SMED30016746

Overview
NameSMED30016746
Smed IDSMED30016746
Uniprot Best hitUncharacterized protein C20orf85 OS=Homo sapiens OX=9606 GN=C20orf85 PE=1 SV=1 (E=2.63842e-20)
Length (bp)506
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30016746 (SMED30016746) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30016746 (SMED30016746) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30016746 (SMED30016746) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30016746 (SMED30016746) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016746

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30016746SMESG000060159.1 SmedASXL_004871SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30016746SMESG000060159.1 dd_Smed_v4_2729_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30016746SMESG000060159.1 dd_Smed_v4_2729_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30016746SMESG000060159.1 dd_Smed_v4_2729_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30016746SMESG000060159.1 dd_Smed_v4_2729_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30016746SMESG000060159.1 dd_Smed_v4_2729_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30016746SMESG000060159.1 dd_Smed_v6_2729_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30016746SMESG000060159.1 dd_Smed_v4_2729_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30016746SMESG000060159.1 dd_Smed_v4_2729_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30016746 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.017026:8254..8842 +2411
Homology
BLAST of SMED30016746 vs. Ensembl Human
Match: C20orf85 (chromosome 20 open reading frame 85 [Source:HGNC Symbol;Acc:HGNC:16216])

HSP 1 Score: 84.7297 bits (208), Expect = 5.494e-21
Identity = 46/125 (36.80%), Postives = 65/125 (52.00%), Query Frame = 1
Query:   64 NYTAQDQIWRDHCTQEMKKAGIWEHNWSFLKQSYRDIIKDDMDRLVDKDRPKAELPLHMHVQPATPKSKYVSVKPSITPFPKTTSGEVGWRSAHRDLQ--LETIGKSKYAKGSILKQLNWPAEAV 432
            N   QD+IW+     E +    W  NW FL   + ++IK + D  +   +PK ELP    ++P TP  KY+ V PS  P P+TT G +GWRSA   L   LE     +  KG+  ++L WP + V
Sbjct:   15 NLVGQDEIWKYRLKAESEARQNWPQNWGFLTTPFEELIKCEED--LPTPKPKIELPERFRIRPVTPVEKYIKVFPS-PPVPQTTQGFIGWRSAVPGLNKCLELDDAIRSCKGAFARELCWPKQGV 136          
BLAST of SMED30016746 vs. Ensembl Xenopus
Match: ENSXETT00000008768.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:10:375685:376466:1 gene:ENSXETG00000003274.1 transcript:ENSXETT00000008768.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.2326 bits (147), Expect = 1.791e-12
Identity = 34/107 (31.78%), Postives = 49/107 (45.79%), Query Frame = 1
Query:  112 MKKAGIWEHNWSFLKQSYRDIIKDDMDRLVDKDRPKAELPLHMHVQPATPKSKYVSVKPSITPFPKTTSGEVGWRSAHRDLQLETIGKSKYAKGSILKQLNWPAEAV 432
            M  +  W  NW FL     ++     + L   + P   LP+ +   P               P P+TT G VGWRS+  +LQL+  GKS Y +G   K++ WP EA+
Sbjct:    1 MATSKRWPDNWGFLTTPPAEVKGPIANTLALPNCPFHPLPIKVAPSP---------------PVPRTTQGFVGWRSSVPELQLDRYGKSSYPQGDFCKEMKWPTEAL 92          
BLAST of SMED30016746 vs. Ensembl Mouse
Match: 1700021F07Rik (RIKEN cDNA 1700021F07 gene [Source:MGI Symbol;Acc:MGI:1919471])

HSP 1 Score: 78.1814 bits (191), Expect = 1.244e-18
Identity = 43/124 (34.68%), Postives = 66/124 (53.23%), Query Frame = 1
Query:   64 NYTAQDQIWRDHCTQEMKKAGIWEHNWSFLKQSYRDIIKDDMDRLVDKDRPKAELPLHMHVQPATPKSKYVSVKPSITPFPKTTSGEVGWRSAHRDLQ-LETIGKSKYAKGSILKQLNWPAEAV 432
            N  AQD+IW+     E +    W   W +L  S +++++ + +    K  PK ELP H +V+P +P  K++ + PS  P PKTT G +GWRS    L  LE   +    KG+  ++L WP + V
Sbjct:   15 NLVAQDEIWKYRLRAESEARQNWPAKWGYLTTSMKELLEGEEEPQTPK--PKPELPSHFYVRPVSPMDKHIKILPS-PPVPKTTQGFIGWRSGKPALYCLEKYSEVCSCKGAYARELCWPEQGV 135          
BLAST of SMED30016746 vs. UniProt
Match: sp|Q9H1P6|CT085_HUMAN (Uncharacterized protein C20orf85 OS=Homo sapiens OX=9606 GN=C20orf85 PE=1 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 2.638e-20
Identity = 46/125 (36.80%), Postives = 65/125 (52.00%), Query Frame = 1
Query:   64 NYTAQDQIWRDHCTQEMKKAGIWEHNWSFLKQSYRDIIKDDMDRLVDKDRPKAELPLHMHVQPATPKSKYVSVKPSITPFPKTTSGEVGWRSAHRDLQ--LETIGKSKYAKGSILKQLNWPAEAV 432
            N   QD+IW+     E +    W  NW FL   + ++IK + D  +   +PK ELP    ++P TP  KY+ V PS  P P+TT G +GWRSA   L   LE     +  KG+  ++L WP + V
Sbjct:   15 NLVGQDEIWKYRLKAESEARQNWPQNWGFLTTPFEELIKCEED--LPTPKPKIELPERFRIRPVTPVEKYIKVFPS-PPVPQTTQGFIGWRSAVPGLNKCLELDDAIRSCKGAFARELCWPKQGV 136          
BLAST of SMED30016746 vs. UniProt
Match: sp|Q9DA42|CT085_MOUSE (Uncharacterized protein C20orf85 homolog OS=Mus musculus OX=10090 PE=2 SV=2)

HSP 1 Score: 78.1814 bits (191), Expect = 8.702e-18
Identity = 43/124 (34.68%), Postives = 66/124 (53.23%), Query Frame = 1
Query:   64 NYTAQDQIWRDHCTQEMKKAGIWEHNWSFLKQSYRDIIKDDMDRLVDKDRPKAELPLHMHVQPATPKSKYVSVKPSITPFPKTTSGEVGWRSAHRDLQ-LETIGKSKYAKGSILKQLNWPAEAV 432
            N  AQD+IW+     E +    W   W +L  S +++++ + +    K  PK ELP H +V+P +P  K++ + PS  P PKTT G +GWRS    L  LE   +    KG+  ++L WP + V
Sbjct:   15 NLVAQDEIWKYRLRAESEARQNWPAKWGYLTTSMKELLEGEEEPQTPK--PKPELPSHFYVRPVSPMDKHIKILPS-PPVPKTTQGFIGWRSGKPALYCLEKYSEVCSCKGAYARELCWPEQGV 135          
BLAST of SMED30016746 vs. TrEMBL
Match: gnl|BL_ORD_ID|15774368 (tr|A0A1I8H2L6|A0A1I8H2L6_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032137g2 PE=4 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 1.237e-41
Identity = 67/136 (49.26%), Postives = 86/136 (63.24%), Query Frame = 1
Query:   25 MAAEKKKVEEVGYNYTAQDQIWRDHCTQEMKKAGIWEHNWSFLKQSYRDIIKDDMDRLVDKDRPKAELPLHMHVQPATPKSKYVSVKPSITPFPKTTSGEVGWRSAHRDLQLETIGKSKYAKGSILKQLNWPAEAV 432
            MA  ++  E  G N  A DQIW+DHCT+E   A  W  +W F+ QSY ++IKD++  L D  RPKAELP HM V P TP   Y+ V PS  P P+TTS E+GWRS  R L L+  G+    +GS++ QL WPAEA+
Sbjct:    1 MANRQEGREVAGCNQIAHDQIWKDHCTKEASSAKHWHKDWGFMAQSYEEVIKDELPTLRDSSRPKAELPAHMQVPPVTPLRNYLRVDPSPKPPPRTTSQEIGWRSGQRSLALDKYGRDGRPRGSLIGQLKWPAEAI 136          
BLAST of SMED30016746 vs. TrEMBL
Match: gnl|BL_ORD_ID|18294879 (tr|A0A267GHQ5|A0A267GHQ5_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032137g3 PE=4 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 2.154e-41
Identity = 67/136 (49.26%), Postives = 86/136 (63.24%), Query Frame = 1
Query:   25 MAAEKKKVEEVGYNYTAQDQIWRDHCTQEMKKAGIWEHNWSFLKQSYRDIIKDDMDRLVDKDRPKAELPLHMHVQPATPKSKYVSVKPSITPFPKTTSGEVGWRSAHRDLQLETIGKSKYAKGSILKQLNWPAEAV 432
            MA  ++  E  G N  A DQIW+DHCT+E   A  W  +W F+ QSY ++IKD++  L D  RPKAELP HM V P TP   Y+ V PS  P P+TTS E+GWRS  R L L+  G+    +GS++ QL WPAEA+
Sbjct:   26 MANRQEGREVAGCNQIAHDQIWKDHCTKEASSAKHWHKDWGFMAQSYEEVIKDELPTLRDSSRPKAELPAHMQVPPVTPLRNYLRVDPSPKPPPRTTSQEIGWRSGQRSLALDKYGRDGRPRGSLIGQLKWPAEAI 161          
BLAST of SMED30016746 vs. TrEMBL
Match: gnl|BL_ORD_ID|18237128 (tr|A0A267EUE4|A0A267EUE4_9PLAT Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032137g1 PE=4 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 2.577e-41
Identity = 67/136 (49.26%), Postives = 86/136 (63.24%), Query Frame = 1
Query:   25 MAAEKKKVEEVGYNYTAQDQIWRDHCTQEMKKAGIWEHNWSFLKQSYRDIIKDDMDRLVDKDRPKAELPLHMHVQPATPKSKYVSVKPSITPFPKTTSGEVGWRSAHRDLQLETIGKSKYAKGSILKQLNWPAEAV 432
            MA  ++  E  G N  A DQIW+DHCT+E   A  W  +W F+ QSY ++IKD++  L D  RPKAELP HM V P TP   Y+ V PS  P P+TTS E+GWRS  R L L+  G+    +GS++ QL WPAEA+
Sbjct:   24 MANRQEGREVAGCNQIAHDQIWKDHCTKEASSAKHWHKDWGFMAQSYEEVIKDELPTLRDSSRPKAELPAHMQVPPVTPLRNYLRVDPSPKPPPRTTSQEIGWRSGQRSLALDKYGRDGRPRGSLIGQLKWPAEAI 159          
BLAST of SMED30016746 vs. TrEMBL
Match: gnl|BL_ORD_ID|23859448 (tr|V3YX69|V3YX69_LOTGI Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_203280 PE=4 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 1.486e-33
Identity = 61/128 (47.66%), Postives = 80/128 (62.50%), Query Frame = 1
Query:   64 NYTAQDQIWRDHCTQEMKKAGIWEHNWSFLKQSYRDIIKDDM----DRLVDKDRPKAELPLHMHVQPATPKSKYVSVKPSITPFPKTTSGEVGWRSAHRDLQLETIGKSKYAKGSILKQLNWPAEAVG 435
            N+ AQDQIW+DH + E+  A  W   W FL + Y D++++D     +R+ +K   K +L   + V+P TP  +Y+ VKPS  PFPKTTS  VGWRSA R L LE  GK    KG ++KQLNWP EAV 
Sbjct:   17 NFVAQDQIWKDHVSGEIVAAKNWPETWDFLNKKYEDLVEEDFPQITERMKNKSSTKKDLTSLVQVRPVTPIEEYIHVKPSPRPFPKTTSQMVGWRSADRSLALEKYGKYSRPKGGLVKQLNWPNEAVS 144          
BLAST of SMED30016746 vs. TrEMBL
Match: gnl|BL_ORD_ID|22552363 (tr|A0A5J4NR33|A0A5J4NR33_9TREM Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0004454 PE=4 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 5.430e-32
Identity = 51/123 (41.46%), Postives = 77/123 (62.60%), Query Frame = 1
Query:   64 NYTAQDQIWRDHCTQEMKKAGIWEHNWSFLKQSYRDIIKDDMDRLVDKDRPKAELPLHMHVQPATPKSKYVSVKPSITPFPKTTSGEVGWRSAHRDLQLETIGKSKYAKGSILKQLNWPAEAV 432
            N  A+DQIW+DHC  E     +W  NWSFL ++  +++KD+ + L+D  R K E+P H+ V  A P S Y+ +KPS  P P+TTSG +GWRS   +  LE   + +  +G +L++ +WP EA+
Sbjct:   15 NIIAKDQIWKDHCQNEANATKLWYKNWSFLTKTQEELLKDEKENLIDPHREKPEIPAHLKVTEAVPISDYIKIKPSPVPIPQTTSGFIGWRSGKEEYLLEKYAQKRSPQGCLLRRFHWPVEAI 137          
BLAST of SMED30016746 vs. Ensembl Nematostella
Match: EDO34523 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP27])

HSP 1 Score: 82.4185 bits (202), Expect = 8.935e-21
Identity = 47/136 (34.56%), Postives = 67/136 (49.26%), Query Frame = 1
Query:   52 EVGYNYTAQDQIWRDHCTQEMKKAGIWEHNWSFLKQSYRDIIKDDMD-------RLVDKDRPKAELPLHMHVQPA-TPKSKYVSVKPSITPFPKTTSGEVGWRSAHRDLQLETIGKSKYAKGSILKQLNWPAEAVG 435
            + G N+  QDQIW+DH   E   A  W  NW FL + Y+ +  +D +         V + R   +LP      P  +  +  +SV  S   +P TT+ E+GWRS+ R   LE  G+    K S L Q+ WP EA+G
Sbjct:    7 KTGLNFVHQDQIWKDHIGHEHGAAKHWPENWGFLIEQYKQLANEDNNIENGEAAVRVKQRRENLKLP------PIDSSVASQLSVGRSKARYPSTTASEIGWRSSQRQCNLERYGRYTKQKSSFLGQMKWPPEAIG 136          
BLAST of SMED30016746 vs. Planmine SMEST
Match: SMESG000060159.1 (SMESG000060159.1)

HSP 1 Score: 286.96 bits (733), Expect = 4.002e-101
Identity = 137/137 (100.00%), Postives = 137/137 (100.00%), Query Frame = 1
Query:   25 MAAEKKKVEEVGYNYTAQDQIWRDHCTQEMKKAGIWEHNWSFLKQSYRDIIKDDMDRLVDKDRPKAELPLHMHVQPATPKSKYVSVKPSITPFPKTTSGEVGWRSAHRDLQLETIGKSKYAKGSILKQLNWPAEAVG 435
            MAAEKKKVEEVGYNYTAQDQIWRDHCTQEMKKAGIWEHNWSFLKQSYRDIIKDDMDRLVDKDRPKAELPLHMHVQPATPKSKYVSVKPSITPFPKTTSGEVGWRSAHRDLQLETIGKSKYAKGSILKQLNWPAEAVG
Sbjct:    1 MAAEKKKVEEVGYNYTAQDQIWRDHCTQEMKKAGIWEHNWSFLKQSYRDIIKDDMDRLVDKDRPKAELPLHMHVQPATPKSKYVSVKPSITPFPKTTSGEVGWRSAHRDLQLETIGKSKYAKGSILKQLNWPAEAVG 137          
BLAST of SMED30016746 vs. Planmine SMEST
Match: SMESG000053923.1 (SMESG000053923.1)

HSP 1 Score: 75.485 bits (184), Expect = 6.657e-18
Identity = 42/124 (33.87%), Postives = 67/124 (54.03%), Query Frame = 1
Query:   67 YTAQDQIWRDHCTQEMKKAGIWEHNWSFLKQSYRDII-KDDMDRLVDKDRPKAELPLHMHVQPATPK-SKYVSVKPSITPFPKTTSGEVGWRSAHRDLQLETIGKSKYAKGSILKQLNWPAEAV 432
            Y      + +   +E      +E  W F+K    DI+ K+++ +L+D  RP   +P H+ +   + K  K V  KPS  PFP+TT+ E+GWR+  R+L LE    S  ++ + L+ +NWP EAV
Sbjct:    5 YQLSPDAYAEQINKEKDAVNNFEQRWGFVKGKLTDILTKEEICKLIDPCRPPIVIPDHLKLPECSEKVPKGVVAKPSPKPFPQTTAAEIGWRAQDRELLLELT--SPPSRMTFLRSMNWPMEAV 126          
The following BLAST results are available for this feature:
BLAST of SMED30016746 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
C20orf855.494e-2136.80chromosome 20 open reading frame 85 [Source:HGNC S... [more]
back to top
BLAST of SMED30016746 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016746 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016746 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016746 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000008768.11.791e-1231.78pep primary_assembly:Xenopus_tropicalis_v9.1:10:37... [more]
back to top
BLAST of SMED30016746 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
1700021F07Rik1.244e-1834.68RIKEN cDNA 1700021F07 gene [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of SMED30016746 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q9H1P6|CT085_HUMAN2.638e-2036.80Uncharacterized protein C20orf85 OS=Homo sapiens O... [more]
sp|Q9DA42|CT085_MOUSE8.702e-1834.68Uncharacterized protein C20orf85 homolog OS=Mus mu... [more]
back to top
BLAST of SMED30016746 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|157743681.237e-4149.26tr|A0A1I8H2L6|A0A1I8H2L6_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|182948792.154e-4149.26tr|A0A267GHQ5|A0A267GHQ5_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|182371282.577e-4149.26tr|A0A267EUE4|A0A267EUE4_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|238594481.486e-3347.66tr|V3YX69|V3YX69_LOTGI Uncharacterized protein OS=... [more]
gnl|BL_ORD_ID|225523635.430e-3241.46tr|A0A5J4NR33|A0A5J4NR33_9TREM Uncharacterized pro... [more]
back to top
BLAST of SMED30016746 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016746 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016746 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016746 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO345238.935e-2134.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30016746 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016746 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000060159.14.002e-101100.00SMESG000060159.1[more]
SMESG000053923.16.657e-1833.87SMESG000053923.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016746 ID=SMED30016746|Name=SMED30016746|organism=Schmidtea mediterranea sexual|type=transcript|length=506bp
GTAACAACTAAGTTATTAATTTAAATGGCAGCAGAAAAGAAAAAAGTTGA
AGAAGTCGGTTATAATTACACAGCACAGGATCAAATATGGAGAGATCACT
GTACACAAGAAATGAAAAAAGCAGGAATCTGGGAGCATAATTGGAGTTTC
TTGAAGCAATCTTATCGAGATATTATTAAGGATGACATGGACCGGTTGGT
GGATAAAGACCGCCCGAAAGCAGAGCTGCCGCTTCACATGCATGTGCAGC
CCGCGACACCGAAAAGTAAATATGTTTCTGTTAAACCATCAATCACACCG
TTTCCAAAAACGACCAGCGGTGAAGTCGGTTGGCGATCTGCACACAGAGA
TTTGCAATTAGAAACGATTGGCAAGTCTAAATATGCCAAAGGTAGTATCC
TAAAACAATTGAATTGGCCAGCTGAAGCTGTTGGATAAATATAATGTTGG
AGATCATTTTGTTTGCCATTAATTAATAAATTCCTATTTTGCTTGAAAAA
AAAAGA
back to top

protein sequence of SMED30016746-orf-1

>SMED30016746-orf-1 ID=SMED30016746-orf-1|Name=SMED30016746-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=138bp
MAAEKKKVEEVGYNYTAQDQIWRDHCTQEMKKAGIWEHNWSFLKQSYRDI
IKDDMDRLVDKDRPKAELPLHMHVQPATPKSKYVSVKPSITPFPKTTSGE
VGWRSAHRDLQLETIGKSKYAKGSILKQLNWPAEAVG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR020339Uncharacterised_C20orf85
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020339Uncharacterised protein family C20orf85PFAMPF14945LLC1coord: 16..135
e-value: 2.8E-35
score: 121.5
NoneNo IPR availablePANTHERPTHR31909FAMILY NOT NAMEDcoord: 1..136
NoneNo IPR availablePANTHERPTHR31909:SF3CHROMOSOME 20 OPEN READING FRAME 85coord: 1..136
NoneNo IPR availablePRODOMPD297655coord: 14..136
e-value: 4.0E-17
score: 211.0