450 2W1 vs. TrEMBL
Match: A0A267F088 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig002295g2 PE=3 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 2.071e-37
Identity = 124/477 (26.00%), Postives = 221/477 (46.33%), Query Frame = 2
Query:  371 FKNLFRIKSNENKFFMEMH----KIYGNIWSFRIINQRYVVLGAPELQTEAFKHS--GMTLSGRPLTELYKYVSKRRGVLSSDGQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNPGSIRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYIKNVQIITSSNLTFSN-AVFPLTNVPLLKYCVPSVLRIKKAMD-------NNVNILTELWKESKENCETNELESSSIGEF---YLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIELTNESKLNFEEILNGENGLVFAPFCHNLKFSR 1747
            F NLF +   E   F+  H    + YG++ SF   ++R+V+L +  +  EA          SGR  +     ++  +G++S++G++W  +R+   K L +      G E+ I   +  L   +D  P       L       +I  ++FN      DE    ++    + +  NL  +N   F  T  P L Y +P  +R+ + +         N+ +     ++  +    N  E S   +F   +L + Q       +H   +D   +R  +++  AG+DT + T+ W  L  A   + Q+++ +E+       +     Y DK  + +  +FI+EV RY T+ P +V HR  +++ F GY +  ND+I+ + Y  +H+ ++W   ++F  +RF+ +  E      E   PF  GKR C+GESLAR+E+ L L  +   Y++EL  +   + ++I  G  GLV AP  H + F R
Sbjct:   51 FGNLFNL---ERPTFLVAHSKWRRQYGDLVSFTFGSRRFVILNSYAVIKEALTSPEWAEVFSGRINSPFILSMTHGKGIVSAEGELWREHRRFALKVLRDFGFARSGTEEAIHAELAELQQTLDAEP-----DELVPRAIANVISVLLFNYRAGTQDEGFTDFM----LASQENLQGNNIGRFIPTAFPGL-YSIPGFMRLLQLIGVDVFVFKRNIEVTHRFCRDQIDRHRRNLAEVSEPADFLDAFLLEQQRLNSKRSDHS-FDDFQLVRTLTELFIAGTDTTSNTIRWALLYAALHPECQDRIAAEVE--AATGNSRLPVYRDKKAMHFTMAFIDEVQRYSTLAPFSVGHRCTRDIRFKGYDISSNDLIMVNLYGVHHDPELWDQPEQFRPERFINSSGEY--ETSEFLVPFSIGKRACLGESLARQELFLFLSGIFQAYRVELHKDCYKDLKDIEVGSAGLVHAPGKHQIIFHR 509          
BLAST of Cytochrome P450 2W1 vs. Ensembl Cavefish
Match: ENSAMXT00000048689.1 (cytochrome P450 2J6-like [Source:NCBI gene;Acc:103028795])

HSP 1 Score: 124.405 bits (311), Expect = 6.218e-30
Identity = 116/439 (26.42%), Postives = 201/439 (45.79%), Query Frame = 2
Query:  434 YGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKRRGV-LSSDGQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNPGS--IRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYIKNVQIITSSNLTFSNAVFPLTNVPLLKYCVPSVLRIKKAMDNNVNILTELWKESKENCETNELESSSIGEFYLKQL-QLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIEL-TNESKLNFEEILNGENGLVFAPFCHN 1732
            YG +    +  +  +VL   E+  EAF H+G   SGRP   +  +++   G+ + S G  W   R+     L +     +  E+ +TE  + L+  + ++ G        + +S++  II  IVF    D++D++    +K V        +F   VF L  VP +K+      +I K  ++    + ++ +E +     N L+  ++ +F    L ++TK    E    ++ N I + +D+  AG+DT A TL W  + + D   +Q +   EI   +        S  D++QLPY  + + E+ R   I+P  V H   +    HGY +     ++ +      + + W + D F  + F++ KE+  K+  E F PF  G R C+GESLAR E+ +   +LI   K      E + N    +NG  GLV  PF +N
Sbjct:   69 YGEMSCLFLGGRPIIVLNKMEIVKEAFVHNGAVFSGRPHMPVLDWITDGLGIIMVSYGNAWKQQRRFALHTLRDFGLGKKSVEERVTEEARYLVEEMLKHEGKAFFPIHPIMNSVS-NIICSIVFGDRYDYEDKRFAHLLKLVTENVRLTGSFVGQVFNL--VPFIKHFPGPHQKIWKNANSLKCFIRDIVEEHR-----NTLDPENLRDFIDAYLVEMTKQEAIEESTFHEENMIMSTADLFLAGTDTTATTLRWGIIYMMDHPDVQERCHEEIVRVLGFDRSP--SMDDRAQLPYTHATLHEIMRRSNIVPLGVGHETTQPTQLHGYHIPAGTQVVANFTAIMSDRNHWKHPDVFNPENFLDEKEQFCKN--EFFLPFSMGPRVCLGESLARTELFIFFSSLIQRLKFSWPPGEPRPN----MNGALGLVRCPFPYN 491          
BLAST of Cytochrome P450 2W1 vs. Ensembl Cavefish
Match: cyp2u1 (cytochrome P450 2U1 [Source:NCBI gene;Acc:103032979])

HSP 1 Score: 124.405 bits (311), Expect = 8.261e-30
Identity = 109/450 (24.22%), Postives = 194/450 (43.11%), Query Frame = 2
Query:  413 FMEMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKRRG-VLSSDGQIWVLYRKLTTKALHEISHKTRGFEDVITENI-----KLLLNYIDRNPGSIRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYIKNVQIITSSNLTFS-NAVFPLTNV-PLLKYCVPSVLRIKKAMDNNVNILTELWKESKENCETNELESSSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIELTNESKLNFEEILNGENGLVFAPFCHNL 1735
             M++ ++YGN++S  + NQ  VVL   E+  +A  +     S RP   L   ++KR+G V +  G +W   RK    AL          E  I E       +LL    +     +  + L  +    +I  I         DE+ +  +     + +S L  S N+   L N+ P L Y    V +  + ++ ++    +            E     I  + ++ L   K  E E    ++        D+  AG+DT   ++ W  L ++    +Q K++ EI+    V S    S +DK  LPY  + I EV R   ++P ++ H   K   F GY + +  +I+ + ++ + +  +W N D F   RF++ + + ++   E F PFG G+R C+GE LA+ E+ L   +++  +   L    +      +NG  GL  AP+ + +
Sbjct:   93 LMQLSRLYGNVYSIFVGNQLLVVLNGYEMVKDAMTNYAEVFSDRPDIPLVSILTKRKGIVFAPYGTVWRRQRKFCHTALRNFGLGKLSLEPCIHEGFTIVKAELLKRSQEAGAAGMDLTPLISNAVSNVISSISLGQRFHHQDEEFRTQLN----LMASGLEISVNSPALLINIFPWLYYLPFGVFKQLRKVERDITAFLKKIIAKHRATLDPENPRDFIDIYLIEMLAQEKAAELEEGGFSEEYLFFIIGDLFIAGTDTTTNSILWLVLYMSLYPDVQEKVQKEIDAV--VGSGRLPSLTDKGTLPYTEATIMEVQRMTVVVPLSIPHMASKTTEFRGYTIPKGTVIIPNLWSVHRDPTVWENPDDFCPSRFLDEQGQLLR--SEYFIPFGIGRRVCMGEQLAKMELFLMFTSMMQAFTFSLPEGHQ---PPPMNGRFGLTLAPYPYKV 531          
BLAST of Cytochrome P450 2W1 vs. Ensembl Cavefish
Match: ENSAMXT00000034412.1 (cytochrome P450 2B4-like [Source:NCBI gene;Acc:111195741])

HSP 1 Score: 122.479 bits (306), Expect = 2.465e-29
Identity = 114/439 (25.97%), Postives = 197/439 (44.87%), Query Frame = 2
Query:  362 VVLFKNLFRIK-SNENKFFMEMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKRRGVLSSD-GQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNPGS-IRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYIKNVQIITSSNLTFSNAVFPLTNVPLLKYCVPSVLRIKKAMDN-------NVNILTELWKESKENCETNELESSSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYK 1645
            V +F N+F++  SN  K F  + + YGN++S     +  V+L   +   EA        SGRP   L  ++++ +G+   D G  W   R+    +L       +  ED I   I+ L+  +D++ G  +    LFH     II+ ++F I  ++ DE +K+Y+ +    T     F   ++     P L+  +P  L  +KA+ +       N N++      SK        E  +  + YL +L+  K  E +     +   +R   D+  AG+DT + TL    L L     IQ K + EI+E ++ K+    S+ D+  +PY  + I E  R    +P +V H   ++    GY + ++ ++  +  +       W    +F  D F+ +  +  K   E F PF  G R C+GE LAR E+ L LV L+  ++
Sbjct:   34 VPIFGNVFQLNISNPLKDFERIAERYGNVYSLYFGGRPAVILTGFKAVKEALVTKAADFSGRPQNVLVSHITEGKGIAFVDYGPYWKEQRRFALMSLRNFGLGKQSMEDRILGEIQHLVVCMDKSVGGFMNPDTLFHEAASNIIYLVLFGIRYEYGDETLKQYVTSFVESTKIANGFWGMIY--DTFPALR-GLP--LPFRKAITHFDIVKNINANMV------SKHKPSRVPGEPKNFVDCYLDELEKQK--ENDGSSFTEGQLVRTIMDLHAAGTDTTSNTLRTAFLYLITHPDIQEKCQREIDEALKGKAHA--SFEDRHDMPYTQAVIHESLRIAKTVPLSVPHCTTRDTELMGYSIPKDTLVFPNLASVLSEEGQWKFPHEFNPDNFLNDHGQFEK--PEAFLPFSAGPRVCLGEGLARMELFLILVTLLRRFQ 455          
BLAST of Cytochrome P450 2W1 vs. Ensembl Cavefish
Match: ENSAMXT00000057567.1 (cytochrome P450 2B4-like [Source:NCBI gene;Acc:111195741])

HSP 1 Score: 122.094 bits (305), Expect = 3.031e-29
Identity = 114/435 (26.21%), Postives = 195/435 (44.83%), Query Frame = 2
Query:  362 VVLFKNLFRIK-SNENKFFMEMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKRRGVLSSD-GQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNPGS-IRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYIKNVQIITSSNLTFSNAVFPLTNVPLLKYCVPSVLRIKKAMDN-------NVNILTELWKESKENCETNELESSSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALI 1633
            V +F N+F++  SN  K F  + + YGN++S     +  V+L   +   EA        SGRP   L  ++++ +G+   D G  W   R+    +L       +  ED I   I+ L+  +D++ G  +    LFH     II+ ++F I  ++ DE +K+Y+ +    T     F   ++     P L+  +P  L  +KA+ +       N N++      SK        E  +  + YL +L+  K  E +     +   +R   D+  AG+DT + TL    L L     IQ K + EI+E ++ K+    S+ D+  +PY  + I E  R    +P +V H   ++    GY + ++ ++  +  +       W    +F  D F+ +  +  K   E F PF  G R C+GE LAR E+ L LV L+
Sbjct:   34 VPIFGNVFQLNISNPLKDFERIAERYGNVYSLYFGGRPAVILTGFKAVKEALVTKAADFSGRPQNVLVSHITEGKGIAFVDYGPYWKEQRRFALMSLRNFGLGKQSMEDRILGEIQHLVVCMDKSVGGFMNPDTLFHEAASNIIYLVLFGIRYEYGDETLKQYVTSFVESTKIANGFWGMIY--DTFPALR-GLP--LPFRKAITHFDIVKNINANMV------SKHKPSRVPGEPKNFVDCYLDELEKQK--ENDGSSFTEGQLVRTIMDLHAAGTDTTSNTLRTAFLYLITHPDIQEKCQREIDEALKGKAHA--SFEDRHDMPYTQAVIHESLRIAKTVPLSVPHCTTRDTELMGYSIPKDTLVFPNLASVLSEEGQWKFPHEFNPDNFLNDHGQFEK--PEAFLPFSAGPRVCLGEGLARMELFLILVTLL 451          
BLAST of Cytochrome P450 2W1 vs. Ensembl Cavefish
Match: ENSAMXT00000034712.1 (cytochrome P450 2J6-like [Source:NCBI gene;Acc:103028795])

HSP 1 Score: 120.168 bits (300), Expect = 1.622e-28
Identity = 115/439 (26.20%), Postives = 198/439 (45.10%), Query Frame = 2
Query:  434 YGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKRRGV-LSSDGQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNPGS--IRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYIKNVQIITSSNLTFSNAVFPLTNVPLLKYCVPSVLRIKKAMDNNVNILTELWKESKENCETNELESSSIGEFYLKQL-QLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIEL-TNESKLNFEEILNGENGLVFAPFCHN 1732
            YG +    +  +  +VL   E+  EAF H+G   SGRP   +  +++   G+ + S G  W   R+     L +     +  E+ +TE  + L+  + ++ G        + +S++  II  IVF    D++D++    +K V        +F   VF L  VP +K+      +I K  ++    + ++ +E +     N L+  ++ +F    L ++TK    E    ++ N I + +D+  AG+DT A TL W  + + D   +Q +   EI   +        S  D++QLPY  + + E+ R   I+P  V H   +    HGY +     ++ +        + W   D F  + F++ K +  K+  E F PF  G R C+GESLAR E+ +   +LI   K      E + N    +NG  GLV  PF +N
Sbjct:   69 YGEMSCLFLGGRPIIVLNKMEIVKEAFVHNGAVFSGRPHMPVLDWITDGLGIIMVSYGNAWKQQRRFALHTLRDFGLGKKSVEERVTEEARYLVEEMLKHEGKAFFPIHPIMNSVS-NIICSIVFGDRYDYEDKRFAHLLKLVTENVRLTGSFVGQVFNL--VPFIKHFPGPHQKIWKNANSLKCFIRDIVEEHR-----NTLDPENLRDFIDAYLVEMTKQEAIEESTFHEENMIMSTADLFLAGTDTTATTLRWGIIYMMDHPDVQERCHEEIVRVLGFDRSP--SMDDRAQLPYTHATLHEIMRRSNIVPLGVGHETTQPTQLHGYHIPAGTQVVANFTAIMSERNHWKYPDVFNPENFLDEKGQFCKN--EFFLPFSMGPRVCLGESLARTELFIFFSSLIQRLKFSWPPGEPRPN----MNGALGLVRCPFPYN 491          
BLAST of Cytochrome P450 2W1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011205.1 (pep scaffold:Pmarinus_7.0:GL477378:108537:110066:1 gene:ENSPMAG00000010178.1 transcript:ENSPMAT00000011205.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.9669 bits (219), Expect = 5.350e-19
Identity = 91/415 (21.93%), Postives = 181/415 (43.61%), Query Frame = 2
Query:  419 EMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKRRGVLSSD-GQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNPGSIRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYI----KNVQIITSSNLTFSNAVFPLTNVPLLKYCVPSVLRIKKAMDNNVNILTELWKESKENCETNELESSSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIP-RTVHRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYK 1645
            E+ K YG + S  +     V +   +   E   H G   + RP T   K V+   G++ +  G+ W+ +R+ T   L          E  I   +  L+    +   +       +S    II  +V     ++ D++ + ++     N+Q+ +    T  N +FP     L+ +  P  + I K+M  +   + ++  E   +   + ++   + + YL QL+     +  +   ++ + I    D+  AG++T + TL W  L +    +IQ +   EI++ V    +      D+  LPYL + I E+ R+  I+P    H    ++ F  Y + +  II+ +  +   + + W    +F  + F++   + +K   + F PF  G R C+GE+LA+ E+ L   +L+ H++
Sbjct:   78 EVTKQYGEVCSVMVGKISMVFVSGYQAVKEVLVHQGHEFADRPNTPFNKKVNGGLGIIFAPYGKYWMQHRRFTLSTLRNFGLGKSSIEQTIQAEVGFLIEAFKQKGSAFDPHYDLNSAVGNIICSMVKGKRYEYSDKQFQDFLHLVENNLQLQSGLLGTLCN-IFPF----LMDFPGPQQI-IFKSMAKSKQFIRDIISE--RHATRDPIKPMCLIDAYLSQLEKE---DNPNSSFSEQSLIMLALDLFIAGAETTSTTLRWGLLYMMMHPEIQAQCHEEIDKIVGSDRLP--CMEDRHSLPYLDAVIHEIQRFSNIVPFGAPHATTADVKFRQYLIPKGTIIMVNMKSVLSDENHWKTPYEFSPENFLDEDGKFVK--PDAFLPFSAGPRVCLGENLAKMELFLFFASLLQHFE 477          
BLAST of Cytochrome P450 2W1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011254.1 (pep scaffold:Pmarinus_7.0:GL479221:5463:6953:-1 gene:ENSPMAG00000010227.1 transcript:ENSPMAT00000011254.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.8113 bits (216), Expect = 1.312e-18
Identity = 96/431 (22.27%), Postives = 182/431 (42.23%), Query Frame = 2
Query:  389 IKSNENKFFMEMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKRRGV-LSSDGQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNPGSIRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYIKNVQIIT---SSNLTFSNAVFPLTNVPLLKYCVP--SVLRIKKAMDNNVNILTELWKESKENCETNELESSSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIELTN 1660
            I +N +    E+ K YG + +  + +   V++   E   E   + G   + RP+T ++  +++  G+ L+  G  W   R+     L           D I+   K L+    +   +       ++    II  ++     D+D+E+ +K    ++ +    +  L     VFP     LLK   P   V  I   +   +N +    + +K+     +L  S     YL Q+   K  +  +      + I+   ++   G +T + TL W  L +     IQ +   EI+  V  +       +D+  LPYL + I E+ R+  ++P  V H   K++ F+ Y   +   ++ +  ++ H+   W   +KF  D F++   + I+   + F PF  G R C+GESLA+ E+ L   +L+ H++    N
Sbjct:   55 ICNNPHIAMQELAKKYGEVCTIMLGSTPVVLVSGYEAVKEVLVNRGHEFADRPITPIFTKLTQNIGIALAPYGDPWKQQRRFALSTLRNFGFGKATIADKISIEAKYLIETFKQETSAFDPHLNLNNALGNIICCLLNRNRYDYDNEQFQKLTHLLEYLVQLQAEPLVILCNVFPF----LLKLPGPWQKVFHIHSKLQCLLNDIVSEHRATKDQHNPRDLIDS-----YLAQIDKEK--DNPNSSFTHQSLIQILIELFIGGLETTSNTLRWGLLFMMMNPDIQARCHGEIDRVVGSERPP--CMTDRRSLPYLDAVIHEIQRFGNVLPLGVLHATSKDVQFNDYLFPKGTHVMVNLMSALHDDIHWKTPNKFNPDHFLDKDGQCIQ--SDAFLPFSAGPRVCLGESLAKMEIFLFFTSLLQHFEFYWPN 470          
BLAST of Cytochrome P450 2W1 vs. Ensembl Sea Lamprey
Match: cyp1d1 (cytochrome P450, family 1, subfamily D, polypeptide 1 [Source:ZFIN;Acc:ZDB-GENE-041114-179])

HSP 1 Score: 80.1073 bits (196), Expect = 4.332e-16
Identity = 55/192 (28.65%), Postives = 102/192 (53.12%), Query Frame = 2
Query: 1076 LTKVYEEEHQ----HLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKI-KHLQENFYPFGTGKRNCIGESLARKEVLLTLVALI 1633
            +    E+EH      L+D   +    DI GAG DT+   L WC L L     +Q+KL+ EI+E +       F   D++ L  + +F+ E+ R+   +P T+ H   ++++ +G  +  +  +  + +  NH+  +W + ++F  DRF+ +  +++ K + E    FG GKR C+G+ +AR+E+ + LV L+
Sbjct:  304 IAMCAEQEHALREVGLSDERVVATALDIFGAGFDTIITGLTWCLLYLCIHPDVQHKLQREIDETIGRDRTPRFE--DRANLRRVEAFLTEMFRHSAFVPFTIPHSTTQDVVLNGMFIPRDTCVFVNLHQVNHDPTVWSDPERFDPDRFLSHDGKEVNKEMVEKVQIFGLGKRRCLGDMVARQELFVVLVTLL 493          
BLAST of Cytochrome P450 2W1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011204.1 (pep scaffold:Pmarinus_7.0:GL477378:78074:79555:1 gene:ENSPMAG00000010177.1 transcript:ENSPMAT00000011204.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.7962 bits (190), Expect = 1.889e-15
Identity = 92/423 (21.75%), Postives = 175/423 (41.37%), Query Frame = 2
Query:  419 EMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKRRGV-LSSDGQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNPGSIRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKY---IKNVQIITSSNLTFSNAVFPLTNVPLLKYCVP--SVLRIKKAMDNNVNILTELWKESKENCETNELESSSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTVHRPM-KNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIELTNES 1666
            E+ K YG + +  + +   V++   +   E   + G   + RP+T L+  ++   G+ L+  G  W   R      L           D I+   + L+    +         + +S    II  ++  I  D+++E+ +K    ++++  + +  L     VFP     L+K   P   V  I   +   +  +    + +K+     +L  S     YL  +   K  +  ++   D   I    ++   G +T + TL W  L +     IQ +   EI++ V  +        D+  LPYL + I E+ R+  I+P  V  P  K++ F+ Y   +   ++ +  ++ ++   W    KF  D F++   + IK   + F PF  G   C GESLA+ E+ L   +L+ H++    N +
Sbjct:   61 ELAKKYGEVCTIMLGSTPVVLVSGYQAVKEVLVNRGHEFADRPITPLFTKLTHNIGIALAPYGDTWKQQRGFALSTLRNFGFGKATITDKISIEARYLIETFKQETSEFDPKFILNSAVGNIICSLLNGIRYDYNNEQFQKLTHLLEHLVQLQAEPLVILCNVFPF----LIKLPGPWQKVFHIHTKLQCLLKDIVSEHRATKDQHNPRDLIDS-----YLAHIDKEK--DNPNRSFTDQTLILLLIELFIGGMETTSNTLCWGLLFMMMNPDIQARCHEEIDKVVGSQRPP--CMKDRRSLPYLDAVIHEIQRFGNILPFGVLHPTSKDVQFNEYVFPKGTHVMVNLMSAFYDDIHWKTPHKFNPDNFLDKDGQCIK--SDAFLPFPAGPCVCFGESLAKMELFLFFTSLLQHFEFYWPNSA 468          
BLAST of Cytochrome P450 2W1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008590.1 (pep scaffold:Pmarinus_7.0:GL483327:8497:10357:1 gene:ENSPMAG00000007780.1 transcript:ENSPMAT00000008590.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.0182 bits (175), Expect = 4.122e-15
Identity = 44/148 (29.73%), Postives = 77/148 (52.03%), Query Frame = 2
Query: 1283 SYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYK-IELTNESKLNFEEILNGENGLVFAP 1720
            S SD+ +LP+  + + EV R+ +I+P  + H   ++ +F GY L E  I+     +   +   W   ++F    F+ +++ K +  ++ F PF  G+R C+GE LA+ E+ L LVAL+  +  +       LN    L  +NG+  AP
Sbjct:    7 SLSDREKLPFTNAVLYEVQRFASIVPLALPHATTRDALFQGYFLPEGTIVFAVLDSVLKDPSQWETPEEFNPSHFL-DRDGKFRK-RDAFLPFSAGRRVCLGEQLAKAELFLFLVALLQKFSFVAPRGPDSLN----LAPQNGITVAP 148          
BLAST of Cytochrome P450 2W1 vs. Ensembl Nematostella
Match: EDO40300 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7U4])

HSP 1 Score: 105.145 bits (261), Expect = 4.340e-24
Identity = 106/447 (23.71%), Postives = 191/447 (42.73%), Query Frame = 2
Query:  413 FMEMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKRR---GVLSSD-GQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYI---DRNPGSIRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKK--YIKNVQIITSSNLTFSNAVFPLTNVPLLKYCVPSVLRIKKAMDNNVNILTELWKESKENCETNELESSSIGEFYLKQLQLTKVYEEEHQHLNDMNFI-RNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIELTNESKLNFEEILNGENGLVFAP 1720
            F  + K YG I+   + ++  +VL    ++ EA        +GRPL  + + +  +R    + + D G+ W ++RKL    + ++  + R  ++VI E +  L   +   D  P  I  +  F +    +I   +F    D +D + ++  YI +     +    +    FP    P L Y    V  IK+       I+   + E  E  + N +   +      KQ +  +  +   +H  +   I      +  AGS+T   TL+W    L     +Q +L  EI++ +     +    S +  +P L +F  E  R   ++P ++ H+   +    GY++ +   +  + ++ +H+  IW   D F  DRF++ K +    +   F PFG G R C+GE LAR E+ L L  L+ H+  E  N         L G+ G+V  P
Sbjct:   24 FAALEKTYGKIFRVYLAHKPIIVLSGDAIK-EALVRQPRNFAGRPLLPITEEIVDKRWGPALFAMDYGERWRIFRKLGHSTI-KVYGEDR-LQEVINEEVSELCKRLEESDEKP--IDITKQFGTAVTNVICTKIFGNRYDINDPEFQRLYYINDKSTRLNIGEGWLKEAFPFLK-PFLPYSQ-QVKEIKELDQERFVIMRAKYDEHVETFDPNHIRDYTDALLKAKQ-EAEEEDKSSKEHFGEGPIIMAGLVTLFLAGSETTTTTLSWAIAYLLHNPGVQARLHKEIDQVI--GKDVSPKLSQRKNIPVLEAFTAETQRLSNLVPLSLPHKTTSDCTLLGYEIAKGTTVFTNLWSLHHDPSIWKEPDTFNLDRFLDAKGKFQAPVGGTFLPFGAGPRVCLGEVLARSELFLFLATLLQHF--EFVNPLGCPLPS-LEGDMGVVLHP 457          
BLAST of Cytochrome P450 2W1 vs. Ensembl Nematostella
Match: EDO41250 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S508])

HSP 1 Score: 105.145 bits (261), Expect = 5.604e-24
Identity = 107/436 (24.54%), Postives = 204/436 (46.79%), Query Frame = 2
Query:  377 NLFRIKSNENKFFM-EMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMT-LSGRPLTELYKYVSK--RRGVLSSDGQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNPGSIRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYIKNVQIITSSNLTFSNAVFPLTNVPLLKYCVPSVLRI-KKAMDNNVNILTELWKESK----ENCETNELESSSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKN-LIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIE 1651
            NL  I  +++     ++ K YG+I+  +I N R+V + +     E      M  L+GRP T  +  +S+  +  VL    +  V  RK+    L     K    E++  E  KL    ++    +I +  +F  +   II   +   + + DD      ++ ++I   S +  S ++  L   P L +   S  R  K  ++    +L + + E K    E+C  +  ++     F   +L++ +  ++    + D +     +D+   G +T + TL+W    L +   +Q +L+++I++F+  +  +    +DK  LPY+ + I EV R  T++P  V H+   N +   GY + ++ II+ + +  +H+   WPN DKF  DRF+    +     Q ++ PF  G+R C+GESLA+ E+ L +  L+  + +E
Sbjct:   40 NLLSITGSDSHIAAAKLAKTYGDIFMLKIFNDRFVFVSSGAGAREVLMGKRMNDLAGRPQTFTFNLLSRGAKDIVLGDYSRHLVWRRKIVHLGLRMYFPKLE--ENIAWEVSKLEGKLMEDIGAAIHSKEVFLLLITNIISSFLLGKSYEPDDPDFLTTLEFIRI--GSQVPVSGSI--LDKFPFLYHLPISESRFYKNVVEPRDRLLDKFFLEHKSTFSEDCIRDLTDA-----FLKAKLEVEREDKKAIGEVTDDHITMLMTDVYVGGLETTSTTLSWLAAYLINYPLVQTRLQTDIDDFIGSRWPVL---ADKPNLPYMEATIAEVLRIATVLPMGVPHKATTNNVPLMGYNIPKDTIIVMNLWAIHHDPREWPNPDKFDPDRFINEDGKFEVPGQRSYLPFSAGRRVCVGESLAKIELFLVMTRLLQQFTLE 461          
BLAST of Cytochrome P450 2W1 vs. Ensembl Nematostella
Match: EDO48774 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI92])

HSP 1 Score: 104.76 bits (260), Expect = 5.806e-24
Identity = 109/482 (22.61%), Postives = 208/482 (43.15%), Query Frame = 2
Query:  368 LFKNLFRIKSNENKFFMEMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKRRGVLSSDGQIWVLYRK----LTTKALHEISHKTRGFEDVITENIKLLLNYI------DRNPGSIRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYIKNVQIITSSNLTFSNAVFPLTNVPLLKYCVPSVL-RIKKAMDNNVNILTELWKESKENCETNELESSSIGEFYLKQLQLT-KVYEEEHQH------------LNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIELTNESKLNFEEILNGENGLVFAPFCHNLK 1738
            L  NL  + S  +     +  IYG I++  + +Q  VVL + E+  EA    G   +GRP   +    S+    +        L R+    + T    E        +++IT  +  L +        D +P   R    F +    ++ +I F      ++E+  + + +++I     LT ++ +      PLL+Y   S++ R++ A+    ++L + ++E ++    +       G    K   LT  + EE +Q             L D + +   +D + AGS+T    L W          +Q +   +I++ +     I  ++ D+ +LPYL +FI EV R  +I+P  V H  M +++  GY + +   ++ + +   H+  +W    +F  +RF++++        E F P+G G R+C GE LAR E+ L  V L+  ++   +        E+L+GE G+   P    ++
Sbjct:    8 LIGNLHLLSSKPHLDLARLGNIYGPIYTLNMGSQLAVVLNSYEIAKEALMKRGNAFAGRPHHFVGSKFSRGGKGVGFQNYTPTLRRQQKTIMKTVKYFETLKTGENLQEIITNEVDYLCDLFVSHGCQDFDP---RRDMTFAAGN--VVGRITFGERFTVENEEFWQLMDSLKIFVE-GLTATSFI---DAFPLLRYFPFSLVKRVQTAVKLRDDVLNKRFREHQDRLRGD-------GMVLAKSKDLTYALIEEANQKTSRTDSQSDTLILTDDHVMMTMNDTIMAGSETPTMLLLWNIYFFVKYPDVQARAFKQIDKVISPDQPI--TWEDRKRLPYLEAFIAEVMRIISIMPLAVPHLAMVDMVLAGYHISKGTTVIVNLWAMGHDPKVWDAPMEFRPERFLDSRGGFSTASSEGFTPYGMGLRSCPGEQLARMELFLFTVRLLRMFEFRASEA----LPEMLDGEFGITIRPLPFKIR 467          
BLAST of Cytochrome P450 2W1 vs. Ensembl Nematostella
Match: EDO32562 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUQ2])

HSP 1 Score: 104.76 bits (260), Expect = 9.397e-24
Identity = 113/480 (23.54%), Postives = 202/480 (42.08%), Query Frame = 2
Query:  383 FRIKSNENKFFMEMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKRRGVLSSDGQI-------WVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYID---RNPGSIRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYIKNVQIITSSNLTFSNAV---FPLTNVPLLK-YCVPSVLRIKKAMDNNVNILTELWKESKENCETNELESSSIGEFYLKQLQLTKVYEEEHQ---------HLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKI-KHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIELTNESKLNFEEILNGENGLVFAPFCHNLKFSR 1747
            FR+    +  F+EM + YG ++S  + ++  VVL    LQ           +GRP  +LY     R G    DG I       W L RK    A+H+        E ++ +    L+  +D     P ++     F   T ++I  I+F  N D           +V+ I  ++  F   V     +  +P ++ + +P V R+ K   +   +L  L++E+K         +S  G        + KV EE  Q          + D++ ++   D+VGAG DT + TL W         ++Q ++  EI+  +    +   +  D   LPY  + + E+ R   + P  V H  ++ + F GY + ++ +I  + ++   N + W N D F   RF++ +   +  +    F PFG G R C G  LA  E++  + A++  ++      +  +    L GE GL   P  +++  +R
Sbjct:   67 FRLGPKSHLDFLEMSRNYGQVFSMYLGSRLVVVLNGMALQEALTGKLSRVFAGRP--KLYTMERCRNG---GDGLINAPYCRKWKLMRKTAITAIHKYIATQDVLESILGKVAHGLVQRLDACAETPHNVMPELKF--ATASVILGILFGENHD---------ASHVESILGTSDDFRKCVGCGLAVDFMPWMENFPIPKVNRMVKLTSDMNAVLKNLYEENK---------TSYSGRIRNLADAVIKVSEEHSQIDDDSDPKGEMADLDVVQTIVDLVGAGFDTSSLTLYWAIAYFVKYPQVQRRIHHEIDTVIGRDRIP--TLDDVKHLPYTHACLYELLRVTCLAPTAVPHSTLEEVDFRGYTIPKDTVIFANIWSLLRNEEYWQNPDVFDPMRFLDEEGRLLNPNSWPTFLPFGAGIRKCTGRELAIAELMFFITAIMQKFRFSEEGLTADHPPIDLTGEAGLTLKPADYHVIITR 519          
BLAST of Cytochrome P450 2W1 vs. Ensembl Nematostella
Match: EDO41284 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S507])

HSP 1 Score: 103.605 bits (257), Expect = 1.835e-23
Identity = 104/440 (23.64%), Postives = 211/440 (47.95%), Query Frame = 2
Query:  377 NLFRIKSNENKFFM-EMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMT-LSGRPLTELYKYVSK-RRGVLSSDGQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRN-----PGSIRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYIKNVQIITSSNLTFSNAVFPLTNVPLLKYCVPSVLRI-KKAMDNNVNILTELWKESK----ENCETNELESSSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKN-LIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIE 1651
            NL  I  +++     ++   YG+I++ +I N R+V + +     E      M  L+GRP T  + ++++  + ++  D    +++R+   K +H      R +   + ENI   ++ ++R        ++ + + F  +   II   +   + + DD      ++  +I   S L  S ++  L N P L +   S  R  KK ++    +L + + E K    E+C  +  ++     F   +L++ +  ++    + D +     +D+  AG +T + TL+W    L +  ++Q +L+++I++ +  +  +    +DK  LPY+ + I EV R  T+ P  + H+   N +   GY + ++ II+ + +  +H+   WPN DKF  DRF+    +     Q ++ PF  G+R C+GESLA+ E+ L +  L+  + +E
Sbjct:   40 NLLSITGSDSHLAAAKLANTYGDIFTLKIFNDRFVFVSSGAGAREVLMGKRMNDLAGRPQTFTFNFLTRGAKDIIFGDYSRHLVWRR---KIVHS---GLRMYFPKLEENIAWEVSKLERKLMKDVGTALHSRDEFSLLITNIISSFLLGKSFEPDDPDFLTTLEFTRI--GSQLPVSGSI--LDNFPFLVHLPISESRFYKKLVEIRDRLLDKFFLEHKSTFSEDCIRDLTDA-----FLKAKLEVEREDKKAIGEVTDDHITMLMTDVYFAGLETTSTTLSWLAAYLINYPQVQTRLQTDIDDVIGSRWPVL---ADKPNLPYMEATIAEVLRIATVAPMGLPHKATTNNVPLMGYNIPKDTIIVMNLWAIHHDPREWPNPDKFDPDRFINEDGKFEVPGQRSYLPFSAGRRVCVGESLAKIELFLVMTRLLQQFTLE 461          
BLAST of Cytochrome P450 2W1 vs. Ensembl Medaka
Match: ENSORLT00000024770.2 (cytochrome P450 2J6 [Source:NCBI gene;Acc:101169416])

HSP 1 Score: 135.961 bits (341), Expect = 6.762e-34
Identity = 115/425 (27.06%), Postives = 200/425 (47.06%), Query Frame = 2
Query:  413 FMEMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKRRGVLSSD-GQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNPG-SIRTSNLFHSMTLTIIFKIVFNINTDFDDEKI----KKYIKNVQIITSSNLTFSNAVFPLTNVPLLKYCVPSVLRIKKAMDNNVNILTELWKESKENCETNELESSSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIELTNES 1666
            F +M + YGN++SF I ++  VV+   +   EA        SGRP       +++R+GV+  D G +W  +R+     L          E+ I E I+  ++ ++ N G ++    +FH+    II K++FN   D++D KI    + +++ +QI         +A   + + PL         +  + M+N +N+   L  E K +    E       + YL +L+  K    E Q L  M F     D+  AG+DT + T+    L L     IQ K + EI++ +E K  +  S+ D+ ++PY+ + I EV R+  I+P +V H   K+    GY + +  +I+ +  +       W    +F  + F+ ++ E IK   E F PF  G R C+GE LAR E+ + +V L+  +K     ++
Sbjct:   52 FEKMKESYGNVYSFFIGSRPAVVVNGLQAMKEAIMIKATDFSGRPQDMFVSDLTQRKGVILVDYGSVWRDHRRFALMTLRNFGLGKISMEERIHEEIQFTISKLEENIGKTLSPKFMFHNAASNIICKVLFNTRYDYEDGKISEIVQGFVEMLQIANGPWAMMYDAFPWIRSFPL------PFNKAFRNMENFLNLAKRLVNEHKMSRVAGE--PRDFVDSYLDELEKNKKDFSEQQLLR-MTF-----DLYIAGTDTTSNTMLAGFLYLMVYPHIQEKCQREIDQMLERKDRV--SFEDRHKMPYMQAVIHEVQRFANIVPLSVFHCTTKDSELSGYTIPKGTLIIQNMVSVLREEGQWKFPHEFNPENFLNDQGEFIK--PEAFMPFSAGPRMCLGEGLARMELFIIMVTLLRKFKFTWPEDA 458          
BLAST of Cytochrome P450 2W1 vs. Ensembl Medaka
Match: ENSORLT00000017336.2 (pep primary_assembly:ASM223467v1:6:26186654:26196090:-1 gene:ENSORLG00000013826.2 transcript:ENSORLT00000017336.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 125.946 bits (315), Expect = 1.357e-30
Identity = 117/433 (27.02%), Postives = 201/433 (46.42%), Query Frame = 2
Query:  377 NLFRIKSNEN-KFFMEMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKRRGV-LSSDGQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNPGSIRTSN-LFHSMTLTIIFKIVFNINTDFDDEKIKKYIKNVQIITSSNLTFSNAVFPLT--NVPLLKYCVPSVLRIKKAMDNNVNILTELWKESKENCETNELESSSIGEFYLKQLQLTKV---YEEEHQHLNDMNFIRNFS-DIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYK 1645
            NL  + +++  K F  + K YGN++S  I  Q  VV+   +   EA  + G   +GRP      +V+++ GV L + G  W  +R+     L          ED I E I+  +  ++++ GS  +   +FH+    II ++++    +++DE IK  IK      + N   +N  + +   ++P+L+       +  K  +   NI  +L KE KE     E       + YL +L+       + EE         +  +S D+  AG+DT + TL    L L     IQ + + EI+  +E K  +  S+ D++ +PY+ + I EV R   I+P +V H  MK+     Y + +  +++ +  +       W    +F  + F+  K E +K   E F PF  G R C+GE LAR E+ LT+V L+  +K
Sbjct:   39 NLLHLSTDDPLKDFERLRKSYGNVFSVFIGPQPAVVINGLKAMKEALVNKGSDFAGRPQDLFINHVTQQLGVVLENYGTTWREHRRFALMTLRNFGLGKTSMEDRIHEEIQQTIKTLEKSIGSTLSPQVIFHNAASNIICQVLYGKRFEYNDEMIKVIIKCF----TDNAKMTNGPWAMIYDSLPILRKLPLPFRKAFKNYETCKNIAFDLLKEHKETKVPGE--PRDFVDCYLDELEKKSADSSFSEER--------LAGYSLDLYFAGTDTTSNTLLTGFLYLVGHPHIQERCQQEIDLVLEGKDQV--SFEDRNNMPYMQAVIHEVQRIANIVPFSVFHATMKDTELMEYSIPKGTMVIQNMKSVLTEEGQWKFPHEFNPENFLNEKGEFVK--PEAFMPFSAGPRVCLGEGLARMELFLTMVTLLRKFK 453          
BLAST of Cytochrome P450 2W1 vs. Ensembl Medaka
Match: ENSORLT00000017318.2 (pep primary_assembly:ASM223467v1:6:26173766:26186815:-1 gene:ENSORLG00000013811.2 transcript:ENSORLT00000017318.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 117.087 bits (292), Expect = 1.593e-27
Identity = 108/428 (25.23%), Postives = 191/428 (44.63%), Query Frame = 2
Query:  398 NENKFFMEMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKRRGVLSSD-GQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNPGSIRTSN-LFHSMTLTIIFKIVFNINTDFDDEKIKKYIKNVQIITSSNLTFSNAVFPLT--NVPLLKYCVPSVLRIKKAMDNNVNILTELWKESKENCETNELESSSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIELTNES 1666
            N  K F  +   YGN++S  +  +  V++   +   EA        +GRP       VSKR+GV+ +D G+ W  +R+     L       +  E+ I+E I+  +  ++ N G + +   +FH+    II +++F    ++DDE IK     VQ  T  N   +N  + +   ++PL++          K  +  V++ T L  E KE     +       + YL +++       +    ++   I    D+  AG+DT + TL      L +   IQ+K + EI+  +E K  +  ++ D+  +PY+ + I EV R    +P +V H   K     GY + +  +I+ +  +       W     F  + F+  K E +K   E F PF  G R C+GE LAR E+ + +V L+  +K     ++
Sbjct:   47 NPLKDFDRLRNSYGNVYSLFLGPKPAVIINGFKAMKEAMVIKATDFAGRPQDLFVNDVSKRKGVILADYGESWRDHRRFALMTLRNFGLGKKSMEERISEEIQHTIKTLENNIGKLFSPQIMFHNAASNIICQVLFGKRFEYDDEIIKTI---VQCFTR-NSKIANGPWAMIYDSIPLIRKLPLPFREAFKNAEICVDVGTHLVNEHKETRIPGK--PRDFVDCYLDEME----KRGDDSSFSEDQLIIYALDLHFAGTDTTSNTLLTGFFYLINYPHIQDKCQQEIDRVLEEKQQV--TFEDRHNMPYMQAVIHEVQRIANTVPLSVFHSTTKETELMGYTIPKGTMIIQNMGSVLREDGQWKFPHDFNPENFLNEKGEFVK--PEAFMPFSAGPRMCLGEGLARMELFIIMVTLLRKFKFTWPEDA 460          
BLAST of Cytochrome P450 2W1 vs. Ensembl Medaka
Match: ENSORLT00000019638.2 (cytochrome P450 2K1 [Source:NCBI gene;Acc:101157991])

HSP 1 Score: 114.005 bits (284), Expect = 1.820e-26
Identity = 111/446 (24.89%), Postives = 194/446 (43.50%), Query Frame = 2
Query:  419 EMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKRRGVLSSDGQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNPG-SIRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYI----KNVQIITSSNLTFSNAVFPLTNVPLLKYCVPSVLRIKKAMDNNVNILTELWKESKENCETNELESSSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIELTNESKLNFEEI-LNGENGLVFAPFCHNL 1735
            E  K YG +++     ++ VVL   +    A  +       R +  + + ++K  GVL S+G IW   R+     L +     +  ED ITE  + LL    +  G +  T+   +     II  +V+    ++DD K    +    +N+Q+  S  L   N       VP L   V S   + +    N      ++   KE     ++    +  F +K   L K     +   ND N +     +  AG++T + TL W  LL+A   KIQ++++ E+   +  + V     SD+  LP+  + I E+ R  +I+P  + H+  K++ F GY + +   +     +  H+A+ W     F    F++   + +K  +E F PF  G+R C+GESLAR E+ +    L+ ++    T    ++ EE+ L    G+   P  H L
Sbjct:   67 EFSKTYGPVFTVFFGGEKVVVLAGYKTVKNALVNHDEEFGERAIPPIIQELNKGLGVLWSNGDIWRDIRRFALTNLRDFGMGKKACEDKITEECQYLLEVFKKFKGNAFDTTKPLNYAVSNIICSMVYGSRFEYDDPKFTSMVDRTNRNIQLSGSPTLQAYNM------VPWLFKWVASRREVHECAAANRKQNQSIFSHLKETLNP-QMCRGFVDAFLVKGQTLEK-SGVTNSAFNDENLLMTVIHLFAAGTETTSTTLRWGLLLMAKYPKIQDQVQDELRRVIGDRMV---QVSDRKNLPFTDAVIHEIQRLASIVPTALPHKTSKDVTFQGYFIKKGTTVFPLLTSVLHDANEWEKPHTFYPAHFLDKDGKFVK--REAFIPFSAGRRICLGESLARMELFMFFTTLLQNFC--FTPPPGVSKEELSLTPCGGITVGPVPHKL 497          
BLAST of Cytochrome P450 2W1 vs. Ensembl Medaka
Match: ENSORLT00000020799.2 (cytochrome P450 2J6 [Source:NCBI gene;Acc:101155419])

HSP 1 Score: 112.849 bits (281), Expect = 4.585e-26
Identity = 112/443 (25.28%), Postives = 200/443 (45.15%), Query Frame = 2
Query:  413 FMEMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKRRGVLSSDGQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNPGSIRTSNLFHSMTLT-IIFKIVFNINTDFDDEKIKKYI----KNVQIITSSNLTFSNAVFPLTNVPLLKYCVPSVLRIKKAMDNNV-NILTELWKESKENCETNELESSSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTV-HRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIELTNESKLNFEEILNGENGLVFAP 1720
            F ++   YG+++S R   +  VVL   +   EA    G ++  RP   L   ++K  GV+ S+G  W   R+     L       +  E VI          + R  G     +L  + T++ II  +VF    ++ D+K KK +    + +QI  S      N+        L+  C+P   +  + +   V + + E  KE K++ + +  ++    +FYL ++Q TK   +E    ++ N I    D+  AGS+T + TL W  L +A   +IQ K+++EI++ +           D+++LPY  + I EV R   I+P ++ H   K++   G+ + +  +I+ +  +   +   W     F    F+    + +K  +  F PF  GKR C+GE+LAR E+ L   + + H+   +        E +L+   GL  AP
Sbjct:   89 FSKLAAEYGDLYSLRFGQRWTVVLNGHKALKEALVTKGDSVVDRPHLPLQDEIAKGLGVIFSNGANWTEQRRFALSTLRYFGFGKKSLEPVILNEFAHCAEELKRFKGEPLDPHLIINNTVSNIICHLVFGHRFNYGDKKFKKLMLLFDRALQIEASIWAQLYNS------FTLIMRCLPGPHKTLQHIWREVQDFIGEELKEHKKSWDPS--DARDYIDFYLTEIQKTK--GQEGSTFDEENLIMCVLDLFVAGSETTSTTLRWAFLYMAKYPEIQEKVQAEIHKVIGKSRPP--CMEDRAELPYTDAVIHEVQRIGNIVPLSLPHATNKDVQLGGFTIPKGVLIIPNLTSVLFDEKEWETPHAFNPGHFLNKDGKFVK--RGAFIPFSAGKRLCLGENLARMELFLFFTSFMQHFSFSMPA----GVEPVLDYRAGLTLAP 513          
BLAST of Cytochrome P450 2W1 vs. Planmine SMEST
Match: SMESG000059212.1 (SMESG000059212.1)

HSP 1 Score: 918.302 bits (2372), Expect = 0.000e+0
Identity = 481/484 (99.38%), Postives = 482/484 (99.59%), Query Frame = 2
Query:  305 YSFKDXXXXXXXXXXXXXXVVLFKNLFRIKSNENKFFMEMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKRRGVLSSDGQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNPGSIRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYIKNVQIITSSNLTFSNAVFPLTNVPLLKYCVPSVLRIKKAMDNNVNILTELWKESKENCETNELESSSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTVHRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIELTNESKLNFEEILNGENGLVFAPFCHNLKFSRISN 1756
            YSFKDPPGPIGIPFIGIFPVVLFK LFRIKSNENKFFMEMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKRRGVLSSDGQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNP SIRTSNLFHSMTLTIIFKIVFNI+TDFDDEKIKKYIKNVQIITSSNLTFSNAVFPLTNVPLLKYCVPSVLRIKKAMDNNVNILTELWKESKENCETNELESSSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVAATLAWCCLLLADRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTVHRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIELTNESKLNFEEILNGENGLVFAPFCHNLKFSRISN
Sbjct:   21 YSFKDPPGPIGIPFIGIFPVVLFKKLFRIKSNENKFFMEMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKRRGVLSSDGQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNPDSIRTSNLFHSMTLTIIFKIVFNIDTDFDDEKIKKYIKNVQIITSSNLTFSNAVFPLTNVPLLKYCVPSVLRIKKAMDNNVNILTELWKESKENCETNELESSSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVAATLAWCCLLLADRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTVHRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIELTNESKLNFEEILNGENGLVFAPFCHNLKFSRISN 504          
BLAST of Cytochrome P450 2W1 vs. Planmine SMEST
Match: SMESG000048645.1 (SMESG000048645.1)

HSP 1 Score: 848.195 bits (2190), Expect = 0.000e+0
Identity = 454/484 (93.80%), Postives = 460/484 (95.04%), Query Frame = 2
Query:  305 YSFKDXXXXXXXXXXXXXXVVLFKNLFRIKSNENKFFMEMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKRRGVLSSDGQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNPGSIRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYIKNVQIITSSNLTFSNAVFPLTNVPLLKYCVPSVLRIKKAMDNNVNILTELWKESKENCETNELESSSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTVHRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIELTNESKLNFEEILNGENGLVFAPFCHNLKFSRISN 1756
            YSFKDPPGPIGIPFIGIFPVVLFK LFRIKSNENKFFMEMHKIYGNIWSFRIINQRYVVLGAPELQT+AFKHSGMTLSGRPLTELYKYVSKRRGVLSSDGQIWVLYRKLTTKA  +   K         E++K+       NP SIRTSNLFHSMTLTIIFKIVFNI+TDFDDEKIKKYIKNVQIITSSNLTFSNAVFPLTNVPLLKYCVPSVLRIKKAMDNNVNILTELWKESKENCETNELESSSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVAATLAWCCLLLADRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTVHRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENK EKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIELTNESKLNFEEILNGENGLVFAPFCHNLKFSRISN
Sbjct:   21 YSFKDPPGPIGIPFIGIFPVVLFKKLFRIKSNENKFFMEMHKIYGNIWSFRIINQRYVVLGAPELQTKAFKHSGMTLSGRPLTELYKYVSKRRGVLSSDGQIWVLYRKLTTKAYMKYPIKQ--------EDLKI-------NPDSIRTSNLFHSMTLTIIFKIVFNIDTDFDDEKIKKYIKNVQIITSSNLTFSNAVFPLTNVPLLKYCVPSVLRIKKAMDNNVNILTELWKESKENCETNELESSSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVAATLAWCCLLLADRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTVHRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKGEKIKHLQENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIELTNESKLNFEEILNGENGLVFAPFCHNLKFSRISN 489          
BLAST of Cytochrome P450 2W1 vs. Planmine SMEST
Match: SMESG000023528.1 (SMESG000023528.1)

HSP 1 Score: 173.711 bits (439), Expect = 2.115e-47
Identity = 137/461 (29.72%), Postives = 234/461 (50.76%), Query Frame = 2
Query:  392 KSNENKFFMEMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLT-ELYKYVSKRRGVLSSDGQIWVLYRKLTTKALHEISHKTRGFED-VITENIKLLLNYIDRNPGSIRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYIKNVQII-TSSNLTFSNAVFPLTNVPLLKYCVPSVLRIKKAMDNNVNILTEL--WKESKENCETNELES-----SSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTVHRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHL---QENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIELTNESKLNFEEILNGENGLVFAPFCHNL 1735
            K +++K + EM + YG +WS ++ + R +V  + EL  E+    G   S RP    +  YVSK+ G++   G+ W  +RK T K +H++       ED V+ E+ KLL          +++  L+    + II +++ N + ++DD+K    IKN+Q+I    N+     +  + N  + +    SV   +  MDN    L EL  W ES+ +  + +        S I E YL   +  +   E     +    IRN  DI GAG DT    L WC L+L  +   Q ++R+EI      KS    +++      +  +F++E  RYF +I R VH   K + F G+ L+  D+++ D  T + + DIW + ++F   RF++    + +HL    ++   FG GKR+C+GE+LAR E+ + L+++I  ++I+LT  +  N   I++G  GL++AP  H +
Sbjct:   49 KYSQSKCYSEMKEKYGALWSRKLFHIREIVFASYELIYESLVIQGTQFSNRPKDLPIMDYVSKKGGIIFIGGKYWKAHRKDTLKIMHKLGMNNLTIEDKVVQESEKLLQEIFKSANKPVKSDKLYSKPVMNIICQLMLNRSFEYDDQKFINVIKNIQVIGQDGNVNLLFFMRSIINFWIFRETFKSV---RIYMDN----LEELEEWVESQLDATSEKFNPEFDNPSCILEHYLVLQKQQESNGESSDLYSKHQIIRNCFDIYGAGIDTTTHMLCWCTLMLGLKPDFQTRIRNEIKA---NKSNSPMNFNTTKSFHFFKAFLDECFRYFPVIQRAVHAVEKPIDFKGFHLVPRDLLMMDFKTLSKDPDIWKDPEEFDPFRFMD----ETRHLYNPNKHLIAFGIGKRSCMGENLARCELTIILLSIIQTFEIKLTQNTLENINLIISGTEGLIYAPLEHEI 495          
BLAST of Cytochrome P450 2W1 vs. Planmine SMEST
Match: SMESG000023530.1 (SMESG000023530.1)

HSP 1 Score: 171.785 bits (434), Expect = 1.197e-46
Identity = 135/461 (29.28%), Postives = 233/461 (50.54%), Query Frame = 2
Query:  392 KSNENKFFMEMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLT-ELYKYVSKRRGVLSSDGQIWVLYRKLTTKALHEISHKTRGFED-VITENIKLLLNYIDRNPGSIRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYIKNVQII-TSSNLTFSNAVFPLTNVPLLKYCVPSVLRIKKAMDNNVNILTEL--WKESKENCETNELES-----SSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTVHRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHLQE---NFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIELTNESKLNFEEILNGENGLVFAPFCHNL 1735
            K +++K + EM + YG +WS ++ + + +V  + EL  E+    G   S RP    +  YVSK+ G++   G+ W  +RK T K +H++       ED V+ E+ KLL          + +  L+    + II +++ N + ++DD+K    IKN+Q+I    N+ F   +  + N  + +    SV   +  MDN    L EL  W ES+ +  + +        S I E YL   +  +   E     +    IRN  DI  AG DT    L WC L+L  +   Q ++R+EI      KS    +++      +  +F++E  RYF +IPR  H   K + F G+ L+  D+++ D    + + DIW + ++F   RF++    + +HL +   +   FG GKR+C+GE+LAR E+ + L+++I +++I+LT  +  N   I++G  GL++AP  H +
Sbjct:   49 KYSQSKCYSEMKEKYGALWSRKLFHIKEIVFASYELIYESLVIHGTQFSNRPKDLPILDYVSKKGGIIFIGGKYWKAHRKDTLKIMHKLGMNNLTIEDKVVQESEKLLQEIFKSANKPVESDKLYSKPVMNIICQLMLNRSFEYDDQKFINVIKNIQVIGQDGNVHFLFYMRSIINFWIFRETFKSV---RIFMDN----LEELEEWVESQLDATSEKFNPEFDNPSCILEHYLVLQKQQESNGESSDLYSKHQIIRNCFDIYSAGIDTTTHMLCWCTLMLGLKPDFQTRIRNEIKA---NKSNSPMNFNTTKSFHFFKAFLDECFRYFPVIPRIAHAVEKPIDFKGFHLVPRDLLMMDFKAMSKDPDIWKDPEEFDPFRFMD----ETRHLHKPNKHLIAFGIGKRSCMGENLARCELTIILLSIIQNFEIKLTQNTLENINLIISGTEGLIYAPLEHEI 495          
BLAST of Cytochrome P450 2W1 vs. Planmine SMEST
Match: SMESG000063883.1 (SMESG000063883.1)

HSP 1 Score: 170.244 bits (430), Expect = 5.230e-46
Identity = 131/460 (28.48%), Postives = 227/460 (49.35%), Query Frame = 2
Query:  383 FRIKSNENKFFMEMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGRPLTELYKYVSKRRGVLSSDGQIWVLYRKLTTKALHEISHKTRGFEDVITENIKLLLNYIDRNPG-SIRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYIKNVQIITSSNLTFSNAVFPLTNVPLL-KYCVPSVLRIKKAMDNNVNILTELWKESKENCETNELESSSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNFSDIVGAGSDTVXXXXXXXXXXXXDRVKIQNKLRSEINEFVEVKSVIFFSYSDKSQLPYLCSFIEEVHRYFTIIPRTVHRPMKNLIFHGYKLLENDIILGDSYTSNHNADIWPNADKFIFDRFVENKEEKIKHL-QENFYPFGTGKRNCIGESLARKEVLLTLVALICHYKIELTNESKLNFEEILNGENGLVFAPFCHNLKFSRIS 1753
            F    +E ++F +M + YG+IWS   + QR + L + ++  EAF  +GM  SG     L +    +RG+L  DG IW   R L  KAL  +   T   E +  E    L+  I +  G  I     F      II  + FN   + +D K +KY+  ++   +S++     ++P   +  L ++  P V     A+ NN  ++ +    S+        +   + ++  K     +   ++  ++   N I+  +D+  AG++T    L +CCLLL    ++Q+ LR+E+   VE  + I  + + K++ P L SFI EVHR+  ++P+  HR MK  IF G++   +D++  D  +   + + + N  KF   RF++  E + K++  ++   FG G+R CIGESLA  E+   L  +I  ++I L+NE+  +F +I  GE G++     H L F  +S
Sbjct:   50 FMTNVSECEYFKQMRQKYGSIWSIETVGQRIITLASFDIVHEAFVENGMLFSGCAQNSLVELYGGKRGILFVDGAIWKQNRHLAIKALTTMGMGTSALEKLNCEQADCLIKEIKQKSGIQIDPRKEFVKAIANIINIVNFNEPNNENDPKFEKYMLCLEKFANSHIKHIIFIWPSFFLSKLGRFLFPKVEEYVNAIYNNRRLVADKCM-SRLKVFNQSSDLKCVFDYIWKNEDFIEDLNDQSFNVKIFNVIQIMTDLQNAGTETTYNLLRFCCLLLGRYPEVQDDLRNELQNLVEDSTQI--TLNLKNKCPKLLSFIGEVHRFCNLVPKVGHRVMKKFIFRGFEFDTSDMVFADFNSIMFDENHFDNPQKFDPYRFLD--ETRTKYIPSQHLIGFGIGRRTCIGESLANMEIFFLLSRIIFEFQISLSNETVEHFAKIFEGEIGIMRTSLYHELVFHSVS 504          
The following BLAST results are available for this feature:
BLAST of Cytochrome P450 2W1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CYP2U15.229e-3025.65cytochrome P450 family 2 subfamily U member 1 [Sou... [more]
CYP2J22.418e-2725.78cytochrome P450 family 2 subfamily J member 2 [Sou... [more]
CYP2E11.124e-2524.49cytochrome P450 family 2 subfamily E member 1 [Sou... [more]
CYP2E11.124e-2524.49cytochrome P450 family 2 subfamily E member 1 [Sou... [more]
CYP2W12.770e-2523.78cytochrome P450 family 2 subfamily W member 1 [Sou... [more]
back to top
BLAST of Cytochrome P450 2W1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp-33C21.528e-2522.46CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
cyp-33D12.938e-2524.09CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
cyp-33D31.355e-2324.82CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
cyp-33C14.693e-2323.06CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
cyp-33C33.231e-2222.59CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of Cytochrome P450 2W1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cyp18a11.228e-2021.70gene:FBgn0010383 transcript:FBtr0074610[more]
Cyp18a11.228e-2021.70gene:FBgn0010383 transcript:FBtr0074609[more]
Cyp305a16.134e-1822.40gene:FBgn0036910 transcript:FBtr0074925[more]
Cyp303a11.605e-1423.72gene:FBgn0001992 transcript:FBtr0343812[more]
Cyp303a11.605e-1423.72gene:FBgn0001992 transcript:FBtr0080828[more]
back to top
BLAST of Cytochrome P450 2W1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp2x78.850e-3026.03cytochrome P450, family 2, subfamily X, polypeptid... [more]
cyp2x71.205e-2926.03cytochrome P450, family 2, subfamily X, polypeptid... [more]
cyp2x98.032e-2926.02cytochrome P450, family 2, subfamily X, polypeptid... [more]
cyp2x98.032e-2926.02cytochrome P450, family 2, subfamily X, polypeptid... [more]
cyp1a1.740e-2725.95cytochrome P450, family 1, subfamily A [Source:ZFI... [more]
back to top
BLAST of Cytochrome P450 2W1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a361.448e-2726.00Xenopus tropicalis uncharacterized LOC100124950 (L... [more]
cyp1a15.369e-2724.58cytochrome P450 family 1 subfamily A member 1 [Sou... [more]
cyp2f11.274e-2624.17cytochrome P450 2K1 [Source:NCBI gene;Acc:10049047... [more]
cyp2f12.432e-2623.93cytochrome P450 2K1 [Source:NCBI gene;Acc:10049047... [more]
gins44.958e-2625.35GINS complex subunit 4 (Sld5 homolog) [Source:Xenb... [more]
back to top
BLAST of Cytochrome P450 2W1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cyp2c293.438e-2925.68cytochrome P450, family 2, subfamily c, polypeptid... [more]
Cyp2c295.473e-2925.81cytochrome P450, family 2, subfamily c, polypeptid... [more]
Cyp2b131.931e-2825.47cytochrome P450, family 2, subfamily b, polypeptid... [more]
Cyp2u16.970e-2824.03cytochrome P450, family 2, subfamily u, polypeptid... [more]
Cyp2u16.970e-2824.03cytochrome P450, family 2, subfamily u, polypeptid... [more]
back to top
BLAST of Cytochrome P450 2W1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P00182|CP2C3_RABIT1.110e-3024.95Cytochrome P450 2C3 OS=Oryctolagus cuniculus OX=99... [more]
sp|Q7Z449|CP2U1_HUMAN2.511e-2925.65Cytochrome P450 2U1 OS=Homo sapiens OX=9606 GN=CYP... [more]
sp|Q0IIF9|CP2U1_BOVIN2.217e-2824.84Cytochrome P450 2U1 OS=Bos taurus OX=9913 GN=CYP2U... [more]
sp|Q64458|CP2CT_MOUSE2.405e-2825.68Cytochrome P450 2C29 OS=Mus musculus OX=10090 GN=C... [more]
sp|Q4V8D1|CP2U1_RAT3.447e-2824.62Cytochrome P450 2U1 OS=Rattus norvegicus OX=10116 ... [more]
back to top
BLAST of Cytochrome P450 2W1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8HTI61.825e-3925.55Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8I1X12.054e-3925.55Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FGF71.022e-3726.00Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8I2391.298e-3726.00Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267F0882.071e-3726.00Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Cytochrome P450 2W1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000048689.16.218e-3026.42cytochrome P450 2J6-like [Source:NCBI gene;Acc:103... [more]
cyp2u18.261e-3024.22cytochrome P450 2U1 [Source:NCBI gene;Acc:10303297... [more]
ENSAMXT00000034412.12.465e-2925.97cytochrome P450 2B4-like [Source:NCBI gene;Acc:111... [more]
ENSAMXT00000057567.13.031e-2926.21cytochrome P450 2B4-like [Source:NCBI gene;Acc:111... [more]
ENSAMXT00000034712.11.622e-2826.20cytochrome P450 2J6-like [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Cytochrome P450 2W1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000011205.15.350e-1921.93pep scaffold:Pmarinus_7.0:GL477378:108537:110066:1... [more]
ENSPMAT00000011254.11.312e-1822.27pep scaffold:Pmarinus_7.0:GL479221:5463:6953:-1 ge... [more]
cyp1d14.332e-1628.65cytochrome P450, family 1, subfamily D, polypeptid... [more]
ENSPMAT00000011204.11.889e-1521.75pep scaffold:Pmarinus_7.0:GL477378:78074:79555:1 g... [more]
ENSPMAT00000008590.14.122e-1529.73pep scaffold:Pmarinus_7.0:GL483327:8497:10357:1 ge... [more]
back to top
BLAST of Cytochrome P450 2W1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cytochrome P450 2W1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO403004.340e-2423.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412505.604e-2424.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487745.806e-2422.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO325629.397e-2423.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412841.835e-2323.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cytochrome P450 2W1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000024770.26.762e-3427.06cytochrome P450 2J6 [Source:NCBI gene;Acc:10116941... [more]
ENSORLT00000017336.21.357e-3027.02pep primary_assembly:ASM223467v1:6:26186654:261960... [more]
ENSORLT00000017318.21.593e-2725.23pep primary_assembly:ASM223467v1:6:26173766:261868... [more]
ENSORLT00000019638.21.820e-2624.89cytochrome P450 2K1 [Source:NCBI gene;Acc:10115799... [more]
ENSORLT00000020799.24.585e-2625.28cytochrome P450 2J6 [Source:NCBI gene;Acc:10115541... [more]
back to top
BLAST of Cytochrome P450 2W1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000059212.10.000e+099.38SMESG000059212.1[more]
SMESG000048645.10.000e+093.80SMESG000048645.1[more]
SMESG000023528.12.115e-4729.72SMESG000023528.1[more]
SMESG000023530.11.197e-4629.28SMESG000023530.1[more]
SMESG000063883.15.230e-4628.48SMESG000063883.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016752 ID=SMED30016752|Name=Cytochrome P450 2W1|organism=Schmidtea mediterranea sexual|type=transcript|length=1782bp
GTGATTTTACTTGAAAAGAAATTTTTCCGCTAGCAAATAATGATGCCTTT
GATTGAAGTTGTTTATCTAAACAATACGACTTAGTAAATACTGTGTTTAA
ACAAAAATTTTATTTCATAGCGATTATACATTCATAGTTTAAATATTACA
AAGATAACCAATCTCAAATGTCAAGTCAATCTGATAAAAATGTCGAGAAA
ATATAATTTATTCAAACAAATTAAATTCAAAAATCTTTGGTAAAATGATT
TACATTATTCTTATACTATTGCTTGTGATTTGTTTACTAATAAACAAACT
AATATATTCTTTTAAAGATCCTCCCGGACCAATCGGAATTCCTTTCATCG
GAATATTTCCTGTTGTACTTTTTAAAAATTTGTTTAGAATTAAATCAAAT
GAGAATAAATTTTTCATGGAAATGCATAAAATCTATGGAAATATTTGGTC
GTTTAGAATTATCAATCAACGCTACGTGGTCCTCGGTGCTCCGGAGTTAC
AGACAGAAGCATTTAAACACTCGGGAATGACACTTTCAGGAAGGCCATTG
ACTGAATTATATAAGTATGTTTCAAAACGCCGAGGAGTTCTTTCTTCAGA
TGGGCAGATATGGGTTTTGTATAGAAAGTTAACAACAAAGGCCCTACATG
AAATATCCCATAAAACAAGAGGATTTGAAGATGTAATTACTGAAAATATA
AAATTACTATTAAATTATATAGATAGAAATCCAGGCAGTATAAGAACTAG
TAACTTGTTCCATTCCATGACCCTCACAATAATTTTCAAAATTGTTTTTA
ATATAAATACCGATTTTGATGATGAAAAAATCAAAAAATATATAAAGAAT
GTTCAAATCATAACGAGTTCTAATCTCACCTTTAGTAATGCAGTTTTTCC
TTTGACTAACGTACCACTACTAAAGTATTGCGTTCCAAGTGTATTGCGAA
TAAAAAAGGCTATGGATAATAACGTAAATATTCTTACTGAATTATGGAAG
GAATCCAAAGAAAATTGTGAAACAAATGAGCTCGAGTCCAGCTCAATTGG
GGAATTCTATCTTAAGCAATTGCAACTGACTAAAGTTTACGAAGAGGAAC
ATCAACATTTGAATGATATGAATTTCATCAGGAACTTTTCAGACATTGTC
GGAGCAGGAAGTGACACAGTGGCGGCAACTCTTGCTTGGTGCTGCTTATT
GTTAGCTGATAGGGTCAAAATTCAAAACAAATTACGATCTGAAATAAATG
AATTTGTAGAAGTAAAATCAGTAATATTTTTTTCATACTCTGATAAAAGT
CAATTACCTTATCTGTGCTCTTTTATTGAAGAAGTTCATAGATATTTCAC
TATAATCCCTCGAACTGTACATCGTCCTATGAAAAATTTGATTTTTCATG
GATATAAATTATTAGAAAATGACATTATTCTTGGAGACAGCTATACAAGC
AATCATAATGCAGACATTTGGCCAAATGCGGATAAATTTATTTTTGACAG
ATTTGTCGAAAATAAAGAGGAAAAAATTAAACATTTACAAGAGAATTTCT
ATCCATTTGGAACAGGTAAAAGAAATTGCATCGGTGAAAGCTTGGCAAGA
AAAGAAGTTTTGTTGACATTAGTAGCATTAATTTGTCATTACAAAATTGA
GTTGACTAATGAATCAAAATTGAATTTCGAAGAAATTCTCAATGGAGAAA
ATGGACTTGTCTTTGCCCCCTTTTGTCATAATTTGAAATTTTCTAGAATT
TCAAATTAATTTATTATCTTTGAAAATAAAAT
back to top

protein sequence of SMED30016752-orf-1

>SMED30016752-orf-1 ID=SMED30016752-orf-1|Name=SMED30016752-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=505bp
MIYIILILLLVICLLINKLIYSFKDPPGPIGIPFIGIFPVVLFKNLFRIK
SNENKFFMEMHKIYGNIWSFRIINQRYVVLGAPELQTEAFKHSGMTLSGR
PLTELYKYVSKRRGVLSSDGQIWVLYRKLTTKALHEISHKTRGFEDVITE
NIKLLLNYIDRNPGSIRTSNLFHSMTLTIIFKIVFNINTDFDDEKIKKYI
KNVQIITSSNLTFSNAVFPLTNVPLLKYCVPSVLRIKKAMDNNVNILTEL
WKESKENCETNELESSSIGEFYLKQLQLTKVYEEEHQHLNDMNFIRNFSD
IVGAGSDTVAATLAWCCLLLADRVKIQNKLRSEINEFVEVKSVIFFSYSD
KSQLPYLCSFIEEVHRYFTIIPRTVHRPMKNLIFHGYKLLENDIILGDSY
TSNHNADIWPNADKFIFDRFVENKEEKIKHLQENFYPFGTGKRNCIGESL
ARKEVLLTLVALICHYKIELTNESKLNFEEILNGENGLVFAPFCHNLKFS
RISN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000420parapharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR036396Cyt_P450_sf
IPR001128Cyt_P450
IPR002401Cyt_P450_E_grp-I
IPR017972Cyt_P450_CS
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
Vocabulary: molecular function
TermDefinition
GO:0016705oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0020037heme binding
GO:0005506iron ion binding
GO:0004497monooxygenase activity
GO:0016491oxidoreductase activity
GO:0016712oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen
GO:0046872metal ion binding
GO:0070330aromatase activity
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0043231intracellular membrane-bounded organelle
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002401Cytochrome P450, E-class, group IPRINTSPR00463EP450Icoord: 175..193
score: 22.79
coord: 293..310
score: 29.43
coord: 358..376
score: 26.88
coord: 445..468
score: 36.6
coord: 61..80
score: 28.04
coord: 398..422
score: 20.91
coord: 85..106
score: 22.84
coord: 435..445
score: 57.44
coord: 313..339
score: 26.02
IPR001128Cytochrome P450PRINTSPR00385P450coord: 445..456
score: 46.82
coord: 304..321
score: 39.27
coord: 359..370
score: 27.03
coord: 436..445
score: 58.56
IPR001128Cytochrome P450PFAMPF00067p450coord: 26..477
e-value: 6.5E-75
score: 252.6
IPR036396Cytochrome P450 superfamilyGENE3DG3DSA:1.10.630.10coord: 21..502
e-value: 4.0E-88
score: 298.4
IPR036396Cytochrome P450 superfamilySUPERFAMILYSSF48264Cytochrome P450coord: 21..481
NoneNo IPR availablePANTHERPTHR24300:SF315CYTOCHROME P450 18A1coord: 5..497
NoneNo IPR availablePANTHERPTHR24300FAMILY NOT NAMEDcoord: 5..497
NoneNo IPR availableSIGNALP_EUKSignalP-TMSignalP-TMcoord: 1..22
score: 0.539
NoneNo IPR availableTMHMMTMhelixcoord: 2..21
IPR017972Cytochrome P450, conserved sitePROSITEPS00086CYTOCHROME_P450coord: 438..447