Protocadherin-1

Overview
NameProtocadherin-1
Smed IDSMED30016728
Length (bp)3487
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin-1 (SMED30016728) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin-1 (SMED30016728) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin-1 (SMED30016728) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin-1 (SMED30016728) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016728

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30016728SMESG000074162.1 SmedASXL_013202SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30016728SMESG000074162.1 SmedASXL_013203SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30016728SMESG000074162.1 dd_Smed_v4_14117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30016728SMESG000074162.1 dd_Smed_v4_14117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30016728SMESG000074162.1 dd_Smed_v4_14117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
cilated neuronSMED30016728SMESG000074162.1 dd_Smed_v4_14117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30016728SMESG000074162.1 dd_Smed_v4_14117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30016728SMESG000074162.1 dd_Smed_v6_14117_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin-1 vs. Ensembl Human
Match: PCDH1 (protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655])

HSP 1 Score: 296.204 bits (757), Expect = 2.283e-83
Identity = 241/795 (30.31%), Postives = 372/795 (46.79%), Query Frame = 3
Query:  339 DFGKPIYKFQFFNCEKSSVYFEINPLNG-VITIERRIDRDNLCHLVPTCCPKK--NNQCNLDLTIKSDD----DFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSI--SPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYA-KLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNN----AKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLT---VMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAK--IFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARL----------RIIIESINGDSI 2633
            D+G P      +  E  + Y  ++   G + T E  IDR+ L       C  +   + C L+  +   D        ++   IEV+DINDN+P ++   +     E + IG    + +A D D G NG++ Y +   PE  E     +          ++Q +L++   LDRE+ D Y+  +   DGG+P    S  + V V D NDN+P FE+  Y   ++EN      VIQ+KA D+D   N +IEY       PE   +L  ++ N+G I V+  +D E  +T+   V A D G   + +   V++ ++D+NDN+P I         +    A I+E+ A    VA+  V D+D  EN  VTC +    +  F L + +   +     Y + T    D E+    T  IV  D GNP  +++ S+ V V D+ND AP F++        E+ KPG  +  I A+D D G NA L YS+  + A   +F+I+   G++ ++T LDRE  ES      AAD G P    TA + V V D NDN P F+       V+EN  A  P+  V V D D+G N++ ++++  +          ++ IQ     +  S S                   DRE  + Y   ++A D G PP+S    + INVLD ND  P    PS ++  + + P+T  G T++Q+ A D D G N+EL YS    N    LF +   SG I+L++ I+  H    + L+V V D G P    TA +          R ++E++ G S+
Sbjct:   80 DYGFPDVG-HLYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRE-----CQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQE-----LFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQ--APEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVV--AGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVEQDNG--------DFVIQNGTGTILSSLS------------------FDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKL-LTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPYG-LFQIGSHSGAITLEKEIERRHH-GLHRLVVKVSDRGKPPRYGTALVHLYVNETLANRTLLETLLGHSL 830          
BLAST of Protocadherin-1 vs. Ensembl Human
Match: PCDH1 (protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655])

HSP 1 Score: 295.434 bits (755), Expect = 2.363e-82
Identity = 241/795 (30.31%), Postives = 372/795 (46.79%), Query Frame = 3
Query:  339 DFGKPIYKFQFFNCEKSSVYFEINPLNG-VITIERRIDRDNLCHLVPTCCPKK--NNQCNLDLTIKSDD----DFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSI--SPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYA-KLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNN----AKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLT---VMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAK--IFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARL----------RIIIESINGDSI 2633
            D+G P      +  E  + Y  ++   G + T E  IDR+ L       C  +   + C L+  +   D        ++   IEV+DINDN+P ++   +     E + IG    + +A D D G NG++ Y +   PE  E     +          ++Q +L++   LDRE+ D Y+  +   DGG+P    S  + V V D NDN+P FE+  Y   ++EN      VIQ+KA D+D   N +IEY       PE   +L  ++ N+G I V+  +D E  +T+   V A D G   + +   V++ ++D+NDN+P I         +    A I+E+ A    VA+  V D+D  EN  VTC +    +  F L + +   +     Y + T    D E+    T  IV  D GNP  +++ S+ V V D+ND AP F++        E+ KPG  +  I A+D D G NA L YS+  + A   +F+I+   G++ ++T LDRE  ES      AAD G P    TA + V V D NDN P F+       V+EN  A  P+  V V D D+G N++ ++++  +          ++ IQ     +  S S                   DRE  + Y   ++A D G PP+S    + INVLD ND  P    PS ++  + + P+T  G T++Q+ A D D G N+EL YS    N    LF +   SG I+L++ I+  H    + L+V V D G P    TA +          R ++E++ G S+
Sbjct:   80 DYGFPDVG-HLYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRE-----CQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQE-----LFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQ--APEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVV--AGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVEQDNG--------DFVIQNGTGTILSSLS------------------FDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKL-LTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPYG-LFQIGSHSGAITLEKEIERRHH-GLHRLVVKVSDRGKPPRYGTALVHLYVNETLANRTLLETLLGHSL 830          
BLAST of Protocadherin-1 vs. Ensembl Human
Match: PCDH10 (protocadherin 10 [Source:HGNC Symbol;Acc:HGNC:13404])

HSP 1 Score: 280.026 bits (715), Expect = 7.750e-79
Identity = 214/674 (31.75%), Postives = 318/674 (47.18%), Query Frame = 3
Query:  396 YFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYI-INTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSF-------------------NGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFG---KDAKIF---SINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLS-TANITVIVKDINDNFP----------------FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKL-IIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLD 2285
            Y ++N   GV+ +  +IDR+ +C   P+C         L L +  ++    +  + IEV DINDN P + + +L  + SE +  G    L  A D D GTN +  Y I+P       SY  ++  T    N+   +LVL+K LDRE+   + +++ A DGG                        G+  + + V D NDN P F++ VY +S+ EN    T VIQL A D D   NG++ Y  SS   P   +LF +   +G + V  ELDYE      + V+A D+G     + C V++ + D NDN+PEI F     T    ++E  APG +VA+FSV D+DS ENG+V C L  + +  F   R+       Y I T    DRE     T  +V  D G P  +TS S+ V V D+ND AP FS+  Y  +V E+  PG Y++ ++ATD+DEG NA L+YSI     +   +F   SIN  +G ++     D E ++   F   A D+G P+ L+  A + +++ D NDN P                 LP+S     L        L +V   DAD+G N+    ++V         R +E     LFR   ++           G+L   R     R+    YE+VIE  D G PP S+   + + ++D
Sbjct:   63 YLDLNLETGVLYVNEKIDREQICKQSPSCV--------LHLEVFLENPL-ELFQVEIEVLDINDNPPSFPEPDLTVEISESATPGTRFPLESAFDPDVGTNSLRDYEITPN------SYFSLDVQTQGDGNRF-AELVLEKPLDREQQAVHRYVLTAVDGGGGGGVGEGGGGGGGAGLPPQQQRTGTALLTIRVLDSNDNVPAFDQPVYTVSLPENSPPGTLVIQLNATDPDEGQNGEVVYSFSSHISPRARELFGLSPRTGRLEVSGELDYEESPVYQVYVQAKDLGPNAVPAHCKVLVRVLDANDNAPEISFS----TVKEAVSEGAAPGTVVALFSVTDRDSEENGQVQCEL--LGDVPF---RLKSSFKNYYTIVTEAPLDREAGDSYTLTVVARDRGEPALSTSKSIQVQVSDVNDNAPRFSQPVYDVYVTENNVPGAYIYAVSATDRDEGANAQLAYSILECQIQGMSVFTYVSINSENGYLYALRSFDYEQLKDFSFQVEARDAGSPQALAGNATVNILIVDQNDNAPAIVAPLPGRNGTPAREVLPRSAEPGYL--------LTRVAAVDADDGENARLTYSIV---------RGNE---MNLFRMDWRT-----------GELRTARRVPAKRDPQRPYELVIEVRDHGQPPLSSTATLVVQLVD 680          

HSP 2 Score: 149.058 bits (375), Expect = 8.641e-36
Identity = 164/616 (26.62%), Postives = 260/616 (42.21%), Query Frame = 3
Query:  900 KVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNS-------GYIHVRWELDYETYTTISLIVEANDMGNL-------------------RRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKV----TCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDA-KIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIY-LYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKL--FRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVL--DVNDCKPKFIFP-SGSNSTV--KVKPRTV-SGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVC-CYVLIVVVKDNGIPRLEDTARLRIIIESING 2624
            +V + V D NDN P F +    + ++E+    T      A D D   N   +Y+I+          FS++  +         + +   LD E       ++ A D G                     +R  T  + I + D NDN P   F+   +T    + EN  PG LV   +  D D  +NG+V    + H+ P A E F L     P T   ++S     D E+      ++   D G         V V V D ND AP  S  +    V+E   PGT +   + TD+D   N  +   + G    ++ S  K    +  E  LDRE+ +S   T  A D G P   ++ +I V V D+NDN P   + +Y +YV EN+     +  V+ TD DEG N++   +++            E  IQ +  F  V+ +  N     L            D E    +   +EA D G+P ++  G   +N+L  D ND  P  + P  G N T   +V PR+   G  + ++ A+D D+G+N+ L YS    N+ N LF M+  +G++   + +         Y L++ V+D+G P L  TA L  +++ ++G
Sbjct:  107 QVEIEVLDINDNPPSFPEPDLTVEISESATPGTRFPLESAFDPDVGTNSLRDYEITP------NSYFSLDVQTQGDGNRFAELVLEKPLDREQQAVHRYVLTAVDGGGGGGVGEGGGGGGGAGLPPQQQRTGTALLTIRVLDSNDNVPA--FDQPVYT--VSLPENSPPGTLVIQLNATDPDEGQNGEVVYSFSSHISPRARELFGLS----PRTGRLEVS--GELDYEESPVYQVYVQAKDLGPNAVPAHCKVLVRVLDANDNAPEISFSTVKEAVSEGAAPGTVVALFSVTDRDSEENGQVQCELLGDVPFRLKSSFKNYYTIVTEAPLDREAGDSYTLTVVARDRGEPALSTSKSIQVQVSDVNDNAPRFSQPVYDVYVTENNVPGAYIYAVSATDRDEGANAQLAYSIL------------ECQIQGMSVFTYVSINSENGYLYAL---------RSFDYEQLKDFSFQVEARDAGSP-QALAGNATVNILIVDQNDNAPAIVAPLPGRNGTPAREVLPRSAEPGYLLTRVAAVDADDGENARLTYSIVRGNEMN-LFRMDWRTGELRTARRVPAKRDPQRPYELVIEVRDHGQPPLSSTATL--VVQLVDG 681          
BLAST of Protocadherin-1 vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 281.952 bits (720), Expect = 1.274e-78
Identity = 225/723 (31.12%), Postives = 348/723 (48.13%), Query Frame = 3
Query:  423 VITIERRIDRDNLCHLVPTCCPKKNNQCNLDL-TIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEI--YFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKP-RTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPR 2576
            + T   RIDR+ LC         + N+C  +L  +   +DF  +I + I VKD NDN+P +    +     E + I     +  A D D G NG+ +Y +    + F L  I+ T       ++  +L++++ LDRE+ D Y   +   DGG P  + +  + V V+D NDN PVF++    + + EN    T VIQL A DAD   N +I Y   +   P   +LF++ + +G I V+  LD E      + V A+D  +    +  TV IN+ D+NDN P I   +  S       ++E +     +A+ +V DKD++ NGKV C +E      F L+ +       Y + T    D E   + +  IV  D G P    +  V V +ED ND  P F++      V+E+ + G YL TI+ATD+D G NA + Y + G +A  F +++  G +      DRE  E   FT  A D+G P   S A + V V D NDN P F       +V EN      +  + VTDAD G N    ++++++                          N  F L P   +I      DRE  + Y   ++ATD G PP+S+   + INV+DVND  P  I P  SN++ K+ P   + G+ +A++ A+D D G N+EL+Y+  S N    LF ++P +G I+L++    +  V  + L+V + D G P+
Sbjct:   85 IFTTSNRIDREKLCA---GASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLD-IVETP----EGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--ARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIE--REVPFHLKAV---YDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQL-GPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILND--------------------------NDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPP-SNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSGNNKG-LFRIDPVTGNITLEEKPAPT-DVGLHRLVVNISDLGYPK 762          

HSP 2 Score: 152.91 bits (385), Expect = 6.515e-37
Identity = 166/614 (27.04%), Postives = 260/614 (42.35%), Query Frame = 3
Query:  243 IDIYEELPRKTKVIDLGAQATKWFPTDVNKLQDFGKPIYKFQFFNCEKSSVYFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQ------FSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNA---KITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHF----SEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIF-GKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLV 2042
            + I E  P  T VI L A       TD + +    +  Y F       +   F +N   G+IT++R +DR+       T      +      T+             I V D+NDN P      +++        SE   +    +L    D D   NG     I  E+  F L  + +   ++ ++           LD E   ++ F + A D G PS N +  V V + DENDN P+F + V  +SV+EN +    +  + A D DS  N  I YQ+        A  F ++  +G +      D E        V A D G     S   VI+ + D NDNSP       +FT+N     ++EN      V V +V D D+ EN  VT  +    N+ F L+    P + + K +   SFDREQ+S  T  +   D G P ++++  V++ V D+ND +P      S  S+   V     PG+ +  + A D D G+NA L Y+I  G +  +F I+ + G + LE       V         +D GYPK L T  + ++   +ND       + Y+Y L   T + PL + N+ D+ +   +E  +T++
Sbjct:  259 VHIPENAPVGTSVIQLHA-------TDAD-IGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARATV------------TINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREV-PFHLKAVYDNQYLLETSS---------LLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGP-----NASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSP-------KFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILN-DNDNFVLD----PYSGVIKSNV--SFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKL-VPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKSLHT--LVLVFLYVNDT---AGNASYIYDLIRRTMETPLDR-NIGDSSQPYQNEDYLTIM 816          

HSP 3 Score: 127.872 bits (320), Expect = 3.698e-29
Identity = 141/585 (24.10%), Postives = 254/585 (43.42%), Query Frame = 3
Query:  963 IISVNENLQSNTPV------IQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYI--------------HVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEE-FSLERMNIPLTVMY-KISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDA-----KIFSINKLDGKVFLETDLDRESVESLHFTTRAAD-SGYPKQLSTANITVIVKDINDNFPFL-------PKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGL-DREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIII 2609
            I ++ E L  N P+      + +  I+A +  +  + Y++  ++K   A L  + S++G I                 +  + E +  + +++  ND   L +     + I ++D NDN+P     PS   N   I EN        + S  D D+  NG    H E +  +  F L+ +  P    + ++   ++ DREQK      I   D G P+++++  + V V D+ND  P F E     H+ E+   GT +  ++ATD D G NA + Y IFG        ++F++N   G + ++  LDRE       T  A+D S  P +   A +T+ V D+NDN P +       P +  +Y+ E    +  +  + V+D D  +N +             I+R+  + ++ ++                D + ++  S L D E T ++   I A+D G P  +   ++ + + D ND  P F  P    S  +   R +  TTI+   A DED GKN+++ Y    N      F ++ ++G ++  +      +   ++  V  +DNG P L+  A + + +
Sbjct:   27 IYTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRL--VSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRLIK-----IKIIVKDTNDNAPMF---PSPVIN-ISIPENTLINSRFPIPSATDPDTGFNG--VQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRY-IFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPAR---ATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGK---------VICFIEREVPFHLKAVY----------------DNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTIS---ATDEDSGKNADIVYQLGPNAS---FFDLDRKTGVLTASRVFDREEQER-FIFTVTARDNGTPPLQSQAAVIVTV 562          
BLAST of Protocadherin-1 vs. Ensembl Human
Match: PCDH10 (protocadherin 10 [Source:HGNC Symbol;Acc:HGNC:13404])

HSP 1 Score: 280.411 bits (716), Expect = 4.500e-78
Identity = 212/673 (31.50%), Postives = 316/673 (46.95%), Query Frame = 3
Query:  396 YFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSF-------------------NGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFG---KDAKIF---SINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLS-TANITVIVKDINDNFP----------------FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKL-IIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLD 2285
            Y ++N   GV+ +  +IDR+ +C   P+C         L L +  ++    +  + IEV DINDN P + + +L  + SE +  G    L  A D D GTN +  Y I+P  + F L      +   ++      LVL+K LDRE+   + +++ A DGG                        G+  + + V D NDN P F++ VY +S+ EN    T VIQL A D D   NG++ Y  SS   P   +LF +   +G + V  ELDYE      + V+A D+G     + C V++ + D NDN+PEI F     T    ++E  APG +VA+FSV D+DS ENG+V C L  + +  F   R+       Y I T    DRE     T  +V  D G P  +TS S+ V V D+ND AP FS+  Y  +V E+  PG Y++ ++ATD+DEG NA L+YSI     +   +F   SIN  +G ++     D E ++   F   A D+G P+ L+  A + +++ D NDN P                 LP+S     L        L +V   DAD+G N+    ++V         R +E     LFR   ++           G+L   R     R+    YE+VIE  D G PP S+   + + ++D
Sbjct:   63 YLDLNLETGVLYVNEKIDREQICKQSPSCV--------LHLEVFLENPL-ELFQVEIEVLDINDNPPSFPEPDLTVEISESATPGTRFPLESAFDPDVGTNSLRDYEITPN-SYFSLDVQTQGDGNRFAE-----LVLEKPLDREQQAVHRYVLTAVDGGGGGGVGEGGGGGGGAGLPPQQQRTGTALLTIRVLDSNDNVPAFDQPVYTVSLPENSPPGTLVIQLNATDPDEGQNGEVVYSFSSHISPRARELFGLSPRTGRLEVSGELDYEESPVYQVYVQAKDLGPNAVPAHCKVLVRVLDANDNAPEISFS----TVKEAVSEGAAPGTVVALFSVTDRDSEENGQVQCEL--LGDVPF---RLKSSFKNYYTIVTEAPLDREAGDSYTLTVVARDRGEPALSTSKSIQVQVSDVNDNAPRFSQPVYDVYVTENNVPGAYIYAVSATDRDEGANAQLAYSILECQIQGMSVFTYVSINSENGYLYALRSFDYEQLKDFSFQVEARDAGSPQALAGNATVNILIVDQNDNAPAIVAPLPGRNGTPAREVLPRSAEPGYL--------LTRVAAVDADDGENARLTYSIV---------RGNE---MNLFRMDWRT-----------GELRTARRVPAKRDPQRPYELVIEVRDHGQPPLSSTATLVVQLVD 680          

HSP 2 Score: 149.828 bits (377), Expect = 7.300e-36
Identity = 166/613 (27.08%), Postives = 258/613 (42.09%), Query Frame = 3
Query:  900 KVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSG----YIHVRWELDYETYTTISLIVEANDMGNL-------------------RRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKV----TCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDA-KIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIY-LYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKL--FRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVL--DVNDCKPKFIFP-SGSNSTV--KVKPRTV-SGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVC-CYVLIVVVKDNGIPRLEDTARLRIIIESING 2624
            +V + V D NDN P F +    + ++E+    T      A D D   N   +Y+I   T   Y  L       G     + +   LD E       ++ A D G                     +R  T  + I + D NDN P   F+   +T    + EN  PG LV   +  D D  +NG+V    + H+ P A E F L     P T   ++S     D E+      ++   D G         V V V D ND AP  S  +    V+E   PGT +   + TD+D   N  +   + G    ++ S  K    +  E  LDRE+ +S   T  A D G P   ++ +I V V D+NDN P   + +Y +YV EN+     +  V+ TD DEG N++   +++            E  IQ +  F  V+ +  N     L            D E    +   +EA D G+P ++  G   +N+L  D ND  P  + P  G N T   +V PR+   G  + ++ A+D D+G+N+ L YS    N+ N LF M+  +G++   + +         Y L++ V+D+G P L  TA L  +++ ++G
Sbjct:  107 QVEIEVLDINDNPPSFPEPDLTVEISESATPGTRFPLESAFDPDVGTNSLRDYEI---TPNSYFSLDVQTQGDGNRFAELVLEKPLDREQQAVHRYVLTAVDGGGGGGVGEGGGGGGGAGLPPQQQRTGTALLTIRVLDSNDNVPA--FDQPVYT--VSLPENSPPGTLVIQLNATDPDEGQNGEVVYSFSSHISPRARELFGLS----PRTGRLEVS--GELDYEESPVYQVYVQAKDLGPNAVPAHCKVLVRVLDANDNAPEISFSTVKEAVSEGAAPGTVVALFSVTDRDSEENGQVQCELLGDVPFRLKSSFKNYYTIVTEAPLDREAGDSYTLTVVARDRGEPALSTSKSIQVQVSDVNDNAPRFSQPVYDVYVTENNVPGAYIYAVSATDRDEGANAQLAYSIL------------ECQIQGMSVFTYVSINSENGYLYAL---------RSFDYEQLKDFSFQVEARDAGSP-QALAGNATVNILIVDQNDNAPAIVAPLPGRNGTPAREVLPRSAEPGYLLTRVAAVDADDGENARLTYSIVRGNEMN-LFRMDWRTGELRTARRVPAKRDPQRPYELVIEVRDHGQPPLSSTATL--VVQLVDG 681          
BLAST of Protocadherin-1 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 194.897 bits (494), Expect = 6.910e-50
Identity = 184/753 (24.44%), Postives = 330/753 (43.82%), Query Frame = 3
Query:  384 KSSVYFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTI--KSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKL--DGKVF-LETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSF--KSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESIN 2621
            +S   F ++ ++G I + + +DR+ L            ++  L +T   + D   S    +V+ V D+ DNSP + ++    +  E + IG +     A D D G NG   YS+             N   ++  N +   +     LDRE +      V A D G P    +  V + V D NDN+PVF    Y +++ EN+     +  +KA D D   NGK+ Y ++S +        +I+ ++G + +R  +D +  + I+ ++ A D       ST  + IN+ D+ND++P +       T    +   E  G++ A+    D+DS  NG +   +E   +E+F ++  +        I T K  DRE  ++ +  +   D G P   TS +++V ++DIND AP F +K Y   ++E++  G+ + T+ A D DE  +  ++Y I   D ++FSI  +   G +  +  +L R+    +     A D G  +     N  V + D+N    F      + + E+     P++ +   D D G N+                           R V    S+  F + P    I   S LDRE    + +++ A+D  +PP +T   I + + D+ND  P+F   + S+    +      GT+  Q+ AID D G N  ++Y     S++ +  LF ++  SG + +   + +  +    VL +  +D G P L   + + + +  +N
Sbjct:  208 RSQNLFTLDTMSGEIRLAKSMDREVL------------DKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEG----------NGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSG---IGGLTIDYSTGEVTLRERIDAKN-SPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAI----DEDSGPNGIIKYSME--GSEDFIIDEDS------GLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDE--DQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQD-HKVRVEISATDQGGLQGRCVVN--VFIDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNA---------------------------RIVYSIDSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQF---TSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKL-DREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVN 886          

HSP 2 Score: 194.126 bits (492), Expect = 1.208e-49
Identity = 181/610 (29.67%), Postives = 279/610 (45.74%), Query Frame = 3
Query:  822 DREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKIS--TLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIY-LYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLL--PDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVL--DVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESINGDS 2630
            DRE +DK+   V A++  +P+ + S  V+V V D  DNSP+FEK  Y   + E+    T V+ + A D DS  NG+IEY   SL +     L +I + SG I     LD ET + I L V A+D G  +R ST  V I + D+NDN+P   F    +  N  I EN     ++A     D+D   NGKV  H    ++           LT+ Y     TL+     + S +TA I   D   P  +++  +++ V DIND AP       +  + E+V  G  +  + A D+D G N ++ YS+ G +   F I++  G +     LDRE+         A D G P   ++  I V++KDINDN P   K  Y + + E       ++ +   D DE    + K+T               Y I++  R+V        FS+L   D   I+  SG  +    K  + I ATD+G      +G   +NV   DVN   P F   +    +VK+   +  G  +  + A D D G N+ + YS  S+      F ++P SG IS+   +    +   + +IV   D+  P L  + ++ +I++ IN +S
Sbjct:  229 DREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEY---SLGEGNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAP--VFASDSY--NVTILENITIPAVIATVKATDEDFGTNGKV--HYSMASSSGIG------GLTIDYSTGEVTLRERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED--FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDE----DQKIT---------------YRIEEADREV--------FSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGG----LQGRCVVNVFIDDVNS-APYF---NDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQ----FFRIDPSSGDISVSSDLDREDRA-TFSVIVTASDHASPPLNTSTQIEVILDDINDNS 781          

HSP 3 Score: 193.356 bits (490), Expect = 1.840e-49
Identity = 183/631 (29.00%), Postives = 290/631 (45.96%), Query Frame = 3
Query:  564 IEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDK----YEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLYVLENHTADVPL----VQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFR-DVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEY 2429
            I V D+NDN+P ++ +       E   I    +   A D DFGTNG  +YS++        S  I   T+ YS  E           RE+ID        ++ A DG  P+ + ++ + + V D ND++P    A  +I++ EN+     V ++ AID DS  NG I+Y +      E ++ F I+ +SG I     LD ET    SL V A DMG     ++ T+ + ++D+NDN+P   F+   +  N  I+E    G    + +++  D++E+ K+T  +E    E FS+  +     ++     LK     Q  KV   I   D+G  +      V+V ++D+N  AP+F++  +   + E    G  + T+ A D D G NA + YSI    ++ F I+   G + + +DLDRE   +      A+D   P   ++  I VI+ DINDN P    S Y   +   + D+P+    +QV+  DAD G N      L   +++         P  +LFR D T             G L +  S LDRE      + I A DRG P  S    I + + DVND  P F      +  + +   +  G+T+  I+A D DEG N+++ +
Sbjct:  363 ITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMAS-------SSGIGGLTIDYSTGEVTL--------RERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSM------EGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPT--FDKKEY--NVTISEEMPRGS--QIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELK----RQDHKVRVEISATDQGGLQGRCV--VNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI--DSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATI---SEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSS---------PSIQLFRLDRTS------------GTLRV-SSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTF---EQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISF 929          

HSP 4 Score: 181.03 bits (458), Expect = 1.413e-45
Identity = 175/664 (26.36%), Postives = 292/664 (43.98%), Query Frame = 3
Query:  540 FSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSY----SIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIY-LYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREV-TTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPK---FIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQ 2504
             S  + L I V DIND++P     + +    E   IG+      A+D D G NGI  YS+     E    +II+ ++ +    +         LDRE   +Y   V A D G PS N S  + V + D NDN+P F+K  Y ++++E +   + +I LKA+D D +   KI Y+I    + E   +  I      + V  EL  + +  + + + A D G L+    C V + I D+N ++P  YF    F+   KI E+   G  V     +D D  +N ++   ++  +++ F ++  +        IS     DRE ++  +  +   D  +P   TS  + V ++DIND +P F+  SY   ++ED+  GT    ++A D D G N ++ Y    S      ++F +++  G + + + LDRE    +     A D G P   + + IT+ + D+NDN P   +  Y LY+ EN      +  +   DADEG N++    +       L   +++     + R                   I+  +  D E    K+   ++A+   +   S+   + I+V DVND KP    F+        V++         I  I A D D+  N+ LEY      + NDL      +GKI ++Q
Sbjct:  459 LSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSM-----EGSEDFIIDEDSGLIKTTK--------LLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQ--KITYRIEEADR-EVFSILDIGDQGAILSVSGELKRQDHK-VRVEISATDQGGLQ--GRCVVNVFIDDVN-SAP--YFNDHPFS--VKIPEHSPIGYPVITLKAEDHDRGDNARIVYSID--SSQFFRIDPSS------GDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVR-------------------ILTRAEFDYEAKANKFFFELQAS---SGQLSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQM------ARQIGFIPAFDPDQ--NATLEYFL----EENDLIEAEKYTGKILVKQ 1056          

HSP 5 Score: 119.398 bits (298), Expect = 9.062e-27
Identity = 141/647 (21.79%), Postives = 273/647 (42.19%), Query Frame = 3
Query:  225 NHKHFTIDIYEELPRKTKVIDLGAQATKWFPTDVNKLQDFGKPIYKFQFFNCEKSSVYFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEE-FSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSG--------------YPKQLSTANITVIVKDINDNF--PFL---------------PKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIK 2069
            + K + + I EE+PR +++I L A         V+  +D  K  Y+ +  + E  S+  +I     ++++   + R             ++++  ++++           V+ + + D+N ++P+++ +    +  E S IG       A D+D G N               + Y I+++     +     + +   LDRE    +  IV A D  +P  N S ++ V + D NDNSP F  + Y  +++E++   T  +Q+ AIDAD   NG ++Y ++  +     +LF ++  SG + V  +LD E +  I L + A D G     +   + + + D+NDN+P   FE  + + +  I EN   G  V     +D D  +N  ++  +   A+ + F +E  +     + +I T   FD E  +K           + + +++  V + V D+ND  P   +   + +  ++V+    +  I A D D+  NA L Y  F ++  +    K  GK+ ++ +  R     + F T  +D                 P+ LS +    + +   D+F  P +               P  I++  ++ H  DV  + + +TD    +     + LV E+   L K
Sbjct:  582 DKKEYNVTISEEMPRGSQIITLKA---------VDNDED-QKITYRIEEADREVFSI-LDIGDQGAILSVSGELKR-------------QDHKVRVEISATDQGGLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNA-------------RIVYSIDSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPT--FE--QLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEE-DAEQNGVVRILTRAEFDYE--AKANKFFFELQASSGQLSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQIGFIPAFDPDQ--NATLEY--FLEENDLIEAEKYTGKILVKQEWKRNM--DVSFKTCVSDGANTECSTCRFIHVLVEPEWLSESFTLSLARMTVDDFWDPLVFQRFRDAMSTLSNWKPSDIHVIGVKQHLDDVIYINIAITDHGRVVRGWRAIELVKESIKKLEK 1177          
BLAST of Protocadherin-1 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 193.356 bits (490), Expect = 1.902e-49
Identity = 184/631 (29.16%), Postives = 286/631 (45.32%), Query Frame = 3
Query:  564 IEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDK----YEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLYVLENHTADVPL----VQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFR-DVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEY 2429
            I V D+NDN+P ++ +       E   I    +   A D DFGTNG  +YS++        S  I   T+ YS  E           RE+ID        ++ A DG  P+ + ++ + + V D ND++P    A  +I++ EN+     V ++ AID DS  NG I+Y +      E ++ F I+ +SG I     LD ET    SL V A DMG     ++ T+ + ++D+NDN+P   F+   +  N  I+E    G  +      D D  E+ K+T  +E    E FS+  +     ++     LK     Q  KV   I   D+G  +      V+V ++D+N  AP+F++  +   + E    G  + T+ A D D G NA + YSI    ++ F I+   G + + +DLDRE   +      A+D   P   ++  I VI+ DINDN P    S Y   +   + D+P+    +QV+  DAD G N      L   +++         P  +LFR D T             G L +  S LDRE      + I A DRG P  S    I + + DVND  P F      +  + +   +  G+T+  I+A D DEG N+++ +
Sbjct:    4 ITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMAS-------SSGIGGLTIDYSTGEVTL--------RERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSM------EGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPT--FDKKEY--NVTISEEMPRGSQIITLKAVDND--EDQKITYRIEEADREVFSILDIGDQGAILSVSGELK----RQDHKVRVEISATDQGGLQGRC--VVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI--DSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATI---SEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSS---------PSIQLFRLDRTS------------GTLRV-SSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTF---EQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISF 570          

HSP 2 Score: 181.03 bits (458), Expect = 1.249e-45
Identity = 175/664 (26.36%), Postives = 293/664 (44.13%), Query Frame = 3
Query:  540 FSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSY----SIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIY-LYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREV-TTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPK---FIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQ 2504
             S  + L I V DIND++P     + +    E   IG+      A+D D G NGI  YS+     E    +II+ ++ +    +         LDRE   +Y   V A D G PS N S  + V + D NDN+P F+K  Y ++++E +   + +I LKA+D D +   KI Y+I    + E   +  I      + V  EL  + +  + + + A D G L+    C V + I D+N ++P  YF    F+   KI E+   G  V     +D D  +N ++   ++  +++ F ++  +        IS     DRE ++  +  +   D  +P   TS  + V ++DIND +P F+  SY   ++ED+  GT    ++A D D G N ++ Y    S      ++F +++  G + + + LDRE    +     A D G P   + + IT+ + D+NDN P   +  Y LY+ EN      +  +   DADEG N++    +       L   +++     + R                   I+  +  D E    K+   ++A+   +   S+   + I+V DVND KP    F+        V++  +      I  I A D D+  N+ LEY      + NDL      +GKI ++Q
Sbjct:  100 LSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSM-----EGSEDFIIDEDSGLIKTTK--------LLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQ--KITYRIEEADR-EVFSILDIGDQGAILSVSGELKRQDH-KVRVEISATDQGGLQ--GRCVVNVFIDDVN-SAP--YFNDHPFS--VKIPEHSPIGYPVITLKAEDHDRGDNARIVYSID--SSQFFRIDPSS------GDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVR-------------------ILTRAEFDYEAKANKFFFELQAS---SGQLSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQ------IGFIPAFDPDQ--NATLEYFL----EENDLIEAEKYTGKILVKQ 697          

HSP 3 Score: 162.925 bits (411), Expect = 5.015e-40
Identity = 144/578 (24.91%), Postives = 261/578 (45.16%), Query Frame = 3
Query:  903 VIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKL--DGKVF-LETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSF--KSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESIN 2621
            V + V D NDN+PVF    Y +++ EN+     +  +KA D D   NGK+ Y ++S +        +I+ ++G + +R  +D +  + I+ ++ A D       ST  + IN+ D+ND++P +       T    +   E  G++ A+    D+DS  NG +   +E   +E+F ++  +        I T K  DRE  ++ +  +   D G P   TS +++V ++DIND AP F +K Y   ++E++  G+ + T+ A D DE  +  ++Y I   D ++FSI  +   G +  +  +L R+    +     A D G  +     N  V + D+N    F      + + E+     P++ +   D D G N+                           R V    S+  F + P    I   S LDRE    + +++ A+D  +PP +T   I + + D+ND  P+F   + S+    +      GT+  Q+ AID D G N  ++Y     S++ +  LF ++  SG + +   + +  +    VL +  +D G P L   + + + +  +N
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSG---IGGLTIDYSTGEVTLRERIDAKN-SPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAI----DEDSGPNGIIKYSME--GSEDFIIDEDS------GLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDE--DQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQD-HKVRVEISATDQGGLQGRCVVN--VFIDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNA---------------------------RIVYSIDSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQF---TSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKL-DREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVN 527          

HSP 4 Score: 119.013 bits (297), Expect = 1.160e-26
Identity = 141/647 (21.79%), Postives = 273/647 (42.19%), Query Frame = 3
Query:  225 NHKHFTIDIYEELPRKTKVIDLGAQATKWFPTDVNKLQDFGKPIYKFQFFNCEKSSVYFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEE-FSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSG--------------YPKQLSTANITVIVKDINDNF--PFL---------------PKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIK 2069
            + K + + I EE+PR +++I L A         V+  +D  K  Y+ +  + E  S+  +I     ++++   + R             ++++  ++++           V+ + + D+N ++P+++ +    +  E S IG       A D+D G N               + Y I+++     +     + +   LDRE    +  IV A D  +P  N S ++ V + D NDNSP F  + Y  +++E++   T  +Q+ AIDAD   NG ++Y ++  +     +LF ++  SG + V  +LD E +  I L + A D G     +   + + + D+NDN+P   FE  + + +  I EN   G  V     +D D  +N  ++  +   A+ + F +E  +     + +I T   FD E  +K           + + +++  V + V D+ND  P   +   + +  ++V+    +  I A D D+  NA L Y  F ++  +    K  GK+ ++ +  R     + F T  +D                 P+ LS +    + +   D+F  P +               P  I++  ++ H  DV  + + +TD    +     + LV E+   L K
Sbjct:  223 DKKEYNVTISEEMPRGSQIITLKA---------VDNDED-QKITYRIEEADREVFSI-LDIGDQGAILSVSGELKR-------------QDHKVRVEISATDQGGLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNA-------------RIVYSIDSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPT--FE--QLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEE-DAEQNGVVRILTRAEFDYE--AKANKFFFELQASSGQLSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQIGFIPAFDPDQ--NATLEY--FLEENDLIEAEKYTGKILVKQEWKRNM--DVSFKTCVSDGANTECSTCRFIHVLVEPEWLSESFTLSLARMTVDDFWDPLVFQRFRDAMSTLSNWKPSDIHVIGVKQHLDDVIYINIAITDHGRVVRGWRAIELVKESIKKLEK 818          
BLAST of Protocadherin-1 vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 151.754 bits (382), Expect = 1.205e-36
Identity = 188/769 (24.45%), Postives = 341/769 (44.34%), Query Frame = 3
Query:  327 NKLQDFGKPIYKFQFFNCEKSSVYFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSV--QDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEG-----NPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIY-LYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIII 2609
             K ++   P Y F  F  E++S + +++  +G I+         + HL          +   D+     ++    I +++EV D NDN+P ++   +  + SE +++G S +L    D D     +  + I     +  ++ +    +   + + Q  LV+  +LDRE  DKYE ++ A DGG P+  G ++  + + D NDN+PVF ++ Y  SV+ N+   + +I ++A DAD   N +I Y I   + P  +  F+I S SG I     L     +T  +IV A+D G+    S+  V I +     +SP +       +N+A + EN   G +VA  S+  Q +D+      +  L P   ++      ++ L ++  I      DRE  S+     +   +G     +P+  T G       DIND AP +   S   H++ +   G    T+ A D D G N  + YS+   D ++ SI+K  G++F+   +D      + F  RA D G P   +   +   + D     P   K+++ + + E+      LV+V   ++  G +   + +L         + +DE+    L  D               G + I+++  D E    Y+  + AT+  +  +++  +I I + DVND  P F +P+  + TV+  P+      +  + A D D G   E+ Y   S + +   F +NP +G++  Q+ +        + L+V  KD G    E++A + I +
Sbjct:   46 GKREESAAPKY-FVVFPDEQTSKFLKVDERSGEIS--------TIAHL------DYEKRSKFDIVAVKVEESGETIDILVEVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVI----LQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSN-FAI-SQSGVITTTASL--LPASTHDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENSTLGSIVARVSIAQQYRDTKLRLIGSSALCPQQTDQ-----AHVYLLLLCGI-----LDRETASEHHLKFLLEKDGQIIIEHPQLLTIG-------DINDNAPQW--HSSQIHISLNRTQGGSR-TLTAKDPDLGQNGWIRYSVL--DTELVSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSL---------QNQDEH----LTVDTMS------------GTVCIQKT-FDFEKQKSYQTTVIATNANS--ETSTSLISIRLKDVNDNWPIF-YPNEYHLTVREGPKPEEPLLV--VSASDMDSGTFGEVSYHILSESSS---FSINPVTGEVFAQKPLARGR----FHLVVSAKDGGGQSSENSANIHITV 731          

HSP 2 Score: 127.872 bits (320), Expect = 2.374e-29
Identity = 129/491 (26.27%), Postives = 219/491 (44.60%), Query Frame = 3
Query:  555 VLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGST--CTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLYVLENHTADVPLVQVNVTDADEGLNS 2021
            ++ I +KD+NDN P +  NE      EG +  +   +  A D D GT G   Y I  E + F ++ +      +++ K   +             ++  +V+A DGG  S   S  + + V D++  +P F ++ Y I   E++    P I + ++ A S    K++Y I S  +      FSI+ ++G I+V   LD + + T+ L ++A     L  G +    V+I I D NDN P+     S       I E+    +   V    DKD  +NG+V   +  I++   S   ++       ++ST    D E        +   D G P ++++ ++ + V D+ND AP F +  Y   V E+  P T +  + A DKD   N  + Y I    ++ F I++  G V+ +  +DRE +  +  +  A D G P + STA+  + V D+NDN P       + V         +  +   D D+GLN 
Sbjct:  626 LISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSSFSINPVTGE---VFAQKPLAR------------GRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDI---LPGIAIGSVGAMS----KVKYSIYSGDQDHN---FSIDEDTGKIYVTRYLDADVHDTVLLNIQA----TLPSGESNQTQVVIFIEDHNDNPPQF----SSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSI--ISSHPGSSIEID---QFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRI-TNGSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLSITPIVVPAGSPLSTAIGTIVAMDPDKGLNG 1077          

HSP 3 Score: 125.946 bits (315), Expect = 1.036e-28
Identity = 155/601 (25.79%), Postives = 251/601 (41.76%), Query Frame = 3
Query:  822 DREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAV--------FSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHI-VCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKD-AKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIY-LYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKL--IIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTI---QESHKVCCYVLIVVVKDNGIPR 2576
            D EK   Y+  V A +  + +    I +   + D NDN P+F    Y ++V E  +   P++ + A D DS   G++ Y I S      +  FSI   +G +  +  L    +    L+V A D G     ++  + I + D +  +P+     SR     + TE+  PG  +          +S+   D + N              FS++          KI   +  D +    V  +I      G   QT    V + +ED ND  P FS       + ED+K     + + A+DKD+  N  + YSI          I++  G++   + LD E+  +     +A D G P + S   + + V D+NDN P   KS Y + VLEN      + +V   D D   N +             I    EY                 F +  D KL  +  +  +DREV +  +I I A D+G PP+S+     I+VLDVND  P  +    S + + V   +   T I  I+A+D D+G N  + Y  ++  Q++ LF++   +G + L++ +    E H+     L V+V D G+PR
Sbjct:  602 DFEKQKSYQTTVIATNANSETSTSLISI--RLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILS-----ESSSFSINPVTGEVFAQKPLARGRF---HLVVSAKDGGGQSSENSANIHITVIDKDTKTPQF----SRSKYEIRTTEDILPGIAIGSVGAMSKVKYSIYSGDQDHN--------------FSIDEDT------GKIYVTRYLDADVHDTVLLNIQATLPSGESNQT---QVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQI---------VYRITNGSEY-----------------FGI--DEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCL----SITPIVVPAGSPLSTAIGTIVAMDPDKGLNGSVLY--RAQLQSS-LFVVK-SNGDVYLRRQLNASDERHQ----RLSVIVSDQGVPR 1125          

HSP 4 Score: 92.4337 bits (228), Expect = 1.654e-18
Identity = 150/644 (23.29%), Postives = 267/644 (41.46%), Query Frame = 3
Query:  717 ISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDIN-DEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDA-KIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPD-GKLIIRE---SGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINV--LDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESIN 2621
            + PE+     S +       +S   +  +    +LDRE +++Y   V     G        +V V V + NDN P F  +     V ENL+  + V  + A D D+     + Y + S +  +    F+I+  +G IH+   LD+E     +L ++A D G+    +  T+ ++  D+NDN+P  + +P   T  +  T   +PG+  A     D D+   G +T  L   ++  F +     P +    +  L          VTA     D G P  +TS  VSV + +    + P F +  + F V E+ K G  +  ++  +  E       Y I   +A KIFSI+K  G++F+   +DRE   +  F     +     Q       VIV D NDN P F   + YL + ++      + Q+  +D D G N      ++S     ++                        +L PD G + + E   + LD      ++I++EA D G+P ++  G + +++     +   P F+ P      V V   T  GT + +I A +    +N  L YS K +        ++ ++G+++L+  +    +    + + V   NG         L+I++E ++
Sbjct: 1854 LQPELAGLTYSIVEGNIDSAFSVDSEGVIRTNLELDREILERYSLKVIGTGSGQ---QIGTRVDVRVNNLNDNVPSFPMS-KPRRVPENLRVGSYVATVGAKDVDNL--APLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATD-GSFDTFTNLTIFVS--DINDNAP-TFSKPLYQTTVSPATF--SPGQPFAKIEAHDLDAR--GALTYSLGQGSSSIFRVA----PESGALFMKVLPPAGERYLVTVTAT----DNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSKIGLQIGNLSGEESRE-----FHYRIQDPEASKIFSIDKF-GRLFVAGPIDREQRATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIV------------------------TLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPV---YEVHVLEDTSVGTVLQKIRASNRLGMRNDGLLYSLKEHQGK---LGIDVKTGELTLKTHLDWESEPIISMYLSVSDGNG---RSAVVPLKIVVEPVD 2436          

HSP 5 Score: 90.5077 bits (223), Expect = 5.970e-18
Identity = 111/399 (27.82%), Postives = 180/399 (45.11%), Query Frame = 3
Query:  558 LVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSI-------SPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPE-IYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSV----GVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALL 1718
            +VI ++D NDN P +S + +     E  ++ +   +  A D D   NG   YSI       S EI +F  +  ++T +++               D E    Y+  V A D G P  + ++ + + V D NDN+P FEK+ Y + V EN    T V ++ A D DS  NG+I Y+I++ +  EY   F I+   G ++ +  +D E  + + + + A D G   R ST +  I++ D+NDN P  +   P      + ++   A G +VA+    D D   NG V       A  + SL  +     V  +     S +R Q+  V    +  D+G PR++    V V    G  DI  + P    + YI  + +    G  L T+NAT    G+++ L
Sbjct:  823 VVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQF--TGQLSTGSLL---------------DYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGS--EY---FGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLSITPIVVPAGSPLS--TAIGTIVAM----DPDKGLNGSVLYR----AQLQSSLFVVKSNGDVYLRRQLNASDERHQRLSV----IVSDQGVPRKSVVCHVPVRISKGSADIQIQEPF---QKYI-EIPKSCPTGCRLTTLNAT----GVSSWL 1177          

HSP 6 Score: 86.6557 bits (213), Expect = 1.002e-16
Identity = 84/345 (24.35%), Postives = 150/345 (43.48%), Query Frame = 3
Query:  906 IVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIY 1940
            ++ + D NDN+P +  +   IS+N     +     L A D D   NG I Y +         +L SI+  +G I V   +D    + I   V A D G+    +   V+ ++ D     P+  FE + +    +I E+   G  +      +     + ++   L+   +E  +++ M+  + +       K+FD E++      ++  +  +  +T++  +S+ ++D+ND  P F    Y   V E  KP   L  ++A+D D G    +SY I  + +  FSIN + G+VF +  L R      H    A D G     ++ANI + V D +   P   +S Y
Sbjct:  428 LLTIGDINDNAPQWHSSQIHISLNRTQGGSR---TLTAKDPDLGQNGWIRYSVLD------TELVSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQ--FEKALW--QVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQN-QDEHLTVDTMSGTVCIQ------KTFDFEKQKSYQTTVIATNANS--ETSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSS-FSINPVTGEVFAQKPLAR---GRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKY 746          

HSP 7 Score: 83.1889 bits (204), Expect = 1.199e-15
Identity = 101/407 (24.82%), Postives = 167/407 (41.03%), Query Frame = 3
Query:  822 DREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYI-ISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPS-RFTNNAKITENEAPGKLVAVFSVQDKDSN-ENGKVTCHLEP-IANEEFSLERMNIPLTVMYK----ISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKD--EGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLYVLENHT--ADVPLVQVNVTDAD 2006
            DRE   ++  I+   DGG  S N S  V V V D+NDN P  + +    + + E+ +    + + +A D D   NGK  +++             +E +SG              ++ L+ E  D+   R  S  +  I +R ++   P +Y E +   +N    TE +AP + +    +   D     G+    L+P +A   +S+   NI           I T    DRE   + +  ++    G   Q     V V V ++ND  P F   S    V E+++ G+Y+ T+ A D D    +   L     G+    F+I++  G + L   LD E +     T +A D  +    +  N+T+ V DINDN P   K +Y   +   T     P  ++   D D
Sbjct: 1688 DREASQEHLLIIILTDGG--SRNDSCTVRVTVADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMDIGQNGKFSFEL-------------LEDSSG--------------SLDLVPETGDLVLRRLSSLQSWKIKLRVVDHGVPGLYVEKNLEISNRNPQTEAKAPLEFLKQTYLSTIDEGLPRGQFIAKLQPELAGLTYSIVEGNIDSAFSVDSEGVIRTNLELDREILERYSLKVIGTGSG---QQIGTRVDVRVNNLNDNVPSFP-MSKPRRVPENLRVGSYVATVGAKDVDNLAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDGSFD---TFTNLTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLD 2058          

HSP 8 Score: 75.0998 bits (183), Expect = 3.146e-13
Identity = 84/375 (22.40%), Postives = 162/375 (43.20%), Query Frame = 3
Query:  822 DREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHV-RW---ELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKIS--TLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDL-DRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFL 1925
            DRE+   +EF V   +    S     K  V V DENDN PVF    Y +S+ +++     + Q+ A D DS  NG++ Y+I S        + ++  ++G I +  W   +LD     T  ++VEA D G+  R +   V ++++  + +    +F    +     + E+ + G ++      ++    N  +           +SL+     L +  K    TLK+    +   + +  +   +GN R      + + VE +++ AP F++ SY   +      G  +  + A D+D G++ ++ YSI  + + +  I +  G + L+  L  R ++     T  A  S   +  +T  + +   D+  + P L
Sbjct: 2189 DREQRATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGND---LNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVY--EVHVLEDTSVGTVLQKIRASNRLGMRNDGLL----------YSLKEHQGKLGIDVKTGELTLKTHLDWESEPIISMYLSVSDGNGRSAVV-PLKIVVEPVDEFAPVFTKSSYTLQIPISTPAGESVGQMQAIDEDGGVHGVVKYSISDRQSTV-KIEEHTGIIRLQKPLVSRRNLTIEQITVVAYSSPTKQSKTTVYLEIGPFDVQPSLPKL 2546          

HSP 9 Score: 63.929 bits (154), Expect = 7.444e-10
Identity = 85/339 (25.07%), Postives = 137/339 (40.41%), Query Frame = 3
Query: 1605 PHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKD--AKIFSINKLDGKVFLETDLDRESVESLHFTT-RAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIII 2609
            P F +    F V E  + GT +  I+   K E   A   + +F  +  +K   +++  G++     LD E          +  +SG      T +I V V D NDN P F  + + L + E            VTD D       +  ++      + K       ++L  D           L+ +G+L       DRE   KYE++IEA D G P K  +    I ++D ND  P F   S S  T  V      G+ +  + A D D G+NS + Y  K  +  ++      +SG I+   ++  +     + +IVV  D+G P L  +A + I +
Sbjct:   20 PTFCQCLTKFTVPESAQIGTRIGWISG--KREESAAPKYFVVFPDEQTSKFLKVDERSGEISTIAHLDYEKRSKFDIVAVKVEESG-----ETIDILVEVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVILQGNVNNVFKLASRKVNEQLQAD-----------LVVNGQL-------DREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVF---SRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSNFAISQSGVITTTASLLPA---STHDVIVVASDHGSPSLSSSAVVTITV 327          
BLAST of Protocadherin-1 vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 150.599 bits (379), Expect = 2.984e-36
Identity = 225/857 (26.25%), Postives = 371/857 (43.29%), Query Frame = 3
Query:  279 VIDLGAQATKWFPTDVNKLQDFGKPIYKFQFFNCEKSSVYFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDK----YEFIVNAFDGGNP-SFNGSIKVIVAVTDENDNSPVF-EKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAK--LFSIESNSGYIHVRWELD----YETYTTISLIVEANDMGNL------RRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEA---PGKLVAVFSVQDKDSNENGKVTCHL---EPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSI---------FGKDAKIFS-INKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQL-STANITVIVKDINDNFPFLPKS----IYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNS-----TVKVKPRTVSGTTIAQIIAIDED-EGKNSELEYSF--KSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRL-------EDTARLRIIIESINGDSILSKENKMKDNVEYSNEES 2687
            V+D+ AQ+ + F    +K    G   Y  +    E  + +F I+P  G+I + R +D D+         PK +    L +T + D+  SH+  L I + D+NDN P +++     Q  E   +  +     A+D D G N    YS+             N N  + SN E   +  K +LD +++++    Y F V A D G P S + S  + +   + ND S VF   + Y   V E+ Q  TPVIQ++A DAD +   ++ Y           K  LFSI+ ++G + +R  +      E    I+L V   D G+          S  T++I I D+N+N PE + + +++++ AKI E      P  +V V    D DS+ NG +   L   +  + + F ++R    LT    +     FDRE + +    +   D G+         SV V DIND +P F   SY   V+     GT + T+ A D D   NA ++YS+            D   F  +N+  G++ L   +  ++ +   F   A D+G P+ L S+A +T+ V D     P    S      + V EN   +  +++     + +  NS+    L   TA+     K E      FR   K F N    +    +++I E GLD E    Y + + ATD  +   STK  + + V DVND  P+F     + +     T        +G  I  + AID D +G  +E+ Y    ++N +    F ++  +G+I   +   +  K+  Y+L V   D  +  L       +D  +++I+I  +N ++   +E K    V+ S  E 
Sbjct:  549 VVDVKAQSFRSFEDGRSK----GPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDD------PALPKLHK---LKVTAREDNRESHVD-LTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVD------------NHNFSINSNGE---ISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRD---EVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPE-FPDCAKYSDIAKIMEGTYKTDPPTIVKV-EATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHV----VFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKT-QKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKL---TASGGPGNKAE----SKFRQFNK-FENGNEWV----EVVIME-GLDYEQVNNYTLTLTATDMTSRVASTKTFV-VEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKF-DREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEG 1351          

HSP 2 Score: 139.043 bits (349), Expect = 1.075e-32
Identity = 159/608 (26.15%), Postives = 258/608 (42.43%), Query Frame = 3
Query:  822 DREKIDKYEFIVNAFD-------GGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPI-ANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAH---IVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKP----GTYLFTINATDKDEGI--NALLSYSIFGK----DAKIFSINKLDGKVFLETDLDRESVESLHFT--TRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIY-LYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTK---YEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDN 2564
            DREKID Y   V A D       G N     ++KV + + D NDN+P FE+  YI  V E+      VI +KA D D   N  + Y +           F + ++SG I V+  LD+E      L++ A+D    R  +T  V I+I D+NDN+P+  FE  ++       + + P  L  V +       ++ ++   LE   A+E F + + +        I  +K+ DR+  + V +    +   D+          V V V DIND +P F E+ + + + E+ +P    G Y   + A D D+    NA + Y I          +F I++  GK+F    LDRE      F    RA D G P +   AN+T+ V D+NDN PF  K+ Y   V E       ++  +  DADE          +SE +       D        +D  +S    L    P          LD E  T+   + + I  +D  +     +  +++ ++D ND  P      G+    +V+     GT+I +  A D D G  +    + +S+ +    F ++ + G + +  T+ +   +  Y LI+   DN
Sbjct: 1287 DREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSN--LRYHLIGAGGGRIP--FGVRTDSGTIFVKEPLDFEASDQYHLVLIASDG---RHNATTNVYIHIEDVNDNAPQ--FEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYS------GTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGY-IEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTD--------KDSKQSSVGVLRVKQP----------LDYEDVTQRDGFHLGIRVSDGRH---DAEAAVHVALVDRNDHAPHI---HGATEH-RVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQ--FTID-QDGTLRVAHTL-DREDIAVYNLIIEAYDN 1849          

HSP 3 Score: 122.865 bits (307), Expect = 9.887e-28
Identity = 162/647 (25.04%), Postives = 276/647 (42.66%), Query Frame = 3
Query:  828 EKIDKYEFIVNAFDGGNPSFNGS-----IKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAID----ADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSK----VTAHIVCFDEGNPRQ-TTSGSVSVGVEDINDEAPHFSEKS-YIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAK------IFSINKLDGKVFLETDLDR----ESVESLHFTTRAADSG----YPKQLSTANITVIV--KDINDNFPFLPK----SIYLYVLEN-HTADVP-LVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGL---------DREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFK-----SNNQTNDL---FLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPR-LEDTARLRI 2603
            E+ D Y     A D  +PS N +     + ++  + DE    P F K  Y ++V+E+   +  V+ +KA       D    G I Y +   T  +  K F I+ ++G IH+   LD++      L           R S   + I I D+NDN P      +R    A++ E+    + +   +  DKD+ +N ++T          +S++  N  +    +IS     D +Q ++       ++   D G P   ++S  + +  E+ NDE+  F   S Y   V ED + GT +  I A D D      ++YS   K+ +      +FSI++  G V L   +      E+   ++ T    D G    YP +  T+  T+++  +D+N+N P  P     S    ++E  +  D P +V+V  TD D   N +   +L                        T+S S   F       +I R++G+         DRE   + ++ ++ATDRG+ P        + V+D+ND  P+F  PS   S  + +     GT++  + A D D   N+E+ YS +          NDL    L+N  SG+I+L + I    K   ++  V+  DNGIP  L+ +A++ +
Sbjct:  489 ERGDTYRISAQAMDL-SPSDNTTSQLSEVAILEILADER--PPQFAKQEYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDNRESHVDLTIRIDDVNDNVPTF----TRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRIT----------YSVDNHNFSINSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRD---EVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLY----------------------YTQSESRKAF-------VIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFE---AVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPI--PMKTQKFIFNVIADDNGIPEALQSSAQVTL 1081          

HSP 4 Score: 107.842 bits (268), Expect = 3.867e-23
Identity = 182/742 (24.53%), Postives = 306/742 (41.24%), Query Frame = 3
Query:  396 YFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISV-NENLQSNTPVIQLKAIDADS-EMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTI---SLIVEA-NDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVF--SVQDKD----SNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSK--VTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDE-GINALLSYSI----------FGKDAKIFSINKLDGKVFLETDLDRESV---ESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPK-FIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGK-----NSELEYSFKSNNQTNDLFLMNPESGKISLQQT-IQE 2516
            +F I+ L G I    + DR+ +   + T      +   L      + D   + +++    D+NDN+P + + + + +  E    G       A D D  +N + Y+ I             ++ T+               LD E  D+Y  ++ A DG     N +  V + + D NDN+P FE+  Y  +V  E++     +  + A DAD  E + +I Y++      E   +F I   SG I +   LD +    +   + +V+A +D GN   G    V +N+RD+NDNSP I+  P R      I EN  P     V+   VQ +D    + EN  +   +  + N+  + E +        KI  ++S DRE  S+      +   D G P +    +V++ V D+ND AP F +  Y   V E    G  + + +A D DE   + + +Y +            KD+K  S+    G + ++  LD E V   +  H   R +D    +  + A + V + D ND+ P +  +    V E+      + +   TD D G           +TA   I R+ +   Q              F++  DG L +  + LDRE    Y ++IEA D  N     + ++ + + DVND  P+ +  P      +  +   V+     +I A D D  +       E+  SFK +   N +F  N + G  S+  T +QE
Sbjct: 1270 HFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVI---NDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSN-LRYHLIGAGGGRIPFGVRTDSGTIFVKEP----------LDFEASDQYHLVLIASDG---RHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADE---VFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVG-YADVQVNVRDINDNSP-IF--PERLF--GYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGI--VRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSV----GVLRVKQPLDYEDVTQRDGFHLGIRVSDG---RHDAEAAVHVALVDRNDHAPHIHGATEHRVREDVPRGTSIGRYTATDRDAG-----------DTARFRINRQSDPKRQ--------------FTIDQDGTLRVAHT-LDREDIAVYNLIIEAYDNSN--NIGRQMVAVYLQDVNDNGPEPYTVP---RPCIFRENTPVNQLGTCEIRATDRDTAEFGPPFTMEVSPSFKYSQYLNVIFNANGDGGNGSMTITPLQE 1945          

HSP 5 Score: 105.531 bits (262), Expect = 1.641e-22
Identity = 181/825 (21.94%), Postives = 334/825 (40.48%), Query Frame = 3
Query:  345 GKPIYKFQFFNCEKSSVYFEINPLNG-------VITIERRIDRDNLCHLVPTC-CPKKNNQCNLDLTIKSDDD--------FSHIIVLVIEVKDINDNSPFW---SQNELVTQFSEGSEIGDSKSLTV--ALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEY--QISSLTKPEYAKLFS----IESNSGYIHVRWELDYETYTTI-SLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPS---RFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNI--PLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKP--------GTYLFTINATDKD-EGINALLSYSIF----GKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTAN--------ITVIVKDINDNFPFLPKSIYL-YVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEG-KNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQES--HKVCCYVLIVVVKDNGIPRLEDTARLRIIIESINGDSILSKE 2645
            G P+ + Q  + ++  V +     NG       + +I+       L H V      +  N  NL + ++ D           +    L+I ++D+N+N P +   ++   + +  EG+   D  ++    A D+D   NG   YS+    +E   +++I+  T + +    +        DRE   + +  V A D G+    G  +  V V D NDNSP FE+  Y  SV+      T VI + A D D+  N +I Y  +I +    E+         +   SG I +   +  +T   I ++I + N +    + S+  V +N+ D    +P+    P      T +  +  N+   +  AV S   ++S+   K+T    P    E    + N         ++  ++  D EQ +  T  +   D    R  ++ +  V V D+ND  P F+   +   ++E++ P        G  + T+ A D D +G    + Y I     G++ K F I++L G++F     DRE ++    T  A+D      L  AN        + +++ D+NDN P   +  Y+  V E+      ++ +   D D+  +S  +  L+      +                        F +  D   I  +  LD E + +Y +V+ A+D G    +T   +YI++ DVND  P+  F     +T  ++        +  + A D D+  K+S + Y  +     +++F +   SG I L + +       V  +  +V   D+    L   A +++ +  IN +S +  E
Sbjct:  764 GTPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVF------DRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVIADDNGIPEALQ-SSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDM-TSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSV-SALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDK--HSNLRYHLIGAGGGRI-----------------------PFGVRTDSGTIFVKEPLDFEASDQYHLVLIASD-GRHNATTN--VYIHIEDVNDNAPQ--FEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQG-ADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPE 1548          

HSP 6 Score: 91.2781 bits (225), Expect = 3.750e-18
Identity = 121/476 (25.42%), Postives = 200/476 (42.02%), Query Frame = 3
Query:  318 TDVNKLQDFGKPIYKFQFFNCEKSSVYFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIV----LVIEVKDINDNSPFWSQNELVTQFSEGSEI--GDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFI--VNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKI-EYQISSLTKPEYAKL--FSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGN--PRQTTSGSVSVGVEDINDEA--PHFSEKSYIFHVNEDV-KPGTYLFTINATDKD 1697
            TD ++ +   + +Y+ +    + +   F I   +G I + + +DRD      P   P  N        +++ DD  + +V    + + V+DINDNSP + +  L     E  E    D          DF        +I   I   +L   IN  ++   ++   K+   + LDRE   + EFI  V A D G PS  G   V + VTD NDN+P FEK  Y  SV E       V+   A DAD E    +  YQ+S  +   Y      S +S+ G + V+  LDYE  T          + + R  +   V + + D ND++P I+          ++ E+   G  +  ++  D+D+ +  +   + +     +F++++          +    + DRE  +     I  +D  N   RQ     V+V ++D+ND    P+   +  IF  N  V + GT    I ATD+D
Sbjct: 1462 TDADQDEKSSRIVYRLE---GQGADEVFRIGKYSGTIELVKALDRDP-----PAGVPSWN------FVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPE-RLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKL---INGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHIH-----GATEHRVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQFTIDQDGT-------LRVAHTLDREDIAVYNLIIEAYDNSNNIGRQM----VAVYLQDVNDNGPEPYTVPRPCIFRENTPVNQLGT--CEIRATDRD 1901          
BLAST of Protocadherin-1 vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 150.599 bits (379), Expect = 2.984e-36
Identity = 225/857 (26.25%), Postives = 371/857 (43.29%), Query Frame = 3
Query:  279 VIDLGAQATKWFPTDVNKLQDFGKPIYKFQFFNCEKSSVYFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDK----YEFIVNAFDGGNP-SFNGSIKVIVAVTDENDNSPVF-EKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAK--LFSIESNSGYIHVRWELD----YETYTTISLIVEANDMGNL------RRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEA---PGKLVAVFSVQDKDSNENGKVTCHL---EPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSI---------FGKDAKIFS-INKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQL-STANITVIVKDINDNFPFLPKS----IYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNS-----TVKVKPRTVSGTTIAQIIAIDED-EGKNSELEYSF--KSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRL-------EDTARLRIIIESINGDSILSKENKMKDNVEYSNEES 2687
            V+D+ AQ+ + F    +K    G   Y  +    E  + +F I+P  G+I + R +D D+         PK +    L +T + D+  SH+  L I + D+NDN P +++     Q  E   +  +     A+D D G N    YS+             N N  + SN E   +  K +LD +++++    Y F V A D G P S + S  + +   + ND S VF   + Y   V E+ Q  TPVIQ++A DAD +   ++ Y           K  LFSI+ ++G + +R  +      E    I+L V   D G+          S  T++I I D+N+N PE + + +++++ AKI E      P  +V V    D DS+ NG +   L   +  + + F ++R    LT    +     FDRE + +    +   D G+         SV V DIND +P F   SY   V+     GT + T+ A D D   NA ++YS+            D   F  +N+  G++ L   +  ++ +   F   A D+G P+ L S+A +T+ V D     P    S      + V EN   +  +++     + +  NS+    L   TA+     K E      FR   K F N    +    +++I E GLD E    Y + + ATD  +   STK  + + V DVND  P+F     + +     T        +G  I  + AID D +G  +E+ Y    ++N +    F ++  +G+I   +   +  K+  Y+L V   D  +  L       +D  +++I+I  +N ++   +E K    V+ S  E 
Sbjct:  549 VVDVKAQSFRSFEDGRSK----GPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDD------PALPKLHK---LKVTAREDNRESHVD-LTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVD------------NHNFSINSNGE---ISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRD---EVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPE-FPDCAKYSDIAKIMEGTYKTDPPTIVKV-EATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHV----VFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKT-QKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKL---TASGGPGNKAE----SKFRQFNK-FENGNEWV----EVVIME-GLDYEQVNNYTLTLTATDMTSRVASTKTFV-VEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKF-DREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEG 1351          

HSP 2 Score: 139.043 bits (349), Expect = 1.075e-32
Identity = 159/608 (26.15%), Postives = 258/608 (42.43%), Query Frame = 3
Query:  822 DREKIDKYEFIVNAFD-------GGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPI-ANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAH---IVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKP----GTYLFTINATDKDEGI--NALLSYSIFGK----DAKIFSINKLDGKVFLETDLDRESVESLHFT--TRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIY-LYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTK---YEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDN 2564
            DREKID Y   V A D       G N     ++KV + + D NDN+P FE+  YI  V E+      VI +KA D D   N  + Y +           F + ++SG I V+  LD+E      L++ A+D    R  +T  V I+I D+NDN+P+  FE  ++       + + P  L  V +       ++ ++   LE   A+E F + + +        I  +K+ DR+  + V +    +   D+          V V V DIND +P F E+ + + + E+ +P    G Y   + A D D+    NA + Y I          +F I++  GK+F    LDRE      F    RA D G P +   AN+T+ V D+NDN PF  K+ Y   V E       ++  +  DADE          +SE +       D        +D  +S    L    P          LD E  T+   + + I  +D  +     +  +++ ++D ND  P      G+    +V+     GT+I +  A D D G  +    + +S+ +    F ++ + G + +  T+ +   +  Y LI+   DN
Sbjct: 1287 DREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSN--LRYHLIGAGGGRIP--FGVRTDSGTIFVKEPLDFEASDQYHLVLIASDG---RHNATTNVYIHIEDVNDNAPQ--FEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYS------GTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGY-IEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTD--------KDSKQSSVGVLRVKQP----------LDYEDVTQRDGFHLGIRVSDGRH---DAEAAVHVALVDRNDHAPHI---HGATEH-RVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQ--FTID-QDGTLRVAHTL-DREDIAVYNLIIEAYDN 1849          

HSP 3 Score: 122.865 bits (307), Expect = 9.887e-28
Identity = 162/647 (25.04%), Postives = 276/647 (42.66%), Query Frame = 3
Query:  828 EKIDKYEFIVNAFDGGNPSFNGS-----IKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAID----ADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSK----VTAHIVCFDEGNPRQ-TTSGSVSVGVEDINDEAPHFSEKS-YIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAK------IFSINKLDGKVFLETDLDR----ESVESLHFTTRAADSG----YPKQLSTANITVIV--KDINDNFPFLPK----SIYLYVLEN-HTADVP-LVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGL---------DREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFK-----SNNQTNDL---FLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPR-LEDTARLRI 2603
            E+ D Y     A D  +PS N +     + ++  + DE    P F K  Y ++V+E+   +  V+ +KA       D    G I Y +   T  +  K F I+ ++G IH+   LD++      L           R S   + I I D+NDN P      +R    A++ E+    + +   +  DKD+ +N ++T          +S++  N  +    +IS     D +Q ++       ++   D G P   ++S  + +  E+ NDE+  F   S Y   V ED + GT +  I A D D      ++YS   K+ +      +FSI++  G V L   +      E+   ++ T    D G    YP +  T+  T+++  +D+N+N P  P     S    ++E  +  D P +V+V  TD D   N +   +L                        T+S S   F       +I R++G+         DRE   + ++ ++ATDRG+ P        + V+D+ND  P+F  PS   S  + +     GT++  + A D D   N+E+ YS +          NDL    L+N  SG+I+L + I    K   ++  V+  DNGIP  L+ +A++ +
Sbjct:  489 ERGDTYRISAQAMDL-SPSDNTTSQLSEVAILEILADER--PPQFAKQEYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDNRESHVDLTIRIDDVNDNVPTF----TRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRIT----------YSVDNHNFSINSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRD---EVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLY----------------------YTQSESRKAF-------VIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFE---AVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPI--PMKTQKFIFNVIADDNGIPEALQSSAQVTL 1081          

HSP 4 Score: 107.842 bits (268), Expect = 3.867e-23
Identity = 182/742 (24.53%), Postives = 306/742 (41.24%), Query Frame = 3
Query:  396 YFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISV-NENLQSNTPVIQLKAIDADS-EMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTI---SLIVEA-NDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVF--SVQDKD----SNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSK--VTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDE-GINALLSYSI----------FGKDAKIFSINKLDGKVFLETDLDRESV---ESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPK-FIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGK-----NSELEYSFKSNNQTNDLFLMNPESGKISLQQT-IQE 2516
            +F I+ L G I    + DR+ +   + T      +   L      + D   + +++    D+NDN+P + + + + +  E    G       A D D  +N + Y+ I             ++ T+               LD E  D+Y  ++ A DG     N +  V + + D NDN+P FE+  Y  +V  E++     +  + A DAD  E + +I Y++      E   +F I   SG I +   LD +    +   + +V+A +D GN   G    V +N+RD+NDNSP I+  P R      I EN  P     V+   VQ +D    + EN  +   +  + N+  + E +        KI  ++S DRE  S+      +   D G P +    +V++ V D+ND AP F +  Y   V E    G  + + +A D DE   + + +Y +            KD+K  S+    G + ++  LD E V   +  H   R +D    +  + A + V + D ND+ P +  +    V E+      + +   TD D G           +TA   I R+ +   Q              F++  DG L +  + LDRE    Y ++IEA D  N     + ++ + + DVND  P+ +  P      +  +   V+     +I A D D  +       E+  SFK +   N +F  N + G  S+  T +QE
Sbjct: 1270 HFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVI---NDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSN-LRYHLIGAGGGRIPFGVRTDSGTIFVKEP----------LDFEASDQYHLVLIASDG---RHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADE---VFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVG-YADVQVNVRDINDNSP-IF--PERLF--GYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGI--VRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSV----GVLRVKQPLDYEDVTQRDGFHLGIRVSDG---RHDAEAAVHVALVDRNDHAPHIHGATEHRVREDVPRGTSIGRYTATDRDAG-----------DTARFRINRQSDPKRQ--------------FTIDQDGTLRVAHT-LDREDIAVYNLIIEAYDNSN--NIGRQMVAVYLQDVNDNGPEPYTVP---RPCIFRENTPVNQLGTCEIRATDRDTAEFGPPFTMEVSPSFKYSQYLNVIFNANGDGGNGSMTITPLQE 1945          

HSP 5 Score: 105.531 bits (262), Expect = 1.641e-22
Identity = 181/825 (21.94%), Postives = 334/825 (40.48%), Query Frame = 3
Query:  345 GKPIYKFQFFNCEKSSVYFEINPLNG-------VITIERRIDRDNLCHLVPTC-CPKKNNQCNLDLTIKSDDD--------FSHIIVLVIEVKDINDNSPFW---SQNELVTQFSEGSEIGDSKSLTV--ALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEY--QISSLTKPEYAKLFS----IESNSGYIHVRWELDYETYTTI-SLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPS---RFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNI--PLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKP--------GTYLFTINATDKD-EGINALLSYSIF----GKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTAN--------ITVIVKDINDNFPFLPKSIYL-YVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEG-KNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQES--HKVCCYVLIVVVKDNGIPRLEDTARLRIIIESINGDSILSKE 2645
            G P+ + Q  + ++  V +     NG       + +I+       L H V      +  N  NL + ++ D           +    L+I ++D+N+N P +   ++   + +  EG+   D  ++    A D+D   NG   YS+    +E   +++I+  T + +    +        DRE   + +  V A D G+    G  +  V V D NDNSP FE+  Y  SV+      T VI + A D D+  N +I Y  +I +    E+         +   SG I +   +  +T   I ++I + N +    + S+  V +N+ D    +P+    P      T +  +  N+   +  AV S   ++S+   K+T    P    E    + N         ++  ++  D EQ +  T  +   D    R  ++ +  V V D+ND  P F+   +   ++E++ P        G  + T+ A D D +G    + Y I     G++ K F I++L G++F     DRE ++    T  A+D      L  AN        + +++ D+NDN P   +  Y+  V E+      ++ +   D D+  +S  +  L+      +                        F +  D   I  +  LD E + +Y +V+ A+D G    +T   +YI++ DVND  P+  F     +T  ++        +  + A D D+  K+S + Y  +     +++F +   SG I L + +       V  +  +V   D+    L   A +++ +  IN +S +  E
Sbjct:  764 GTPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVF------DRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVIADDNGIPEALQ-SSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDM-TSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSV-SALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDK--HSNLRYHLIGAGGGRI-----------------------PFGVRTDSGTIFVKEPLDFEASDQYHLVLIASD-GRHNATTN--VYIHIEDVNDNAPQ--FEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQG-ADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPE 1548          

HSP 6 Score: 91.2781 bits (225), Expect = 3.750e-18
Identity = 121/476 (25.42%), Postives = 200/476 (42.02%), Query Frame = 3
Query:  318 TDVNKLQDFGKPIYKFQFFNCEKSSVYFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIV----LVIEVKDINDNSPFWSQNELVTQFSEGSEI--GDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFI--VNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKI-EYQISSLTKPEYAKL--FSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGN--PRQTTSGSVSVGVEDINDEA--PHFSEKSYIFHVNEDV-KPGTYLFTINATDKD 1697
            TD ++ +   + +Y+ +    + +   F I   +G I + + +DRD      P   P  N        +++ DD  + +V    + + V+DINDNSP + +  L     E  E    D          DF        +I   I   +L   IN  ++   ++   K+   + LDRE   + EFI  V A D G PS  G   V + VTD NDN+P FEK  Y  SV E       V+   A DAD E    +  YQ+S  +   Y      S +S+ G + V+  LDYE  T          + + R  +   V + + D ND++P I+          ++ E+   G  +  ++  D+D+ +  +   + +     +F++++          +    + DRE  +     I  +D  N   RQ     V+V ++D+ND    P+   +  IF  N  V + GT    I ATD+D
Sbjct: 1462 TDADQDEKSSRIVYRLE---GQGADEVFRIGKYSGTIELVKALDRDP-----PAGVPSWN------FVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPE-RLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKL---INGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHIH-----GATEHRVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQFTIDQDGT-------LRVAHTLDREDIAVYNLIIEAYDNSNNIGRQM----VAVYLQDVNDNGPEPYTVPRPCIFRENTPVNQLGT--CEIRATDRD 1901          
BLAST of Protocadherin-1 vs. Ensembl Fly
Match: ft (gene:FBgn0001075 transcript:FBtr0077478)

HSP 1 Score: 257.299 bits (656), Expect = 2.443e-69
Identity = 223/814 (27.40%), Postives = 370/814 (45.45%), Query Frame = 3
Query:  246 DIYEELPRKTKVIDLGAQATKWFPTDVNKLQDFGKPIYKFQFFNCEKSSVYFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGIS-YYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTIS---------LIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKIT---ENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIF-GKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNP-PKSTKGIIYINVLDVNDCKPKFIFP-------SGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQES-HKVCCYVLIVVVKDNGIPRLEDTARLRIIIES 2615
            ++ E  PR T V         + PT         KP + ++F    +    F ++P+ G +     +DR+ +             + + DL + S    ++ I + I+V D+NDNSP + +  +   FSE +  G    L  A D D G NG++  Y I     + +   +   N     +   L L     LDRE    Y+  ++A DGG+P   G ++V V + D NDN P+F+ + Y +S+NE     TPV+ + A D D   N KI Y ++     E    F++   +G I     ++    T +            V A D G+ R+     V +N+ D ND+ P I F    F +  K+    EN   G +VA  +V+D DS  NG+ +  +  ++  E    R+      ++ +      DRE+  K    +V  D+G P +TT+  + + V D+ND  P F +  Y   ++E    G+++ +I ATD+D G+NA + Y I  G + K FS++ L G +     LDRE  +++  +  A D G   + +   + VI+ D ND  P F  +   + + E+      +  +  TD D+G N      L        ++R   YP+Q     +T             G+L  R   LDRE  ++YEI + A D+G P P+S    +++NV DVND  P+F +P       +  +  +K+K        +  + A D+D+G N+ +EY  +S  +   LF ++  SG ISL+     S H    Y L+V  +D G  R +  A + I+++S
Sbjct:   72 EVLEGQPRGTTV--------GFIPT---------KPKFSYRFNEPPRE---FTLDPVTGEVKTNVVLDREGM-------------RDHYDLVVLSSQP-TYPIEVRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNVDNKFRLVTTANPS--GDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLA-----ETEHQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFR--FFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRI--VSGNELGHFRLE-EAADLHIVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNELKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPNPKFAYTQLKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAPS-----VERL--YPLQFALDALT-------------GQLTTRRP-LDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQF-YPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESGGE--GLFQLDARSGAISLRGDAPASMHWKPHYKLLVSARDAGQRRSQQDAIVEIVLKS 815          

HSP 2 Score: 213.386 bits (542), Expect = 1.885e-55
Identity = 216/751 (28.76%), Postives = 338/751 (45.01%), Query Frame = 3
Query:  486 PKKNNQCNLD-LTIKSDDDFSHIIVLVIEVKDINDNSP-FWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYS-NKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMG-NLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAP--GKLVAVFSVQDKDSNE-NGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPK-QLSTANITVIVKDINDNFPFLPKSIY-LYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTK------YEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVK--VKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESINGDSILSKENKMKDNVEYSNEES 2687
            P+K  Q   + L  +     S  + + I +KD+ND  P F S NE  T   E   I        A+DND G NG   Y +  E  + ++     ++ + +S N    +L +   LDRE    Y   + A D G P  +   ++++ + DENDNSPVF+   Y  SV EN      V+Q+ A D D   NG+I Y   S+   +    FSI  ++G + V   L+YE  +  SL V A D       G T  + INI D+NDN P     P      A++ EN  P  G  V   +  D D+   N +V   L+   ++ F   R+N        I+ LK  DREQ+S+ T  +V  D G+P  T +G V V V+DIND  P F  +SY   V E++  GT++ T  ATDKDEG+NA L +++ G+    F I+   G++   T LDRE     H T  A DS   + + S+ N+T+ V D+NDN P    + Y + V E  +    +      D D+G N+    T         I  +D++     + D+               K  +  + L+ +  TK      Y IVI A D+G    S+K  + + +L   +  P F + + S+  +   V+P    G  I ++ A    +G   ++ Y+  +     D   ++P SG +S+ Q   +      Y + +   D   P L     + + +   N ++ + ++  +  N E   EES
Sbjct: 2128 PRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFISANE--TAIMENVAINTVVIAVKAVDNDEGRNGYIDY-LMKEARDEDMG---QSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRY---SIVLGDQNHDFSISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDNRPTFLDSPYL----ARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDSDLF---RIN---ASSGDIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLLGEHMHRFHIDSETGEISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYT---------ISGRDQH-----YFDINT-------------KTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTV-ILRPPELFPTFAYMANSHFAMSEDVRP----GKMITKVSATSPKKGLVGKIRYAI-AGGIMGDSLRVDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQ--LIYNAEVLEEES 2824          

HSP 3 Score: 195.667 bits (496), Expect = 5.542e-50
Identity = 200/735 (27.21%), Postives = 315/735 (42.86%), Query Frame = 3
Query:  399 FEINPLNGVITIER--RIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNG-ISYYSISPEITEFELSYIINTNT-MMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCT----------------------VIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANE--EFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTS-GSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSI-FGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPK-SIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKL-IIRESGLDREVTTKYEIVIEATDRGNPPK---STKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISL 2498
            F I P+ GV+ ++R  R +  +L H+             L  T       S  + L + + D+ND++P +      T   E +++        A D D G NG ISY              II  NT  M+       L ++  LDRE+ D Y   V+  D G PS +  + V++ V DENDN+P F  + +  S+ EN  ++T V +L A+D D   N ++ + +SS T+      F+I++ +G+I      D E    +S   EA+      RGS                         V + + D+NDN+PE    P   T    I+E  + G  +     QD D   NG V   L    NE  +F+L+      +   ++S  +  DRE +      +V  D       +S  S+++ V D ND AP F++ S    V E    GT L    A+D D+G+N+ + +SI  G     F I+ + G ++L   LD E + S      A+D G P   +T    V+V D NDN P  P  +I   + E      P+V V   D D GLN +    +         K++ + P  + F   T++           G +  +RE  +DRE    + + + ATDR  P +   ST+ ++ + V D+ND  P F+  + +    K      S T + Q+ A D D   N  + Y   S  Q  +LF +   +G I+ 
Sbjct:  992 FRIGPVTGVLYLQRPIRAEPGSLIHV------------ELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYE-------------IIEGNTERMFGVFPDGYLFVRAPLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQTQD-----FTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVT----ISEGASEGTHITHVFTQDADEGLNGDVYYSLAK-GNEAGQFNLD------SATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAIS--------KQEPQLPQGRHFGINTET-----------GVIHTLRE--IDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVSGPQ--ELFKLQRNTGIITF 1662          

HSP 4 Score: 176.792 bits (447), Expect = 3.961e-44
Identity = 178/698 (25.50%), Postives = 305/698 (43.70%), Query Frame = 3
Query:  558 LVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYI----ISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWE-LDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLYVLENHTADVPLV-QVNVTDAD-EGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESINGDS 2630
            L I V D+NDN P +          E    G+      ALD D G N + +Y+IS     +   + INT T + S K +LK   K   D      Y  +++A D G  S +   ++ V +        +F    Y+     +++E+++    + ++ A      + GKI Y I+     +  +   ++ NSG + V  + LDYE      + +EA D       S   + +N+ D NDN+P +     +   NA++ E E+P +L+AV    D+DS +NG V   L+   +  F +       T   +I T    DRE+       +   D+G P  T + SV + + D ND  P F+ + +  +V E+ + G+++  + ++D D G NA  SYS      + F I    G + +   LDRE  +       A+D  +  +     IT+ ++D NDN P    S Y +        + LV Q+  TD D +G NS    +L   +    I    +    ++F      F +S +   P+                 Y + + ATD G PP  ++ ++ IN++D ++  PKF     +     +    V G  I ++ A D+ +   +E++YS  + N ++ +F +    G I+L + IQ       Y L+V   D G+P   D  R+ I++   N D+
Sbjct: 2582 LTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTISGRDQHY---FDINTKTGVVSTKLELKTKTKSHDDL----TYTIVISAMDQGEQSLSSKAELTVILRPPE----LFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGDSLR---VDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVM----EQLIYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRLQNDFDGTFEI-------TESGEIYTRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFT-RLFSLNVTENAEIGSFVIRVTSSDLDLGANANASYSFSENPGEKFRIEPQSGNITVAGHLDREQQDEYILKVVASDGAWRAETP---ITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSLQQPSPMFSI----DPATGEVFSKKAVRFKHSQYVRSPE---------------NMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKF---EQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMTFNLSS-IFSVGRHDGWITLVKPIQVPPNT-RYELVVRATDRGVPPQSDETRVVIVVTGENMDT 3226          

HSP 5 Score: 176.022 bits (445), Expect = 7.638e-44
Identity = 191/800 (23.88%), Postives = 343/800 (42.88%), Query Frame = 3
Query:  396 YFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDD-----FSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITE-FELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPS-FNGSIKVIVAVTDENDNSPVFEKAVYI---------ISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVR--------WELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRD----LNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLE--PIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGS------VSVGVEDINDEAPHFS---EKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLYVL-ENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQ-----TNDLFL--MNP----------ESGKISLQQTIQESHKVCCYVLI-VVVKDNGIPRLEDTARLRIIIESIN 2621
            +F ++PL G+I     +DR+               +  ++L+I + D      F++  + VI + D ND +P +SQ E      E +      +L  A D+D GTNG   ++++P +   + L + ++  T   + +  L        DREK+ +YE  V A D G P+  + +  V + V D NDN P F    YI         I + + ++    ++ + A D D   N  IEY++ S  +     LF +++ SG I +R        W+  Y+      L+V A D G  R      V I ++     L     +      +   + +   N  P + V +  V+    + NGK   H+E   I  +     R++   T   +I+T +  DRE+++     I+     +     S        V++ + D+ND AP F+   E      + E+   G  ++     D+D G+N+ +SYS+     + F I  + G ++L+  +  E    +H    A D+G P   S  +++V++ D+ND+ P    + Y   L E    +     +  TD D G N                         ++  ++ +  +  +F + PDG L +R + LDRE    Y + +   D G P +S+   + I+V+D ND  P+F   + S  T  +     + T + ++ A+D D G+N+EL ++  S  Q     T + F+  + P           + + S +           Y+L+   V DNGIPRL+D  ++++I+  +N
Sbjct:  541 WFSMDPLTGLIVTTGPLDREI--------------RDTVELSISARDGGPNPKFAYTQLKVI-ILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRRPL--------DREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESGGE----GLFQLDARSGAISLRGDAPASMHWKPHYK------LLVSARDAGQRRSQQDAIVEIVLKSKLEMLECGQAQAGGYEFQMVEDHEQQRNSQPNREVGIVQVK----STNGKANSHIEYDIIQGDRAQNFRID---TRSGRITTARPLDREEQANYRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLTNNPNQQFRIGPVTGVLYLQRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNG------------------------RISYEIIEGNTERMFGVFPDGYLFVR-APLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQF---TNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVN 1272          

HSP 6 Score: 169.474 bits (428), Expect = 7.410e-42
Identity = 190/702 (27.07%), Postives = 306/702 (43.59%), Query Frame = 3
Query:  540 FSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSIS---PEITEFELSYIINTNT-MMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPS---FNGSIKVIVAVTDENDNSPVF---EKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEAND--MGNLRRGSTCTV-IINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEF-----------SLERMNIPLTVMYKISTLKSFDRE---QKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLY-VLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKD 2561
             S  ++  + V D NDN P +    +V Q  EG  +        A D D G NG   Y+IS   P++ +    + INT T ++++ +E         +DRE ID +   V A D   PS    +    V V V D NDN+PVF     A+     + +  S+T V+Q+ A DADS  NG + Y+I  ++ P+  +LF ++ N+G I       ++      L +++ D  + + RR S   + II        S    FE  R   +  + ENE  G  +               VT HL     E F            ++R+      +  +ST    DRE   ++ +V  + +    G PR T+   V V V D ND  P F +  ++++V+ED++ G  + T+ A D D  + ++    + G D K F +    GK+ L   LDRE+        R +D     Q + A  T+ V D NDN P    ++Y + + EN      + Q+   DAD G N++    +VS+                        ++N +FSL P   ++   + LD E    Y ++++A D G P  ST   +Y NVLD+ND  P F   S S+   +  P     T +  + A D D G N  +EYS  + +  ++  + +  +G I  ++ +   H+   Y L V  +D
Sbjct: 1469 LSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGR-HFGINTETGVIHTLRE---------IDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEI--VSGPQ--ELFKLQRNTGIITFTPGPQFKQEVRYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQFE-QRSKLSGSVYENEPIGTSILT-------------VTAHLASAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALG-GQPR-TSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPDT-LGSVTFLLMDGHDGK-FLLEPSTGKLILNDTLDRETKSKYELRIRVSDG---VQYTEAYATIQVSDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSD------------------------WANDVFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSEVFENVP---IATEVVTVSAKDIDSGNNGLIEYSITAGDVDSEFGIDS--NGTIRTRRNLDREHR-STYTLTVTARD 2105          

HSP 7 Score: 167.162 bits (422), Expect = 3.962e-41
Identity = 201/758 (26.52%), Postives = 324/758 (42.74%), Query Frame = 3
Query:  399 FEINPLNGVITIERRIDRDN--LCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIV----LVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEY--AKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCT---VIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLT----------VMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYI-FHVNEDVKPGTYLFTINA----TDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRES-VESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPD-GKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDT 2588
            F ++   G +++ RR+DR++  + HL+                +  D    H +     + I V D NDN+P ++Q+       E S  G       A D D G N    +SIS      +  +I +    +Y +K          LD E I  Y   + A D G PS + ++   V V D+NDN P+F     +  + E +   TP++ + A D DS +NGK+ Y IS   +P+    + F I + +G IH   E+D E+  T  L V A D          T   V + + D+NDN+P ++   +      K + ++     V     +D DS+ NG VT  +     E F L+R    +T          V Y++ TLKS D   +S+  +  V      P   + GS S          P F ++S +   V E+   GT + T+ A     + +  +  + +    G+  ++F I+   G +    +LDRE+  E       A   G   + S   + V V D ND+ P    + ++Y   N + D+ +               T  TL +    TL        +  L  D      +  F L P  GKLI+ ++ LDRE  +KYE+ I  +D     + T+    I V D ND  P F     +  +  +      G  + QI+A D D G+N++L Y   S+   ND+F +NP++G ++L   + +  +V  Y+LIV  +DNG P L  T
Sbjct: 1326 FNLDSATGQLSLGRRLDRESQEIHHLI---------------VVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAG-NRRDTFHIDSITGSLYLHKP---------LDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISK-QEPQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAP-VFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVSGPQELFKLQRNTGIITFTPGPQFKQEVRYQL-TLKSTDEAVQSERRSSEVYITIITP--GSGGSES--------SVPQFEQRSKLSGSVYENEPIGTSILTVTAHLASAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVY---NVSEDLQI-------------GHTISTLRAHDPDTLGS------VTFLLMD----GHDGKFLLEPSTGKLILNDT-LDRETKSKYELRIRVSDG---VQYTEAYATIQVSDTNDNPPLF---EDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSD-WANDVFSLNPQTGMLTLTARL-DYEEVQHYILIVQAQDNGQPSLSTT 2010          

HSP 8 Score: 146.362 bits (368), Expect = 7.951e-35
Identity = 166/624 (26.60%), Postives = 271/624 (43.43%), Query Frame = 3
Query:  564 IEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALD-NDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEE--FSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQT--TSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGK-DAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNS 2417
            I + D ++N P + Q E +    + +  G       A D  D GTN + Y      +  F LS I +        +    + L K +      +YE +V A D G P  +   +V++ VT EN ++P F    Y + V EN    + ++ + A D D+  NG + Y IS   +    + FS++  +G I ++ +LDY+      L +   D+G     S   + I + D+NDN P   F    +  +  I EN+  G  V      DKDS +N  +     P   +   F + + N        IS+  SFD E++   T  I      NP  +  +  ++ V V  +N+  P F +  + F V+E    GT +  + ATDKD G +  + Y + G  + K F I+   G +++   LDRE+   +  T  A + G  +   T    VI+   + N P  P+ I  Y     +   P+               TKVT V      +  + +++    +  ++ +SF   + +    G+ I   S LDRE T+ Y +VI A D G PP++    ++I + DVND  P F  P G N    +     +GT+I  +IA D D  +N 
Sbjct: 3112 INIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTNEMDY-----SLMTFNLSSIFSVG------RHDGWITLVKPIQVPPNTRYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNE---RQDFSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPP--VFNHKEY--HCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSN------GTISSAVSFDYEERRIYTLQIKA---KNPDSSMESYANLYVHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKGFRIDTNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGNDP--PEFIKHYYTSTISEAAPV--------------GTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQT----GE-ISTASRLDREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTFT-PEGLNG--YISENEPAGTSIMTLIASDPDLPRNG 3684          

HSP 9 Score: 145.206 bits (365), Expect = 2.072e-34
Identity = 184/711 (25.88%), Postives = 310/711 (43.60%), Query Frame = 3
Query:  558 LVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEM-NGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTI-------SLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKD---SNEN--GKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKI-FSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGI--IYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSF--KSNNQTNDLFLMNPESGKISLQQTI--QESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESINGD 2627
            +++ + D NDN P +++       +E +EIG       + D D G N  + YS S            N         +   + +   LDRE+ D+Y   V A DG   ++     + + + D+NDN+P FE + Y  S  E  QS   V Q+ A D D +  N  I Y   SL +P  + +FSI+  +G +  +  + ++    +       +L V A D G     S C V INI D ++N P+  FE + +   A + ++   G+ +      DK    +NE     +T +L  I    FS+ R +  +T++  I    +   E   + T      D G P Q+    V + V   N + P FS  SY   V E+   G+ + T+ ATD D G N +L YSI G + +  FS+++  G + ++  LD + ++  H      D GY    S A +T+I+ D+NDN P F  K  + Y+ EN      + Q +  D D   N+      +              P +  F  +    + ++ S +            D E    Y + I+A    NP  S +    +Y++VL VN+  P+F+ P        V   +  GT +  + A D+D G++  + Y     SN++    F ++  +G I + + +  +  ++V   VL V+ K+ G  R  DT   ++II   +G+
Sbjct: 2899 VLLHLLDKNDNPPKFTR-LFSLNVTENAEIGSFVIRVTSSDLDLGANANASYSFSE-----------NPGEKFRIEPQSGNITVAGHLDREQQDEYILKVVASDG---AWRAETPITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISY---SLQQP--SPMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPK--FEQAEYL--APLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMTFNLSSI----FSVGRHDGWITLVKPIQVPPNTRYELVVRAT------DRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNERQDFSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSG-----------PDRHFF--IMNQSNGTISSAV----------SFDYEERRIYTLQIKAK---NPDSSMESYANLYVHVLGVNEFYPQFLQPV---FHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKG---FRIDTNTGLIYVARHLDRETQNRV---VLTVMAKNYGSIRGNDTDEAQVIISIQDGN 3540          

HSP 10 Score: 141.739 bits (356), Expect = 2.338e-33
Identity = 206/777 (26.51%), Postives = 329/777 (42.34%), Query Frame = 3
Query:  396 YFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSP-FWSQNELVTQFSEGSEIGDSKSLTV--ALDNDFGTNGISYYSISPEITE-FELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNS-----PVFEKAVYII-SVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLT----KPEYAKLFSIESNSGYIHVRWELDYETYT-TISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAK-IFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNS--ETKVTL--------VSETATTLIKR------KDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSN-----NQTNDL-FLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIII 2609
            +F IN   GVI   R IDR+++     T       Q        S+   S   ++ + V+DINDN+P F S N  +      +  G S ++    A D D  +NG+  Y I     E F+L    NT  + ++   Q          ++++ +Y+  + + D    S   S +V + +            P FE+   +  SV EN    T ++ + A  A +E    IEY ++++T    + +  +LF I++  G +    ELD E       + V A  +G   R S   V + + D ND+ P+    P  F  N  ++E+   G  ++     D D+   G VT  L    + +F LE    P T   K+    + DRE KSK    I   D     Q T    ++ V D ND  P F +  Y F + E+ + G  +  I A D D G NA LSY +    A  +FS+N   G + L   LD E V+      +A D+G P   +T  +   V D+NDN P F P S    V EN      +V V+  D D G N   E  +T         +    T   +R      +  Y +    RD    F++  FS L + +L ++     +   T+ E +     +     S+   + I + DVND  P FI    +N T  ++   ++   IA + A+D DEG+N  ++Y  K        Q++ L F +NP  G++ +   +    +   Y+L +  +D G P     ++L I I
Sbjct: 1540 HFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQ-------PSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVSGPQELFKLQR--NTGIITFTPGPQF---------KQEV-RYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQFEQRSKLSGSVYENEPIGTSILTVTAHLASAE----IEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTP--FVYN--VSEDLQIGHTISTLRAHDPDT--LGSVTFLLMDGHDGKFLLE----PST--GKLILNDTLDRETKSKYELRIRVSDG---VQYTEAYATIQVSDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWANDVFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGDVDSEFGIDSNGTIRTRRNLDREHRSTYTLTVTARDCADEFAS--FSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQR---LSSTVKVTILIKDVNDEVPVFI---SANETAIMENVAINTVVIA-VKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALDRELR-SSYLLNITARDRGEPPQSTESQLLIRI 2268          

HSP 11 Score: 138.272 bits (347), Expect = 2.401e-32
Identity = 151/532 (28.38%), Postives = 230/532 (43.23%), Query Frame = 3
Query:  399 FEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIK--SDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNP--SFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGST--CTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKI-------STLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGIN-ALLSYS-IFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLYV 1949
            F ++   G I I++++D D +             + +L++T++       S + +L I + D+NDN P ++  E      E   +G       A D D   N I +Y+  P   +    +I+N +    S+            D E+   Y   + A    NP  S      + V V   N+  P F + V+   V+E     T V  ++A D DS  +G++ Y    L      K F I++N+G I+V   LD ET   + L V A + G++R   T    VII+I+D ND  PE  F    +T  + I+E    G  V      DKD               N +FS   +N  L   +KI       ST    DRE+ S     I   D G P QT S +V + +ED+ND  P F+ +    +++E+   GT + T+ A+D D   N    +Y  I GK     S+++  G V   T  DRE    L       DSG PKQ S   +T+ V D NDN P   +S+++ V
Sbjct: 3277 FSVDERTGGIVIQQQLDYDLI------------QEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHF-FIMNQSNGTISSA--------VSFDYEERRIYTLQIKA---KNPDSSMESYANLYVHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYL---LVGSSNDKGFRIDTNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGND-PPE--FIKHYYT--STISEAAPVGTKVTTVKAIDKDVRTQ-----------NNQFSYSIINGNLKQSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTFTPEGLNGYISENEPAGTSIMTLIASDPDLPRNGGPFTYQLIGGKHKSWLSVDRNSGVVRSTTSFDREMTPILEAIIEVEDSGKPKQKSQHLLTITVLDQNDN-PSTTRSLHIAV 3764          

HSP 12 Score: 128.257 bits (321), Expect = 3.142e-29
Identity = 175/757 (23.12%), Postives = 315/757 (41.61%), Query Frame = 3
Query:  399 FEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDND-FGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAK---ITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANE--EFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIF--GKDAKIFSINKLDGKVFLETDLDRES--VESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATD----RGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDED-EGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESIN 2621
            F I P +G IT+   +DR+            + ++  L + + SD  +     + I ++D NDN+P +  +     F E  +        +A D D  G N +  YS+      F    I      ++S K       +     E +  Y   V A D G P       V + + D ++N P FE+A Y+  + ++      ++++ A D       +++Y   SL     + +FS+  + G+I +   +     T   L+V A D G   +     V+I +   N ++P       RF+ N+    + ENE  G  +      D D+  NG +   +    NE  +FS++     + +  ++     +D  Q+  +  +I   D G    ++   +++ + D+ND  P F+ K Y  ++ E+   GT++F  +A DKD   NA++ Y+    G D   F +N+ +G +      D E   + +L    +  DS      S AN+ V V  +N+ +P FL    +  V E       +  V  TD D G +      LV  +              K FR  T +             LI     LDRE   +  + + A +    RGN   + +  + I++ D ND  P+FI    +++  +  P    GT +  + AID+D   +N++  YS  + N     F ++ ++G+IS    + +  +   Y L++   D G+P    +A + I +E +N
Sbjct: 2959 FRIEPQSGNITVAGHLDRE------------QQDEYILKV-VASDGAWRAETPITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSLQQPSPMFS---IDPATGEVFSKKAVRFKHSQYVRSPENM--YALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTNEMDY---SLMTFNLSSIFSVGRHDGWITLVKPIQVPPNTRYELVVRATDRGVPPQSDETRVVIVVTGENMDTP-------RFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISG-GNERQDFSVDERTGGIVIQQQL----DYDLIQEYHL--NITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAKNPDS---SMESYANLYVHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSN------------DKGFRIDTNT------------GLIYVARHLDRETQNRVVLTVMAKNYGSIRGN--DTDEAQVIISIQDGND-PPEFIKHYYTSTISEAAP---VGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQS-FKIDVQTGEISTASRL-DREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVN 3645          

HSP 13 Score: 93.9745 bits (232), Expect = 7.737e-19
Identity = 99/374 (26.47%), Postives = 141/374 (37.70%), Query Frame = 3
Query: 1569 VSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALL-SYSIFGKDA----KIFSINKLDGK---VFLET--DLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLYVL-ENHTADVPLVQVNVTDADEGLNS---------ETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKF---IFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESIN 2621
            V + V D+ND +P F E S     +E    GT L    ATD D G N +   Y I   +     ++ +     G    + LET  +LDRES  S      A D G P +     + V + D+NDN P    S Y   L E      P+V V  +D D G NS         E + T+  ET       +   P Q   +  + S  + +F++                          A D G+P +  +  + +N+LD ND  P      FP G      V    V+GT +A +   D D G N        S N+     L       I     + +  ++  Y L VV  D G P    TA L I +  +N
Sbjct:  142 VRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLAETEHQFTVNPETGVISTTERVNCPQQTNVKS-SASQKSCVFTVF-------------------------ARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGK-VATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLEEAADLHIVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVN 488          
BLAST of Protocadherin-1 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0078045)

HSP 1 Score: 243.432 bits (620), Expect = 5.511e-65
Identity = 195/657 (29.68%), Postives = 311/657 (47.34%), Query Frame = 3
Query:  552 IVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSI-SPEITE-FELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDS-NENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIF---GKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIY-LYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRT---VSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKI 2492
            I +++ VKD NDN+P + Q  +  +F E +     ++L  A D D        Y+I S  + + F LS     + ++Y + +     +   LDRE    Y  ++ A DGG P   G + V + + D NDN P+F ++ Y  +V EN    T V+Q+ A D D++ NG +EY I+   + +  ++F I+  +G I++   LD+ET     L+V A D G     +T  V I + D+NDN P I         + KI+E+  PG+ VA  SV D DS  E   V   L    +  F+L   +     +Y +      DRE  S  T  +V  D+G P    S S+ + + D+ND  P F +  Y  +V E   PGT +  + A D+DEG+N+ L+YS+       A+ F I+   G +   + +D E+      T  A D G P   STA + V + D+NDN P   +S Y + V EN      +++V+ +D D G+N+                    Y I + F+ +T+      F +      I     LD E  + YE  + ATDRG    ST  +I + + DVND +P F +P     +++  P+     S T I  ++A D D G   ++ Y   + N+   +F ++  +G+I
Sbjct:  158 IRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQ-----ISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINR-RQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNG-GDGHFALTTRD---NSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVN-----------------YTIGEGFKHLTE------FEVRSASGEICIAGELDFERRSSYEFPVLATDRGG--LSTTAMIKMQLTDVNDNRPVF-YPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAG-IFRIDRSTGEI 777          

HSP 2 Score: 239.195 bits (609), Expect = 1.177e-63
Identity = 224/768 (29.17%), Postives = 352/768 (45.83%), Query Frame = 3
Query:  396 YFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQI---------SSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSE-KSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIF-GKDAK---IFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRK-DEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDR--GNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSF--------KSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKD---NGIPRLED--TARLRII 2606
            YF I   +G I I + +D +           K     N+  T+     + H  V  IEV+D+NDN+P +  + +     E +E+G       A D D G++G   YS+  E  +   +    +  ++ S            LD E   ++  IV A DGG PS + ++ ++V V D NDN PVFEK  Y ++V+E+   N  +IQ+ A D D+  N +I Y+I         +S++  + ++ F I  NSG+I++R  LD ET     L V A D G     +   VI+ + D NDN P+  F+ S++    +I EN   G +V V +  D D  EN  +   L PI N  F +     P+T   +IST +  DRE +      +   D+G P ++    V + V D+ND AP  ++ +  +  V E+  PGT +  + A D+D G NA ++YSI  G+D+    +FSI+   G +     LD E          A+D G P + +   + V V D+NDN P F   S+   V E    D  L  V        + S + +   ++     ++   ++  +      +TK    + F +      ++    LDREV +++ + I A D    N P+S+   + I V DVND  P++         ++V   T  GT I    A D D G N +L+Y          +S  Q   LF M+  +G +SLQ  + +   V  Y+LIV   D   N   RL+   T RLRI+
Sbjct:  874 YFSIETNSGNIRIAKPLDHE----------AKSQVLLNIQATLGEPPVYGHTQV-NIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQH----------LDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPK--FQKSKY--EFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPI-NSSFQVH----PVT--GEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVRE----DAALGHV--------VGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEW---PQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPL-DFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRIL 1593          

HSP 3 Score: 201.83 bits (512), Expect = 7.434e-52
Identity = 201/723 (27.80%), Postives = 311/723 (43.02%), Query Frame = 3
Query:  540 FSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLT-----VALDNDFGTNGISYYSI--SPEITEFELSY----IINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEE-FSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIF--GKDAKIFSINKLD-----------GKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLYVLENHTADVPLVQ-VNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLP-DGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTN--DLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESIN 2621
             S   ++ +++ D+NDN P +   E      E  +     S T     VA D D+G  G   Y I    E   F +      I      M S + Q                +   ++A DGGN   N    V +++ D     P+FEKA Y   V E++   T V  + A   D      + Y I S     Y   FSIE+NSG I +   LD+E  + + L ++A  +G         V I + D+NDN+PE  FE S       + E+   G  +      DKDS  +G+VT  L   + +  F+++  +  L +       +  D E   + T  +   D G P  +T+ ++ V V+D+ND  P F +  Y  +V+E       +  +NA+D D G NA ++Y I   G D    SI+  D           G ++L   LDRE+ +    T  A D+G P   +   + V V D NDN P   KS Y + +E +     +V  V  +D D G N+  + +L+              PI            NS F + P  G++  RE  LDRE+   Y++V+EA D+G P +S +  + I+V DVND  P+   P      V V+     GT + ++ A+D D G+N+ + YS      ++   LF ++P SG I  +  +    +   Y L V   D G P  E    LR+ +  +N
Sbjct:  695 LSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPM--------------HMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGY---FSIETNSGNIRIAKPLDHEAKSQVLLNIQAT-LGEPPVYGHTQVNIEVEDVNDNAPE--FEASMV--RISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILS------QHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLL--------------PI------------NSSFQVHPVTGEISTREP-LDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADP--QEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEER-SIYRLGVAASDGGNPPRETVRMLRVEVLDLN 1359          

HSP 4 Score: 181.03 bits (458), Expect = 2.019e-45
Identity = 184/725 (25.38%), Postives = 306/725 (42.21%), Query Frame = 3
Query:  558 LVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFT--NNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAK-IFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKS---NNQTNDL--------FLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESINGDSILSKENKMKDNVEYSNEES 2687
            + + + D+NDN P + Q+       E ++ G S    +A D D G N    YS++         + I+  T + + +  +        D E     +  V A DGG P  + +  V+V + D NDN P+F+++ Y +SV EN      ++++ A D D  +N  + Y I    K  +   F + S SG I +  ELD+E  ++    V A D G L   +T  + + + D+NDN P  Y    + +   + K +   +   +VAV +  D D    G+V+  +  +A  E  + R++     ++ +       R Q   +  +I   D GN R      V + + D     P F +  Y ++V ED+  GT + ++ A   D    + + YSI+  D    FSI    G + +   LD E+   +    +A   G P       + + V+D+NDN P F    + + V E+     PL   +  D D G + +   +LV E+                           LF++      +I    LD E + ++ +++ ATD G P  ST   I ++V DVND  P F        +V V         I Q+ A D D G N+ + Y       +N TN +        F + P SG I L+  +    +   Y L V+  DNG P     A+ R+I+  ++ +    K  K K   E+  EE+
Sbjct:  490 IFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHI--------DCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFK--HLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGL--STTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVAT-DPDYGNFGQVSYRI--VAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHML-NISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQAT-LGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESG------------------------KGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVF---EKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRD-RYQLTVLATDNGTPAAH--AKTRVIVRVLDANDNDPKFQKSK--YEFRIEEN 1165          

HSP 5 Score: 176.792 bits (447), Expect = 3.842e-44
Identity = 186/690 (26.96%), Postives = 306/690 (44.35%), Query Frame = 3
Query:  552 IVLVIEVKDINDNSPFW-----SQNELVTQF-SEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPS-FNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIV---EAN--------------------DMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLE--PIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSG-SVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSG-YPKQLSTANITVIVKDINDNFPFLPKSIYLYVLENHTADVP---LVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKV--KPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQ 2504
            + + + + D ND++P +     S  +  + F S+ + IG+  +  VA+D D G NG   Y I+      E  + IN+ T +    E +K +     D EK  ++  I+ A D G P     S+ + + V   ++N P F +AVY  ++ EN+ S + V+Q+ A       N  + Y+I +    +   LF ++   G I  R + D E+  +  L V   +AN                    D  N +     T+ I + D+NDNSPE  F P        + EN  PG +  V +  D D   N  +   +    + N+ FS++  +  L+        +  DREQ S+ T  I   D G P+      ++++ VED ND AP F    Y   V ED   GT +  I+A D D G+NA L YS+  +    F+I+   G +     LDRE   S +F   A D G Y  + +T  + + V DINDN P   +  Y Y+ +      P   L++V   DAD G N+E   +L +E +    K                      F + P    +     L  E      + + A D+GNPP+S+ G+I + + +     P   F    N T +V  K  + SGT + Q++A+  D G+  ++++SF + N+ + +  ++  SG+I + +
Sbjct: 1586 VTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITG--GNGEGRFRINSQTGII---ELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVAND---LFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPE--FRPGS-CYGLSVPENSEPGVIHTVVA-SDLDEGPNADLIYSITGGNLGNK-FSIDSSSGELSA-------RPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFER--YPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAK----------------------FRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRF---QNETYRVMLKENSPSGTRLLQVVALRSD-GRRQKVQFSFGAGNE-DGILSLDSLSGEIRVNK 2226          

HSP 6 Score: 155.606 bits (392), Expect = 1.215e-37
Identity = 169/613 (27.57%), Postives = 258/613 (42.09%), Query Frame = 3
Query:  822 DREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWE----LDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPH----FSEKSYIFHVNEDVKPGTYLFTINATDKDEGIN-ALLSYSIFGKDAKIFSINKLDGKVFL---ETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIY-LYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESIN 2621
            DRE    Y  +     G N      I+V+V V DENDN+P F +    I   EN         L A D D E      Y I S    +  +L S     G +++  +    LD ET    SL++EA D G        TV I I+D+NDN P   F  SR+   A + EN   G  V      D D++ENG V   +    +++  + R++ P T    I+  K+ D E K      +V  D G     T+  VS+ V D+ND  P     F        ++E  +PG ++  I+  D D     A ++ ++ G D   F++   D  ++L      LDRE V +   +  A D G P   ++ +I + + D+NDN P   + +Y   V+E       ++QV   D DEGLNS    +L +ET  T                         F + P   LI   S +D E     ++ + A D G PP S+   + + + DVND +P F     S   V V      G  I ++ A D D G N+ + Y+     +    F +   SG+I +   + +  +   Y   V+  D G   L  TA +++ +  +N
Sbjct:  139 DRETRASYSLVAIPLSGRN------IRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQP--IFNQSRYF--ATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRID-PRTGAIYIN--KALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGH-FALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSL-AETPET---------------------HAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIF---DQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGEL-DFERRSSYEFPVLATDRG--GLSTTAMIKMQLTDVN 709          

HSP 7 Score: 144.05 bits (362), Expect = 3.762e-34
Identity = 205/800 (25.62%), Postives = 329/800 (41.12%), Query Frame = 3
Query:  399 FEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHI----IVLVIEVKDINDNSP-FWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNG-ISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAID--ADSEMNG--------KIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDM--GNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLE---PIANEE----FSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGN---PRQTTSGSVSVGVEDINDEAPHFSE------KSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAK-IFSINKLDGKVFLETDL-----DRESVESLHFTTRAADSGYPK-QLSTANITVIVKDINDNFPFLPKSIY-LYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPR-LEDTARLRIIIESINGDSILSKENKMKDNVE 2669
            F+++P+ G I+    +DR+ L  L              DL +++ D  + +    + + I V D+NDN+P      E V    E    G       A+D D G N  I+Y  +    ++    + I+  + +   +          LD E+   Y   V A DGGNP       + V V D NDN P F  +  +  V E+      V  +  I+  AD   N         ++ Y ++ LTK      F I+ +SG + V   LD E  +   L + A D    N  + S  TV I + D+NDN+PE   +P     + +++E    G ++  F+  D D+  NG +   L    P  NE      SL RM+   ++   +S     D E   +    +   D+ +    R  TS +V + + D ND APHF        K+    +++  + G  +  I A D+D G N  L+Y I G + +  F IN   G + L   L     D E     +    A D G P+ + S+ N+ +IV+  ++N P   +++Y   +LEN  +   ++QV         N+     + +  A  L     +  I    R      S + + L    +   R+S L      K        D  N        IYI V DVND  P+  F  GS   + V P       I  ++A D DEG N++L YS    N  N  F ++  SG++S +   +E H    Y L +   D G P+  +    + I +E  N ++   K +K   +V+
Sbjct: 1199 FQVHPVTGEISTREPLDRE-LREL-------------YDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTR--------VVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPI----DLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMD---SLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITT-RGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPE--FRPGSCYGLSV-PENSEPGVIHTVVASDLDEGPNADLIYSITGGNLGNK-FSIDSSSGELSARPLDREQHSR--YTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQ 1962          

HSP 8 Score: 142.51 bits (358), Expect = 1.086e-33
Identity = 188/753 (24.97%), Postives = 319/753 (42.36%), Query Frame = 3
Query:  558 LVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSF-NGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPG-KLVAVFSVQDKD-----------SNENGKVTCHLEPIANE-------EFSLERMNIPL---------------------------TVMYKISTLKSF--DREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIF-GKDAKIFSIN-KLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYP--IQKLFRDVTKSFSN-SLFSL-LPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDED-----------EGKNSELEYSFKSNNQTNDLFLMNPESGKIS-----LQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRI 2603
            + I V+D NDN+P +  ++      E + +G S     A+D D G N    YS++ E T+++ +    +  +    K          LDRE    Y F+V A DGG     + ++ V + V D NDN P+FE+  YI  V   +Q    +++++A+DAD   N +I Y +++      AK F I  ++G +     L  E+   + L V A D GN  + S   + + I +    +P + F+    T    + EN   G +L+ V +++               NE+G ++  L+ ++ E           +R + P                            T   +  T  SF     Q +++   +V      P   +   + + +ED ND +P FS+K ++  V+E    GT++  ++A D D G NA L Y I  G     F I     G V     LDRE  +       A D G P+   TA I V + D+NDN P  P               P   V V++A     +E    + S +A  +    D YP    +L  + T    N S+F+L    GKL+++   LD E+  +YE+ + A+D  +  ++   ++ + V D ND  P F+      +   + P     + I++ +++D D           EG NS++ Y  +   +    F ++P +G +S     LQ  +  S     Y + ++ KD G P L+ +  LR+
Sbjct: 1938 ITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANE-TQWQFAIDGQSGLITTVGK----------LDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAK-FRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNE--TYRVMLKENSPSGTRLLQVVALRSDGRRQKVQFSFGAGNEDGILS--LDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFP---------------PNNLVTVSEA-----TELGAVITSISANDV----DTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRR-LDYELQQEYELDVIASDAAHEART---VLTVRVNDENDNAPVFL-AQQPPAYFAILPAI---SEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEG---FSVHPSNGVVSVNMSRLQPAVSSSGD---YFVRIIAKDAGKPALKSSTLLRV 2636          

HSP 9 Score: 115.931 bits (289), Expect = 1.689e-25
Identity = 160/673 (23.77%), Postives = 274/673 (40.71%), Query Frame = 3
Query:  558 LVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSI------SPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFE--PSRFTNNAKITE-NEAPGKLVAVFSVQDKDSNE---NGKVTCHLEPIANEEFSLERMNIPLTV-MYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYP------KQLSTANITVIVKDINDNFPFLPKSIYLYVLENHTADV--PLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSL-LPDGKLIIRESGLDREVTTK-YEIVIEATDRGNP-PKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSF---KSNNQTNDLFLMNPESGKIS 2495
            LVIE++D NDNSP +SQ + V   SEG+  G   +   A D+D G+N    Y I      +  + E   S I+ TN ++               DRE  D Y+  + A D G P   G+  + V + D NDN P F     +++V+E  +    +  + A D D+           S    E   +F+++  SG + ++  LDYE      L V A+D  +  R     + + + D NDN+P    +  P+ F     I+E +E+      + +V   D++    N KV   +EP A E FS+   N  ++V M ++    S            I+  D G P   +S  + V   D       F +  Y   ++E    G+ +  +     D+ +       I G +   F + +    V ++  LDRE  +        +    P         S  ++ + + D NDNFP   +S       +  A +   + Q+   DAD+                      +  P  ++  D+T      +F++ L  G L +    LD +   K YE++I A D  +  P  +     + + D ND +PKF      +   + +P    G+++ +  A D D+G   +L YS     S+  +  +F ++ ESG ++
Sbjct: 2308 LVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVL---------------DREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPN-NLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEAR---TVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEP-AQEGFSVHPSNGVVSVNMSRLQPAVS----SSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAI-----IAGNEESAFELLQSKAIVLVKP-LDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQ----------------------ENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNR-LDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEP---VGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVT 2924          

HSP 10 Score: 95.5153 bits (236), Expect = 2.916e-19
Identity = 143/586 (24.40%), Postives = 237/586 (40.44%), Query Frame = 3
Query:  879 PSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIE-SNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMY--KISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAP---------HFSEKSYIFHVNEDVKPGTYLFTINATDKD-EGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESL-HFTTR--AADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPP------KSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGK--NSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDN 2564
            P      ++++ + DENDNSP F +  ++ +V+E     T V Q+ A D+D+  N ++ Y I       +   F IE + SG +     LD E      L + A D G  +   T T+ + I D+NDN P        F  N  +T +EA      + S+   D +    +T  L   A     +E M+I     Y  K+   +  D E + +    ++  D  +  +T    ++V V D ND AP         +F+    I  ++E +     L T+NATD D EG N+ + Y I     + FS++  +G V +     + +V S   +  R  A D+G P   S+   T++    NDN     + +        +   PL  V +    + L+    +   +E                           S F LL   K I+    LDRE    Y++ +  +    PP       S+   + I +LD ND  P  IF   +    ++        +IAQ+ AID D+    NSE+ Y   S N  + +F ++  +G + +   +        Y LI+   D+
Sbjct: 2300 PFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHI---VDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPT-------FPPNNLVTVSEATELGAVITSISANDVDTYPALTYRLG--AESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTV---LTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIY-IIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSS---TLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGNE--------------------------ESAFELL-QSKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFP--IFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEH-MFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDS 2836          

HSP 11 Score: 61.6178 bits (148), Expect = 5.435e-9
Identity = 69/286 (24.13%), Postives = 122/286 (42.66%), Query Frame = 3
Query:  558 LVIEVKDINDNSPFWSQN-ELVTQFSEGSEIGDSKSLTVALDNDFGT--NGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVI-VAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYA-KLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHL 1400
            ++I + D NDN P + ++ +   + SE + +  S +   A+D D     N    Y I+    E   +  + T  +  +N+       K          YE I+ A D  +     S++   + + DENDN P F    Y+  + EN    + V +  A D D    G++ Y I      E + K+F ++S SG +   +  DYE      + + A+DMG   + ++  V + I   ++ +P+      RF   A +   +  G +V   +  D DS  +G+V   L
Sbjct: 2738 VIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAK---------SYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGG--KKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQ--GYVVGQVTATDSDSGPDGRVVYQL 3010          

HSP 12 Score: 52.7582 bits (125), Expect = 2.464e-6
Identity = 58/215 (26.98%), Postives = 96/215 (44.65%), Query Frame = 3
Query:  543 SHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNP--SFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWE--LDYETYTTISL 1175
            S  + + I V DINDN P + +   + Q     + G +     ALD D G N    YS++ E +     + IN +T   S  + L     K L  E        V A D GNP  S  G I++++    +      F+   Y + + EN  S T ++Q+ A+ +D     K+++   +  +     + S++S SG I V     LDY+ ++T S+
Sbjct: 2038 SATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLE--------VVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSDGRRQ-KVQFSFGAGNED---GILSLDSLSGEIRVNKPHLLDYDRFSTPSM 2240          
BLAST of Protocadherin-1 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0343249)

HSP 1 Score: 243.432 bits (620), Expect = 5.511e-65
Identity = 195/657 (29.68%), Postives = 311/657 (47.34%), Query Frame = 3
Query:  552 IVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSI-SPEITE-FELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDS-NENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIF---GKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIY-LYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRT---VSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKI 2492
            I +++ VKD NDN+P + Q  +  +F E +     ++L  A D D        Y+I S  + + F LS     + ++Y + +     +   LDRE    Y  ++ A DGG P   G + V + + D NDN P+F ++ Y  +V EN    T V+Q+ A D D++ NG +EY I+   + +  ++F I+  +G I++   LD+ET     L+V A D G     +T  V I + D+NDN P I         + KI+E+  PG+ VA  SV D DS  E   V   L    +  F+L   +     +Y +      DRE  S  T  +V  D+G P    S S+ + + D+ND  P F +  Y  +V E   PGT +  + A D+DEG+N+ L+YS+       A+ F I+   G +   + +D E+      T  A D G P   STA + V + D+NDN P   +S Y + V EN      +++V+ +D D G+N+                    Y I + F+ +T+      F +      I     LD E  + YE  + ATDRG    ST  +I + + DVND +P F +P     +++  P+     S T I  ++A D D G   ++ Y   + N+   +F ++  +G+I
Sbjct:  158 IRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQ-----ISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINR-RQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNG-GDGHFALTTRD---NSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVN-----------------YTIGEGFKHLTE------FEVRSASGEICIAGELDFERRSSYEFPVLATDRGG--LSTTAMIKMQLTDVNDNRPVF-YPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAG-IFRIDRSTGEI 777          

HSP 2 Score: 239.195 bits (609), Expect = 1.177e-63
Identity = 224/768 (29.17%), Postives = 352/768 (45.83%), Query Frame = 3
Query:  396 YFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQI---------SSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSE-KSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIF-GKDAK---IFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRK-DEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDR--GNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSF--------KSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKD---NGIPRLED--TARLRII 2606
            YF I   +G I I + +D +           K     N+  T+     + H  V  IEV+D+NDN+P +  + +     E +E+G       A D D G++G   YS+  E  +   +    +  ++ S            LD E   ++  IV A DGG PS + ++ ++V V D NDN PVFEK  Y ++V+E+   N  +IQ+ A D D+  N +I Y+I         +S++  + ++ F I  NSG+I++R  LD ET     L V A D G     +   VI+ + D NDN P+  F+ S++    +I EN   G +V V +  D D  EN  +   L PI N  F +     P+T   +IST +  DRE +      +   D+G P ++    V + V D+ND AP  ++ +  +  V E+  PGT +  + A D+D G NA ++YSI  G+D+    +FSI+   G +     LD E          A+D G P + +   + V V D+NDN P F   S+   V E    D  L  V        + S + +   ++     ++   ++  +      +TK    + F +      ++    LDREV +++ + I A D    N P+S+   + I V DVND  P++         ++V   T  GT I    A D D G N +L+Y          +S  Q   LF M+  +G +SLQ  + +   V  Y+LIV   D   N   RL+   T RLRI+
Sbjct:  874 YFSIETNSGNIRIAKPLDHE----------AKSQVLLNIQATLGEPPVYGHTQV-NIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQH----------LDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPK--FQKSKY--EFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPI-NSSFQVH----PVT--GEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVRE----DAALGHV--------VGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEW---PQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPL-DFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRIL 1593          

HSP 3 Score: 201.83 bits (512), Expect = 7.434e-52
Identity = 201/723 (27.80%), Postives = 311/723 (43.02%), Query Frame = 3
Query:  540 FSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLT-----VALDNDFGTNGISYYSI--SPEITEFELSY----IINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEE-FSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIF--GKDAKIFSINKLD-----------GKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLYVLENHTADVPLVQ-VNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLP-DGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTN--DLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESIN 2621
             S   ++ +++ D+NDN P +   E      E  +     S T     VA D D+G  G   Y I    E   F +      I      M S + Q                +   ++A DGGN   N    V +++ D     P+FEKA Y   V E++   T V  + A   D      + Y I S     Y   FSIE+NSG I +   LD+E  + + L ++A  +G         V I + D+NDN+PE  FE S       + E+   G  +      DKDS  +G+VT  L   + +  F+++  +  L +       +  D E   + T  +   D G P  +T+ ++ V V+D+ND  P F +  Y  +V+E       +  +NA+D D G NA ++Y I   G D    SI+  D           G ++L   LDRE+ +    T  A D+G P   +   + V V D NDN P   KS Y + +E +     +V  V  +D D G N+  + +L+              PI            NS F + P  G++  RE  LDRE+   Y++V+EA D+G P +S +  + I+V DVND  P+   P      V V+     GT + ++ A+D D G+N+ + YS      ++   LF ++P SG I  +  +    +   Y L V   D G P  E    LR+ +  +N
Sbjct:  695 LSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPM--------------HMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGY---FSIETNSGNIRIAKPLDHEAKSQVLLNIQAT-LGEPPVYGHTQVNIEVEDVNDNAPE--FEASMV--RISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILS------QHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLL--------------PI------------NSSFQVHPVTGEISTREP-LDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADP--QEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEER-SIYRLGVAASDGGNPPRETVRMLRVEVLDLN 1359          

HSP 4 Score: 181.03 bits (458), Expect = 2.019e-45
Identity = 184/725 (25.38%), Postives = 306/725 (42.21%), Query Frame = 3
Query:  558 LVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFT--NNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAK-IFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKS---NNQTNDL--------FLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESINGDSILSKENKMKDNVEYSNEES 2687
            + + + D+NDN P + Q+       E ++ G S    +A D D G N    YS++         + I+  T + + +  +        D E     +  V A DGG P  + +  V+V + D NDN P+F+++ Y +SV EN      ++++ A D D  +N  + Y I    K  +   F + S SG I +  ELD+E  ++    V A D G L   +T  + + + D+NDN P  Y    + +   + K +   +   +VAV +  D D    G+V+  +  +A  E  + R++     ++ +       R Q   +  +I   D GN R      V + + D     P F +  Y ++V ED+  GT + ++ A   D    + + YSI+  D    FSI    G + +   LD E+   +    +A   G P       + + V+D+NDN P F    + + V E+     PL   +  D D G + +   +LV E+                           LF++      +I    LD E + ++ +++ ATD G P  ST   I ++V DVND  P F        +V V         I Q+ A D D G N+ + Y       +N TN +        F + P SG I L+  +    +   Y L V+  DNG P     A+ R+I+  ++ +    K  K K   E+  EE+
Sbjct:  490 IFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHI--------DCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFK--HLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGL--STTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVAT-DPDYGNFGQVSYRI--VAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHML-NISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQAT-LGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESG------------------------KGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVF---EKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRD-RYQLTVLATDNGTPAAH--AKTRVIVRVLDANDNDPKFQKSK--YEFRIEEN 1165          

HSP 5 Score: 176.792 bits (447), Expect = 3.842e-44
Identity = 186/690 (26.96%), Postives = 306/690 (44.35%), Query Frame = 3
Query:  552 IVLVIEVKDINDNSPFW-----SQNELVTQF-SEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPS-FNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIV---EAN--------------------DMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLE--PIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSG-SVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSG-YPKQLSTANITVIVKDINDNFPFLPKSIYLYVLENHTADVP---LVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKV--KPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQ 2504
            + + + + D ND++P +     S  +  + F S+ + IG+  +  VA+D D G NG   Y I+      E  + IN+ T +    E +K +     D EK  ++  I+ A D G P     S+ + + V   ++N P F +AVY  ++ EN+ S + V+Q+ A       N  + Y+I +    +   LF ++   G I  R + D E+  +  L V   +AN                    D  N +     T+ I + D+NDNSPE  F P        + EN  PG +  V +  D D   N  +   +    + N+ FS++  +  L+        +  DREQ S+ T  I   D G P+      ++++ VED ND AP F    Y   V ED   GT +  I+A D D G+NA L YS+  +    F+I+   G +     LDRE   S +F   A D G Y  + +T  + + V DINDN P   +  Y Y+ +      P   L++V   DAD G N+E   +L +E +    K                      F + P    +     L  E      + + A D+GNPP+S+ G+I + + +     P   F    N T +V  K  + SGT + Q++A+  D G+  ++++SF + N+ + +  ++  SG+I + +
Sbjct: 1586 VTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITG--GNGEGRFRINSQTGII---ELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVAND---LFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPE--FRPGS-CYGLSVPENSEPGVIHTVVA-SDLDEGPNADLIYSITGGNLGNK-FSIDSSSGELSA-------RPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFER--YPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAK----------------------FRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRF---QNETYRVMLKENSPSGTRLLQVVALRSD-GRRQKVQFSFGAGNE-DGILSLDSLSGEIRVNK 2226          

HSP 6 Score: 155.606 bits (392), Expect = 1.215e-37
Identity = 169/613 (27.57%), Postives = 258/613 (42.09%), Query Frame = 3
Query:  822 DREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWE----LDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPH----FSEKSYIFHVNEDVKPGTYLFTINATDKDEGIN-ALLSYSIFGKDAKIFSINKLDGKVFL---ETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIY-LYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESIN 2621
            DRE    Y  +     G N      I+V+V V DENDN+P F +    I   EN         L A D D E      Y I S    +  +L S     G +++  +    LD ET    SL++EA D G        TV I I+D+NDN P   F  SR+   A + EN   G  V      D D++ENG V   +    +++  + R++ P T    I+  K+ D E K      +V  D G     T+  VS+ V D+ND  P     F        ++E  +PG ++  I+  D D     A ++ ++ G D   F++   D  ++L      LDRE V +   +  A D G P   ++ +I + + D+NDN P   + +Y   V+E       ++QV   D DEGLNS    +L +ET  T                         F + P   LI   S +D E     ++ + A D G PP S+   + + + DVND +P F     S   V V      G  I ++ A D D G N+ + Y+     +    F +   SG+I +   + +  +   Y   V+  D G   L  TA +++ +  +N
Sbjct:  139 DRETRASYSLVAIPLSGRN------IRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQP--IFNQSRYF--ATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRID-PRTGAIYIN--KALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGH-FALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSL-AETPET---------------------HAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIF---DQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGEL-DFERRSSYEFPVLATDRG--GLSTTAMIKMQLTDVN 709          

HSP 7 Score: 144.05 bits (362), Expect = 3.762e-34
Identity = 205/800 (25.62%), Postives = 329/800 (41.12%), Query Frame = 3
Query:  399 FEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHI----IVLVIEVKDINDNSP-FWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNG-ISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAID--ADSEMNG--------KIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDM--GNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLE---PIANEE----FSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGN---PRQTTSGSVSVGVEDINDEAPHFSE------KSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAK-IFSINKLDGKVFLETDL-----DRESVESLHFTTRAADSGYPK-QLSTANITVIVKDINDNFPFLPKSIY-LYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPR-LEDTARLRIIIESINGDSILSKENKMKDNVE 2669
            F+++P+ G I+    +DR+ L  L              DL +++ D  + +    + + I V D+NDN+P      E V    E    G       A+D D G N  I+Y  +    ++    + I+  + +   +          LD E+   Y   V A DGGNP       + V V D NDN P F  +  +  V E+      V  +  I+  AD   N         ++ Y ++ LTK      F I+ +SG + V   LD E  +   L + A D    N  + S  TV I + D+NDN+PE   +P     + +++E    G ++  F+  D D+  NG +   L    P  NE      SL RM+   ++   +S     D E   +    +   D+ +    R  TS +V + + D ND APHF        K+    +++  + G  +  I A D+D G N  L+Y I G + +  F IN   G + L   L     D E     +    A D G P+ + S+ N+ +IV+  ++N P   +++Y   +LEN  +   ++QV         N+     + +  A  L     +  I    R      S + + L    +   R+S L      K        D  N        IYI V DVND  P+  F  GS   + V P       I  ++A D DEG N++L YS    N  N  F ++  SG++S +   +E H    Y L +   D G P+  +    + I +E  N ++   K +K   +V+
Sbjct: 1199 FQVHPVTGEISTREPLDRE-LREL-------------YDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTR--------VVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPI----DLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMD---SLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITT-RGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPE--FRPGSCYGLSV-PENSEPGVIHTVVASDLDEGPNADLIYSITGGNLGNK-FSIDSSSGELSARPLDREQHSR--YTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQ 1962          

HSP 8 Score: 142.51 bits (358), Expect = 1.086e-33
Identity = 188/753 (24.97%), Postives = 319/753 (42.36%), Query Frame = 3
Query:  558 LVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSF-NGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPG-KLVAVFSVQDKD-----------SNENGKVTCHLEPIANE-------EFSLERMNIPL---------------------------TVMYKISTLKSF--DREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIF-GKDAKIFSIN-KLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYP--IQKLFRDVTKSFSN-SLFSL-LPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDED-----------EGKNSELEYSFKSNNQTNDLFLMNPESGKIS-----LQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRI 2603
            + I V+D NDN+P +  ++      E + +G S     A+D D G N    YS++ E T+++ +    +  +    K          LDRE    Y F+V A DGG     + ++ V + V D NDN P+FE+  YI  V   +Q    +++++A+DAD   N +I Y +++      AK F I  ++G +     L  E+   + L V A D GN  + S   + + I +    +P + F+    T    + EN   G +L+ V +++               NE+G ++  L+ ++ E           +R + P                            T   +  T  SF     Q +++   +V      P   +   + + +ED ND +P FS+K ++  V+E    GT++  ++A D D G NA L Y I  G     F I     G V     LDRE  +       A D G P+   TA I V + D+NDN P  P               P   V V++A     +E    + S +A  +    D YP    +L  + T    N S+F+L    GKL+++   LD E+  +YE+ + A+D  +  ++   ++ + V D ND  P F+      +   + P     + I++ +++D D           EG NS++ Y  +   +    F ++P +G +S     LQ  +  S     Y + ++ KD G P L+ +  LR+
Sbjct: 1938 ITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANE-TQWQFAIDGQSGLITTVGK----------LDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAK-FRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNE--TYRVMLKENSPSGTRLLQVVALRSDGRRQKVQFSFGAGNEDGILS--LDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFP---------------PNNLVTVSEA-----TELGAVITSISANDV----DTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRR-LDYELQQEYELDVIASDAAHEART---VLTVRVNDENDNAPVFL-AQQPPAYFAILPAI---SEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEG---FSVHPSNGVVSVNMSRLQPAVSSSGD---YFVRIIAKDAGKPALKSSTLLRV 2636          

HSP 9 Score: 115.931 bits (289), Expect = 1.689e-25
Identity = 160/673 (23.77%), Postives = 274/673 (40.71%), Query Frame = 3
Query:  558 LVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSI------SPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFE--PSRFTNNAKITE-NEAPGKLVAVFSVQDKDSNE---NGKVTCHLEPIANEEFSLERMNIPLTV-MYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYP------KQLSTANITVIVKDINDNFPFLPKSIYLYVLENHTADV--PLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSL-LPDGKLIIRESGLDREVTTK-YEIVIEATDRGNP-PKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSF---KSNNQTNDLFLMNPESGKIS 2495
            LVIE++D NDNSP +SQ + V   SEG+  G   +   A D+D G+N    Y I      +  + E   S I+ TN ++               DRE  D Y+  + A D G P   G+  + V + D NDN P F     +++V+E  +    +  + A D D+           S    E   +F+++  SG + ++  LDYE      L V A+D  +  R     + + + D NDN+P    +  P+ F     I+E +E+      + +V   D++    N KV   +EP A E FS+   N  ++V M ++    S            I+  D G P   +S  + V   D       F +  Y   ++E    G+ +  +     D+ +       I G +   F + +    V ++  LDRE  +        +    P         S  ++ + + D NDNFP   +S       +  A +   + Q+   DAD+                      +  P  ++  D+T      +F++ L  G L +    LD +   K YE++I A D  +  P  +     + + D ND +PKF      +   + +P    G+++ +  A D D+G   +L YS     S+  +  +F ++ ESG ++
Sbjct: 2308 LVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVL---------------DREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPN-NLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEAR---TVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEP-AQEGFSVHPSNGVVSVNMSRLQPAVS----SSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAI-----IAGNEESAFELLQSKAIVLVKP-LDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQ----------------------ENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNR-LDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEP---VGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVT 2924          

HSP 10 Score: 95.5153 bits (236), Expect = 2.916e-19
Identity = 143/586 (24.40%), Postives = 237/586 (40.44%), Query Frame = 3
Query:  879 PSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIE-SNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMY--KISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAP---------HFSEKSYIFHVNEDVKPGTYLFTINATDKD-EGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESL-HFTTR--AADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPP------KSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGK--NSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDN 2564
            P      ++++ + DENDNSP F +  ++ +V+E     T V Q+ A D+D+  N ++ Y I       +   F IE + SG +     LD E      L + A D G  +   T T+ + I D+NDN P        F  N  +T +EA      + S+   D +    +T  L   A     +E M+I     Y  K+   +  D E + +    ++  D  +  +T    ++V V D ND AP         +F+    I  ++E +     L T+NATD D EG N+ + Y I     + FS++  +G V +     + +V S   +  R  A D+G P   S+   T++    NDN     + +        +   PL  V +    + L+    +   +E                           S F LL   K I+    LDRE    Y++ +  +    PP       S+   + I +LD ND  P  IF   +    ++        +IAQ+ AID D+    NSE+ Y   S N  + +F ++  +G + +   +        Y LI+   D+
Sbjct: 2300 PFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHI---VDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPT-------FPPNNLVTVSEATELGAVITSISANDVDTYPALTYRLG--AESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTV---LTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIY-IIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSS---TLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGNE--------------------------ESAFELL-QSKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFP--IFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEH-MFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDS 2836          

HSP 11 Score: 61.6178 bits (148), Expect = 5.435e-9
Identity = 69/286 (24.13%), Postives = 122/286 (42.66%), Query Frame = 3
Query:  558 LVIEVKDINDNSPFWSQN-ELVTQFSEGSEIGDSKSLTVALDNDFGT--NGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVI-VAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYA-KLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHL 1400
            ++I + D NDN P + ++ +   + SE + +  S +   A+D D     N    Y I+    E   +  + T  +  +N+       K          YE I+ A D  +     S++   + + DENDN P F    Y+  + EN    + V +  A D D    G++ Y I      E + K+F ++S SG +   +  DYE      + + A+DMG   + ++  V + I   ++ +P+      RF   A +   +  G +V   +  D DS  +G+V   L
Sbjct: 2738 VIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAK---------SYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGG--KKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQ--GYVVGQVTATDSDSGPDGRVVYQL 3010          

HSP 12 Score: 52.7582 bits (125), Expect = 2.464e-6
Identity = 58/215 (26.98%), Postives = 96/215 (44.65%), Query Frame = 3
Query:  543 SHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNP--SFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWE--LDYETYTTISL 1175
            S  + + I V DINDN P + +   + Q     + G +     ALD D G N    YS++ E +     + IN +T   S  + L     K L  E        V A D GNP  S  G I++++    +      F+   Y + + EN  S T ++Q+ A+ +D     K+++   +  +     + S++S SG I V     LDY+ ++T S+
Sbjct: 2038 SATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLE--------VVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSDGRRQ-KVQFSFGAGNED---GILSLDSLSGEIRVNKPHLLDYDRFSTPSM 2240          
BLAST of Protocadherin-1 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0339463)

HSP 1 Score: 242.276 bits (617), Expect = 1.231e-64
Identity = 213/769 (27.70%), Postives = 337/769 (43.82%), Query Frame = 3
Query:  384 KSSVYFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDF---SHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELS-------YIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFD---GGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNT---PVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYK---ISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSI-FGKDAKIFSINKLDGK--VFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIY-LYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESIN 2621
            +S   F+++   GV+T    +DR+ +               +    + +DD F   S    L + V D ND+SP +   +      EG+ +G +     A D D G N    Y I        L+       + I++ + + S +  L        DRE  D Y  +V A D     +     +  V V V D+NDN P F +  Y + V E+    T    V  ++A DAD   N  I Y I           FSI+S SG + +   LDYE+  +  L++ A D G+  R +T  +++N+ D NDN+P  Y   S+F  +  + EN   G  +      D D   N ++T           S    N PL V  +   + T+K  DRE++ +    +V  D G P ++ S SV + V+D+ND  P F+ K Y  +V ED  PGT + T+ ATD DE  ++ L Y I  G     F+I   +G+  + +   LD +  +    T  A DSG   +  TA + + + D N+  P    + Y   V E+      ++ V+ TD+D G+N++   +L  E+   L                    S   FS+ P    I+  + LDRE T+ Y + + A D GNP  S    + I V DVND  P F  P    S ++     + GT++ Q+ A D D G N  ++Y     +  +  F+++P SG I   + + +   V  + L  +  D G P L  T  ++I +E +N
Sbjct:  402 RSQSLFKVDSRTGVVTTSASLDRELM-------------DVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSL--------DRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAI---IGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYT--SQFQES--VLENVPVGYNIIRVQAYDSDEGANAEIT--------YSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDE--DSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGL-------------------GSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILE---DALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGL-DRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVN 1107          

HSP 2 Score: 201.83 bits (512), Expect = 6.393e-52
Identity = 210/728 (28.85%), Postives = 314/728 (43.13%), Query Frame = 3
Query:  558 LVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSL-TKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTV-----MYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAK--IFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVS---ETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTK-YEIVIEATDRGNPPKSTKGIIYINVLDVNDCKP------------KFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARL--RIIIESINGDSILSKENKMKD 2660
            L++ V D NDN+P +  ++      E   +G +     A D+D G N    YSIS     F L+    T  +             K LDRE+  ++ F V A DGG P  + S  V++ V D NDN P F    Y  +V E+    TPV  + A D D +   ++ Y+I++  T+  +A   + ++  G I +   LDY+      L V A D G   R  T TV INI D N+ +P   FE + ++  A + E+   G  V V S  D D   N ++T  L    NEE S+  +  P           I T    DRE  S     +   D GNP  + +  V +GV D+ND AP F    Y   + ED   GT +  + A+D D G+N  + Y +  +D +   F I+   G +     LDRESV   H T  A D G P   ST  + + ++D+ND+ P F    I LYV EN      + +++  D DEG+N+    +++      A +L+ R      Q                       ++  + LD E T K +E+V+ A    +PP      I I V DVND  P            +  FPSG                I +I A D D   + +L Y   S N  N L  +N  SG + L  + Q +  V  +  + V   +GI   +   +L  R+I E +  +S+  + N+M +
Sbjct:  675 LLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQ----------TIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDED--SRLHYEITTGNTRGRFA--ITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGG--RSDTATVHINITDANNFAP--IFENAPYS--ASVFEDAPVGTTVLVVSATDSDVGVNAQITYSL----NEE-SINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQ-----------------------LLTMTELDYESTRKRFELVVRA---ASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHFPSGE---------------IGRIPAFDAD--VSDKLHYRILSGNNAN-LLRLNSSSGGLVL--SPQLNTNVPKFATMEVSVSDGINEAKAIMQLSVRLITEDMLFNSVTVRLNEMTE 1331          

HSP 3 Score: 190.66 bits (483), Expect = 1.930e-48
Identity = 173/581 (29.78%), Postives = 255/581 (43.89%), Query Frame = 3
Query:  930 DNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPL----TVMYKISTLKSFDREQKSKVTAHIVCFDEGNP---RQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGT---YLFTINATDKDEGINALLSYSIFGKDAKI-FSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGK--ISLQQTI---QESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESIN 2621
            + SP FE+A+Y+ SV E   +   V  ++A D +   +  + Y + SL       LF ++S +G +     LD E        V A D     R  T T+ +N+ D ND+SP   FE  +F   A I E    G  V      D+D  +N ++   +E + +     +   +P+    +    IST  S DRE        +   D  +    R+T + SV V V D ND  P FSE++Y   V ED   GT    +  I ATD D+G NA + Y+I G + +  FSI+ + G V L   LD ESV S     RA D G P + +T  + V V D NDN P F        VLEN      +++V   D+DEG N+E   ++         +R D +P+                ++ P    +     LDRE   ++   + A D G PPKS    + I V DVND  P F   +       V      GT +  + A D DE  +S L Y   + N T   F +  ++G+  I++ Q++   QE      ++L V   D+G     DTA + I I   N
Sbjct:  354 NQSPYFEQALYVASVLEEQPAGAAVTTVRARDPE---DSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPT--FEAEQF--EASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSIS--------ERDDNFPL----------------AVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAF---NPKYYEANVGEDQPPGTPVTTVTATDPDE--DSRLHYEITTGN-TRGRFAITSQNGRGLITIAQSLDYKQEKR----FLLTVAATDSG--GRSDTATVHINITDAN 891          

HSP 4 Score: 123.635 bits (309), Expect = 7.612e-28
Identity = 136/517 (26.31%), Postives = 213/517 (41.20%), Query Frame = 3
Query:  306 KWFPTDVNKLQDFGKPIYKFQFFNC-EKSSVYFEINPLN-------------GVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEE---FSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIF-GKDAKIFSINKLDGKVFLETDLD 1802
            K++  +V + Q  G P+      +  E S +++EI   N             G+ITI + +D             K+  +  L +        S    + I + D N+ +P +          E + +G +  +  A D+D G N    YS++ E         + +      N +   +V    LDRE    Y   V A DGGNPS + +  V + VTD NDN+P F+  +Y  S+ E+    T VIQ+ A D D  +NG+I+Y +S     + +  F I+  SG I     LD E+     L   A D G+    ST  V I + D+ND+ P   F   + T    + EN   G +V      D D   N  V  H   I  ++   FSL  +  P +   ++ T+   D E   K    +V     +P       + + V D+ND AP   +   IF+   D  P   +  I A D D  ++  L Y I  G +A +  +N   G + L   L+
Sbjct:  797 KYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDY------------KQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESING-----LGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGS--FVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPT--FASDKIT--LYVPENSPVGSVVGEIHAHDPDEGVNAVV--HYSIIGGDDSNAFSL--VTRPGSERAQLLTMTELDYESTRKRFELVV--RAASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHFPSGEIGRIPAFDAD--VSDKLHYRILSGNNANLLRLNSSSGGLVLSPQLN 1282          
BLAST of Protocadherin-1 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0330601)

HSP 1 Score: 242.276 bits (617), Expect = 1.280e-64
Identity = 213/769 (27.70%), Postives = 337/769 (43.82%), Query Frame = 3
Query:  384 KSSVYFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDF---SHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELS-------YIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFD---GGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNT---PVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYK---ISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSI-FGKDAKIFSINKLDGK--VFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIY-LYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESIN 2621
            +S   F+++   GV+T    +DR+ +               +    + +DD F   S    L + V D ND+SP +   +      EG+ +G +     A D D G N    Y I        L+       + I++ + + S +  L        DRE  D Y  +V A D     +     +  V V V D+NDN P F +  Y + V E+    T    V  ++A DAD   N  I Y I           FSI+S SG + +   LDYE+  +  L++ A D G+  R +T  +++N+ D NDN+P  Y   S+F  +  + EN   G  +      D D   N ++T           S    N PL V  +   + T+K  DRE++ +    +V  D G P ++ S SV + V+D+ND  P F+ K Y  +V ED  PGT + T+ ATD DE  ++ L Y I  G     F+I   +G+  + +   LD +  +    T  A DSG   +  TA + + + D N+  P    + Y   V E+      ++ V+ TD+D G+N++   +L  E+   L                    S   FS+ P    I+  + LDRE T+ Y + + A D GNP  S    + I V DVND  P F  P    S ++     + GT++ Q+ A D D G N  ++Y     +  +  F+++P SG I   + + +   V  + L  +  D G P L  T  ++I +E +N
Sbjct:  402 RSQSLFKVDSRTGVVTTSASLDRELM-------------DVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSL--------DRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAI---IGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYT--SQFQES--VLENVPVGYNIIRVQAYDSDEGANAEIT--------YSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDE--DSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGL-------------------GSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILE---DALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGL-DRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVN 1107          

HSP 2 Score: 201.83 bits (512), Expect = 7.365e-52
Identity = 210/728 (28.85%), Postives = 314/728 (43.13%), Query Frame = 3
Query:  558 LVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSL-TKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTV-----MYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAK--IFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVS---ETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTK-YEIVIEATDRGNPPKSTKGIIYINVLDVNDCKP------------KFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARL--RIIIESINGDSILSKENKMKD 2660
            L++ V D NDN+P +  ++      E   +G +     A D+D G N    YSIS     F L+    T  +             K LDRE+  ++ F V A DGG P  + S  V++ V D NDN P F    Y  +V E+    TPV  + A D D +   ++ Y+I++  T+  +A   + ++  G I +   LDY+      L V A D G   R  T TV INI D N+ +P   FE + ++  A + E+   G  V V S  D D   N ++T  L    NEE S+  +  P           I T    DRE  S     +   D GNP  + +  V +GV D+ND AP F    Y   + ED   GT +  + A+D D G+N  + Y +  +D +   F I+   G +     LDRESV   H T  A D G P   ST  + + ++D+ND+ P F    I LYV EN      + +++  D DEG+N+    +++      A +L+ R      Q                       ++  + LD E T K +E+V+ A    +PP      I I V DVND  P            +  FPSG                I +I A D D   + +L Y   S N  N L  +N  SG + L  + Q +  V  +  + V   +GI   +   +L  R+I E +  +S+  + N+M +
Sbjct:  675 LLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQ----------TIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDED--SRLHYEITTGNTRGRFA--ITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGG--RSDTATVHINITDANNFAP--IFENAPYS--ASVFEDAPVGTTVLVVSATDSDVGVNAQITYSL----NEE-SINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQ-----------------------LLTMTELDYESTRKRFELVVRA---ASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHFPSGE---------------IGRIPAFDAD--VSDKLHYRILSGNNAN-LLRLNSSSGGLVL--SPQLNTNVPKFATMEVSVSDGINEAKAIMQLSVRLITEDMLFNSVTVRLNEMTE 1331          

HSP 3 Score: 190.66 bits (483), Expect = 2.165e-48
Identity = 173/581 (29.78%), Postives = 255/581 (43.89%), Query Frame = 3
Query:  930 DNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPL----TVMYKISTLKSFDREQKSKVTAHIVCFDEGNP---RQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGT---YLFTINATDKDEGINALLSYSIFGKDAKI-FSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGK--ISLQQTI---QESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESIN 2621
            + SP FE+A+Y+ SV E   +   V  ++A D +   +  + Y + SL       LF ++S +G +     LD E        V A D     R  T T+ +N+ D ND+SP   FE  +F   A I E    G  V      D+D  +N ++   +E + +     +   +P+    +    IST  S DRE        +   D  +    R+T + SV V V D ND  P FSE++Y   V ED   GT    +  I ATD D+G NA + Y+I G + +  FSI+ + G V L   LD ESV S     RA D G P + +T  + V V D NDN P F        VLEN      +++V   D+DEG N+E   ++         +R D +P+                ++ P    +     LDRE   ++   + A D G PPKS    + I V DVND  P F   +       V      GT +  + A D DE  +S L Y   + N T   F +  ++G+  I++ Q++   QE      ++L V   D+G     DTA + I I   N
Sbjct:  354 NQSPYFEQALYVASVLEEQPAGAAVTTVRARDPE---DSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPT--FEAEQF--EASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSIS--------ERDDNFPL----------------AVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAF---NPKYYEANVGEDQPPGTPVTTVTATDPDE--DSRLHYEITTGN-TRGRFAITSQNGRGLITIAQSLDYKQEKR----FLLTVAATDSG--GRSDTATVHINITDAN 891          

HSP 4 Score: 123.635 bits (309), Expect = 7.069e-28
Identity = 136/517 (26.31%), Postives = 213/517 (41.20%), Query Frame = 3
Query:  306 KWFPTDVNKLQDFGKPIYKFQFFNC-EKSSVYFEINPLN-------------GVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEE---FSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIF-GKDAKIFSINKLDGKVFLETDLD 1802
            K++  +V + Q  G P+      +  E S +++EI   N             G+ITI + +D             K+  +  L +        S    + I + D N+ +P +          E + +G +  +  A D+D G N    YS++ E         + +      N +   +V    LDRE    Y   V A DGGNPS + +  V + VTD NDN+P F+  +Y  S+ E+    T VIQ+ A D D  +NG+I+Y +S     + +  F I+  SG I     LD E+     L   A D G+    ST  V I + D+ND+ P   F   + T    + EN   G +V      D D   N  V  H   I  ++   FSL  +  P +   ++ T+   D E   K    +V     +P       + + V D+ND AP   +   IF+   D  P   +  I A D D  ++  L Y I  G +A +  +N   G + L   L+
Sbjct:  797 KYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDY------------KQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESING-----LGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGS--FVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPT--FASDKIT--LYVPENSPVGSVVGEIHAHDPDEGVNAVV--HYSIIGGDDSNAFSL--VTRPGSERAQLLTMTELDYESTRKRFELVV--RAASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHFPSGEIGRIPAFDAD--VSDKLHYRILSGNNANLLRLNSSSGGLVLSPQLN 1282          
BLAST of Protocadherin-1 vs. Ensembl Zebrafish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 295.819 bits (756), Expect = 1.083e-83
Identity = 242/807 (29.99%), Postives = 360/807 (44.61%), Query Frame = 3
Query:  249 IYEELPRKTKVIDLGAQATKWFPTDVNKLQDFGKPIYKFQFFNCEKSSVYFEINPLNG-VITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDD----DFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNN----AKITENEAPGKLVAVFSVQDKDSNENGKVTC--------HLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDA--KIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIII 2609
            ++EE P  T +  L A            L D G        +  E  + Y  ++   G + T E  IDR+ L       C  K   C L+  +   D        +I   IEV+DINDN+P +    L     E + +G   S+ +A D D   NG++ Y+++      E   +          ++  +L++   LDRE  D Y+  + A DGGNP    S  + V + D NDN+P FEK+ Y   V EN      V+Q+KA D+D   NG+IEY +     P   KL  I+ +SG I+V+  LD E    +   V A D G   + S   V I++ D NDN+P +         +    A I+E+   G  VA+  V DKD  EN  VTC         L P ++     +R        Y + T    D E+       IV  D GNP  +++ S+ V V D ND +P FS   +     E+ +PG  +  + A+D D G NA L YSI    +   +F I+   G+V   + LDRE  +   F   AAD G P    TA + + V D NDN P F+       VLEN     P+  V V D DEG N++ ++++  +          ++ IQ     +  S S                   DRE  + Y   ++A D G+PP+S+   + INVLD ND  P    PS S S +++ P     + +  + A D D G N+EL YS    N  +DLF ++P +G+I+L + +   H    + L++ V D G P     A + I +
Sbjct:   29 VHEEQPPSTLIGSLAAD---------QGLPDTG------HLYKLEVGAPYLRVDGKTGDIFTTEIPIDRETLKD-----CRNKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTERNGVADYTLT---AGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDP-VPKLLRIDRSSGIIYVKGPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSSVDNKR-------KYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVVASDADSGTNAELVYSIIADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMDEGENAQVQLSVEPDVG--------KFVIQNGTGTILSSIS------------------FDREKESSYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVVTKPSNS-SFIRLSPMAAPDSVVEVVEAEDIDSGSNAELVYSIAGGN-PHDLFYISPSNGEITLTKELTRKHS-GLHRLVIKVSDRGKPSRHAIALVHIYV 775          
BLAST of Protocadherin-1 vs. Ensembl Zebrafish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 295.819 bits (756), Expect = 7.617e-83
Identity = 242/807 (29.99%), Postives = 360/807 (44.61%), Query Frame = 3
Query:  249 IYEELPRKTKVIDLGAQATKWFPTDVNKLQDFGKPIYKFQFFNCEKSSVYFEINPLNG-VITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDD----DFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNN----AKITENEAPGKLVAVFSVQDKDSNENGKVTC--------HLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDA--KIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIII 2609
            ++EE P  T +  L A            L D G        +  E  + Y  ++   G + T E  IDR+ L       C  K   C L+  +   D        +I   IEV+DINDN+P +    L     E + +G   S+ +A D D   NG++ Y+++      E   +          ++  +L++   LDRE  D Y+  + A DGGNP    S  + V + D NDN+P FEK+ Y   V EN      V+Q+KA D+D   NG+IEY +     P   KL  I+ +SG I+V+  LD E    +   V A D G   + S   V I++ D NDN+P +         +    A I+E+   G  VA+  V DKD  EN  VTC         L P ++     +R        Y + T    D E+       IV  D GNP  +++ S+ V V D ND +P FS   +     E+ +PG  +  + A+D D G NA L YSI    +   +F I+   G+V   + LDRE  +   F   AAD G P    TA + + V D NDN P F+       VLEN     P+  V V D DEG N++ ++++  +          ++ IQ     +  S S                   DRE  + Y   ++A D G+PP+S+   + INVLD ND  P    PS S S +++ P     + +  + A D D G N+EL YS    N  +DLF ++P +G+I+L + +   H    + L++ V D G P     A + I +
Sbjct:   29 VHEEQPPSTLIGSLAAD---------QGLPDTG------HLYKLEVGAPYLRVDGKTGDIFTTEIPIDRETLKD-----CRNKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTERNGVADYTLT---AGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDP-VPKLLRIDRSSGIIYVKGPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSSVDNKR-------KYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVVASDADSGTNAELVYSIIADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMDEGENAQVQLSVEPDVG--------KFVIQNGTGTILSSIS------------------FDREKESSYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVVTKPSNS-SFIRLSPMAAPDSVVEVVEAEDIDSGSNAELVYSIAGGN-PHDLFYISPSNGEITLTKELTRKHS-GLHRLVIKVSDRGKPSRHAIALVHIYV 775          
BLAST of Protocadherin-1 vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 290.812 bits (743), Expect = 7.885e-82
Identity = 243/808 (30.07%), Postives = 383/808 (47.40%), Query Frame = 3
Query:  366 QFFNCEKSSVYFEINPLNG-VITIERRIDRDNL--CHLVPTCCPKKNNQCNLDLTIKSDDDF----SHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNN----AKITENEAPGKLVAVFSVQDKDSNENGKVTCHLE---PIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAK--IFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVK-VKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRII----------IESINGDSILSK-ENKMKDNVEYSNEESDNFDF 2702
              +  E  + Y  ++   G + T E  IDR++L  C  +      + + C L+  +   D        +I   IE+ D NDN+P +S   L     E + +G   ++ VA D D G+NGI+ Y+++   T  E + + +      S+++  +L++   LDRE  D Y+  +   DGG+P    S  + + +TD NDN P FE++ Y   + EN      V+Q+KA D+D   NG++ Y +   + P   +L SI+ N+G I V+  +D E  + +   V+A D G   + S   V I ++D NDN+P I         +    A I+E+   G  VA+  V D+D  EN  VTC +    P      S    +       + +TL  ++R ++ ++   IV  D GNP  +++ S+ V V D+ND AP FS   Y     E+ +PG  +  + ATD D G NA L+YSI G      +F IN   G+V + + LDRE ++   F   AAD G P    TA + V V D NDN P F+       V EN     P+  V V D DEG N+  ++++  +    +I+                   N  ++       I+     DRE  + Y   ++A D G+PP+S+   I INVLD ND  P    P  +NS+ K + PRT   T +  + A D D G NSEL+++    N  + LF ++ E G+I+L +     H +  + L+V VKD G P  + TA + I           +E + G S+ +  E  +  + +YS +   N  F
Sbjct:   59 HLYKLEVGAPYLRVDGKTGDIYTTENSIDRESLKDCRNL-----FEGDPCFLEFEVSITDLMKGTGPRLIEGRIEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALT---TGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSSP-VMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRI--EIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPDNGKFMIQ-------------------NGTYT-------ILSTISFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKP--ANSSYKFLDPRTSPETHVESVEAEDIDIGLNSELDFNIVGGN-PHGLFRISSE-GEITLAKEFTPKH-IGLHRLVVKVKDKGTPPRQTTALVHIYVNETIGNVSHVEGLVGHSLYTPLEMDIAGDPDYSRDPHSNILF 824          
BLAST of Protocadherin-1 vs. Ensembl Zebrafish
Match: pcdh10a (protocadherin 10a [Source:ZFIN;Acc:ZDB-GENE-020731-1])

HSP 1 Score: 290.041 bits (741), Expect = 9.054e-82
Identity = 234/737 (31.75%), Postives = 361/737 (48.98%), Query Frame = 3
Query:  234 HFTIDIYEELPRKTKVIDLGAQATKWFPTDVNKLQDFGKPIYKFQFFNCEKSSVYFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAK------IFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLYVLENHTA--DVP--------LVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKL-IIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAI 2393
            HF++   EE  R T V ++          D+ KL        +FQ     ++  Y E+N  NG + +  RIDR+ +C        ++   C L L +  ++    +  + IEV DINDN P + + ++  + +E +  G    +  A D D GTN +S Y+I+         + ++  T    N+   +LVL K LDRE+   +++++ A DGG P   G+  ++V V D NDN+P F+++VY +S+ EN    T VIQL A D D   NG+I Y +SS   P    LF+I+S +G I V  E+DYE  +T  + V+A DMG     + C V++ + D+NDN+PEI F     T    ++E  APG ++A+ SV D+DS ENG++TC L       F L+         Y I T    DRE+    T  +V  D+G P  +TS S+ V V D ND AP F +  Y  +V E+  PG Y++ ++A D D G NA ++YSI   + +        SIN  +G ++     D E ++   F   A DSG P+  + A + VI+ D NDN P    S+   + +N TA   +P        + ++  TDAD+G N+    +++         R +E     +FR   ++           G+L   R     R+    Y+++IE  D G PP S+     INVL V+         SG   +VK K  ++  T I  IIA+
Sbjct:   19 HFSVP--EEQERGTVVGNIAED----LGLDITKLS-----ARRFQTVPSSRTP-YLEVNLENGALVVNERIDREEIC--------RQTVPCLLHLEVFLENPL-ELFRVEIEVMDINDNPPSFPETDITVEITESATPGTRFPVENAFDPDVGTNALSTYAITTNNY-----FYLDVQTQGDGNR-FAELVLDKPLDREQQAIHKYVLTAVDGGQPQRTGTALLVVKVLDSNDNAPTFDQSVYSVSLRENSPVGTLVIQLNASDMDEGQNGEIVYSLSSHNSPRIRDLFNIDSRTGRIEVTGEVDYEESSTHQIYVQAKDMGPNAVPAHCKVLVKLIDVNDNTPEISFS----TVTESVSEQAAPGTVIALLSVTDRDSGENGQMTCELH--GEVPFKLKSS---FKNYYTIVTDGPLDREKAESYTLTVVAKDKGVPSLSTSKSIKVHVSDENDNAPRFMQSVYDVYVTENNVPGAYIYAVSAVDPDVGQNAYVTYSILECEIQGMSILTYVSINSENGYLYALRSFDYEQIKEFSFMVHAKDSGAPELTANATVNVIIVDQNDNAP----SVIAPLGKNGTAREHLPRSAEPGYLVTRIVATDADDGENARLSYSIL---------RGNEL---GMFRMDWRT-----------GELRTARRVSSKRDPPHPYDLLIEVRDHGQPPLSSSA--SINVLLVDSVVEGR---SGDRGSVKSKEGSLDLTLIL-IIAL 686          

HSP 2 Score: 120.168 bits (300), Expect = 5.847e-27
Identity = 131/473 (27.70%), Postives = 209/473 (44.19%), Query Frame = 3
Query: 1227 VIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTL-KSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAK----IFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVK--DINDNFPFLP-KSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYS-FKSNNQTNDLFL---MNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIII 2609
            V I + D+NDN P   F  +  T   +ITE+  PG    V +  D D   N   T  +    N  F L+         +    L K  DREQ++     +   D G P++T +  + V V D ND AP F +  Y   + E+   GT +  +NA+D DEG N  + YS+   ++     +F+I+   G++ +  ++D E   +     +A D G P  +  A+  V+VK  D+NDN P +   ++   V E       +  ++VTD D G N +    L  E    L                  SF N  ++++ DG L       DRE    Y + + A D+G P  ST   I ++V D ND  P+F+    S   V V    V G  I  + A+D D G+N+ + YS  +   Q   +     +N E+G +   ++  +  ++  +  +V  KD+G P L   A + +II
Sbjct:  106 VEIEVMDINDNPPS--FPETDIT--VEITESATPGTRFPVENAFDPDVGTNALSTYAI--TTNNYFYLDVQTQGDGNRFAELVLDKPLDREQQAIHKYVLTAVDGGQPQRTGTALLVVKVLDSNDNAPTFDQSVYSVSLRENSPVGTLVIQLNASDMDEGQNGEIVYSLSSHNSPRIRDLFNIDSRTGRIEVTGEVDYEESSTHQIYVQAKDMG-PNAVP-AHCKVLVKLIDVNDNTPEISFSTVTESVSEQAAPGTVIALLSVTDRDSGENGQMTCELHGEVPFKL----------------KSSFKN-YYTIVTDGPL-------DREKAESYTLTVVAKDKGVPSLSTSKSIKVHVSDENDNAPRFM---QSVYDVYVTENNVPGAYIYAVSAVDPDVGQNAYVTYSILECEIQGMSILTYVSINSENGYLYALRSF-DYEQIKEFSFMVHAKDSGAPELTANATVNVII 542          
BLAST of Protocadherin-1 vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 290.041 bits (741), Expect = 9.206e-82
Identity = 243/808 (30.07%), Postives = 383/808 (47.40%), Query Frame = 3
Query:  366 QFFNCEKSSVYFEINPLNG-VITIERRIDRDNL--CHLVPTCCPKKNNQCNLDLTIKSDDDF----SHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNN----AKITENEAPGKLVAVFSVQDKDSNENGKVTCHLE---PIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAK--IFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVK-VKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRII----------IESINGDSILSK-ENKMKDNVEYSNEESDNFDF 2702
              +  E  + Y  ++   G + T E  IDR++L  C  +      + + C L+  +   D        +I   IE+ D NDN+P +S   L     E + +G   ++ VA D D G+NGI+ Y+++   T  E + + +      S+++  +L++   LDRE  D Y+  +   DGG+P    S  + + +TD NDN P FE++ Y   + EN      V+Q+KA D+D   NG++ Y +   + P   +L SI+ N+G I V+  +D E  + +   V+A D G   + S   V I ++D NDN+P I         +    A I+E+   G  VA+  V D+D  EN  VTC +    P      S    +       + +TL  ++R ++ ++   IV  D GNP  +++ S+ V V D+ND AP FS   Y     E+ +PG  +  + ATD D G NA L+YSI G      +F IN   G+V + + LDRE ++   F   AAD G P    TA + V V D NDN P F+       V EN     P+  V V D DEG N+  ++++  +    +I+                   N  ++       I+     DRE  + Y   ++A D G+PP+S+   I INVLD ND  P    P  +NS+ K + PRT   T +  + A D D G NSEL+++    N  + LF ++ E G+I+L +     H +  + L+V VKD G P  + TA + I           +E + G S+ +  E  +  + +YS +   N  F
Sbjct:   61 HLYKLEVGAPYLRVDGKTGDIYTTENSIDRESLKDCRNL-----FEGDPCFLEFEVSITDLMKGTGPRLIEGRIEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALT---TGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSSP-VMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRI--EIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPDNGKFMIQ-------------------NGTYT-------ILSTISFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKP--ANSSYKFLDPRTSPETHVESVEAEDIDIGLNSELDFNIVGGN-PHGLFRISSE-GEITLAKEFTPKH-IGLHRLVVKVKDKGTPPRQTTALVHIYVNETIGNVSHVEGLVGHSLYTPLEMDIAGDPDYSRDPHSNILF 826          
BLAST of Protocadherin-1 vs. Ensembl Xenopus
Match: ENSXETT00000038930.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:19026355:19038271:-1 gene:ENSXETG00000013126.1 transcript:ENSXETT00000038930.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 286.574 bits (732), Expect = 3.413e-82
Identity = 200/580 (34.48%), Postives = 304/580 (52.41%), Query Frame = 3
Query:  372 FNCEKSSVYFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEI-GDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKL------DGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFL--PKSIYLYVLENH-----TADVPLVQVNVTDADEGLNSETKVTLVSETATTLIK 2069
               E+S  +F +NP NG +T++ RIDR++LC    TC         L + I +++    +  L IE+ DINDNSP +S N+ +   +E   I G    L +A D D G NGIS Y ++P    F LS     +  +        LVL+  LDRE+ +++  I+ A DGG P  +GS  +IV V D NDN PVF K+ Y + + EN + NT +  L A D D   NG+IEY   S T     +LF +   +G I+++  +DYE      L + A D G       C + + + D NDN PEI       + +  + EN A    VA F+V+D+DS +NG+VT  L P  N  F ++    PL   Y + T +  DRE+ S+    +   D G+P   T  + S+ + DIND AP F + +Y   ++E+  PG++L T++A D DEG+N+ L+YS+      +FSI+ L       G ++ +   D E+++    T RA DSG+PK  S A ++V V D+NDN+P L  PK     +++       +A   + +++  D D G N+    +LV +T TTL K
Sbjct:   65 LGSERSRRHFALNPANGDLTVKERIDRESLCGSSSTCV--------LPIEIVAENPL-ELYSLEIEIIDINDNSPTFSVNDHIINITELVAIPGIIFPLEIAHDPDVGKNGISQYKLNP-TPYFSLSVKNRKDGTLIPE-----LVLETVLDREEKEEHRLILIALDGGEPPRSGSCNIIVNVLDINDNPPVFHKSNYKVKLLENPKLNTVLTTLNATDQDEGRNGEIEYYFDSHTSESAKELFHLHPQTGEIYIKGIVDYEESNFHELSIRAKDKGVPELEGRCLLQVEVEDANDNPPEIILT----STSTDVPENAALETAVAFFTVRDRDSGKNGEVTLTLSP--NLPFKIK----PLKNHYSLVTDQLLDREKISQYDIQMTAKDLGSPTLQTQVTFSINISDINDNAPVFLQANYNAIIHENKDPGSFLCTVSAFDSDEGVNSELTYSLVDSKIDVFSISSLVYIDPKSGNIYSQRAFDYENIQVFQITVRAEDSGFPKLFSNATVSVFVLDVNDNYPTLLYPKYSRELIIDERIPNSASAGYLVTKISAVDLDSGHNAWLLFSLVDDTDTTLFK 619          

HSP 2 Score: 140.198 bits (352), Expect = 2.516e-33
Identity = 137/482 (28.42%), Postives = 213/482 (44.19%), Query Frame = 3
Query: 1233 INIRDLNDNSPEIYFEPSRFTNN---AKITENEA-PGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMN------IPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSY---SIFGKDAK-IFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNN----QTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESIN 2621
            I I D+NDNSP        F+ N     ITE  A PG +  +    D D  +NG     L P     FSL   N      IP  V+  +      DRE+K +    ++  D G P ++ S ++ V V DIND  P F + +Y   + E+ K  T L T+NATD+DEG N  + Y   S   + AK +F ++   G+++++  +D E       + RA D G P+      + V V+D NDN P  +  S    V EN   +  +    V D D G N E  +TL       +   K+ Y +                         + +  LDRE  ++Y+I + A D G+P   T+    IN+ D+ND  P F+    +N    +      G+ +  + A D DEG NSEL YS   +       + L  ++P+SG I  Q+   +   +  + + V  +D+G P+L   A + + +  +N
Sbjct:  120 IEIIDINDNSP-------TFSVNDHIINITELVAIPGIIFPLEIAHDPDVGKNGISQYKLNP--TPYFSLSVKNRKDGTLIPELVLETV-----LDREEKEEHRLILIALDGGEPPRSGSCNIIVNVLDINDNPPVFHKSNYKVKLLENPKLNTVLTTLNATDQDEGRNGEIEYYFDSHTSESAKELFHLHPQTGEIYIKGIVDYEESNFHELSIRAKDKGVPELEGRCLLQVEVEDANDNPPEIILTSTSTDVPENAALETAVAFFTVRDRDSGKNGEVTLTLSPNLPFKIKPLKNHYSL-------------------------VTDQLLDREKISQYDIQMTAKDLGSPTLQTQVTFSINISDINDNAPVFL---QANYNAIIHENKDPGSFLCTVSAFDSDEGVNSELTYSLVDSKIDVFSISSLVYIDPKSGNIYSQRAF-DYENIQVFQITVRAEDSGFPKLFSNATVSVFVLDVN 558          

HSP 3 Score: 134.806 bits (338), Expect = 1.332e-31
Identity = 161/604 (26.66%), Postives = 248/604 (41.06%), Query Frame = 3
Query:  909 VAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLK-AIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYI----HVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVT----CHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETD--LDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTV---KVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTA-RLRIIIESINGDSILSKENKMKDNVEY 2672
            + + D NDNSP F    +II++ E +     +  L+ A D D   NG  +Y+   L    Y  L       G +     +   LD E      LI+ A D G   R  +C +I+N+ D+NDN P   F  S +    K+ EN     ++   +  D+D   NG++      H    A E F L     P T    I  +   D E+ +     I   D+G P       + V VED ND  P     S    V E+    T +      D+D G N  ++ ++       F I  L     L TD  LDRE +        A D G P   +    ++ + DINDN P FL  +    + EN      L  V+  D+DEG+NSE   +LV         + D + I            +SL  + P    I  +   D E    ++I + A D G P   +   + + VLDVND  P  ++P  S   +   ++     +G  + +I A+D D G N+ L +S   +  T  LF ++  +G++   + +QE      + L++ + D+G P L  T   L +  E+     +LS    M D   Y
Sbjct:  120 IEIIDINDNSPTFSVNDHIINITELVAIPGIIFPLEIAHDPDVGKNGISQYK---LNPTPYFSLSVKNRKDGTLIPELVLETVLDREEKEEHRLILIALDGGEPPRSGSCNIIVNVLDINDNPP--VFHKSNY--KVKLLENPKLNTVLTTLNATDQDEGRNGEIEYYFDSHTSESAKELFHLH----PQTGEIYIKGI--VDYEESNFHELSIRAKDKGVPELEGRCLLQVEVEDANDNPPEIILTSTSTDVPENAALETAVAFFTVRDRDSGKNGEVTLTL--SPNLPFKIKPLKNHYSLVTDQLLDREKISQYDIQMTAKDLGSPTLQTQVTFSINISDINDNAPVFLQANYNAIIHENKDPGSFLCTVSAFDSDEGVNSELTYSLVD-------SKIDVFSI------------SSLVYIDPKSGNIYSQRAFDYENIQVFQITVRAEDSGFPKLFSNATVSVFVLDVNDNYPTLLYPKYSRELIIDERIPNSASAGYLVTKISAVDLDSGHNAWLLFSLVDDTDTT-LFKVSAYTGEVRTIRELQEMDYKEQH-LVISISDHGEPTLSTTVIILSVFQENSKSRDLLSNSKPMTDITLY 687          

HSP 4 Score: 86.2705 bits (212), Expect = 1.856e-16
Identity = 94/349 (26.93%), Postives = 164/349 (46.99%), Query Frame = 3
Query: 1629 IFHVNEDVKPGTYL------FTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESV---ESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLYVLENHTADVPLVQVNVT---DADEGLN--SETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNN--QTNDLFLMNPESGKISLQQTI--QESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESIN 2621
            +F V E+ +PG+ +        IN  D  +    L S     +  + F++N  +G + ++  +DRES+    S         +  P +L +  I +I  DINDN P    + ++  +    A +P +   +    D D G N  S+ K+      + ++  RKD                    +L+P+   ++ E+ LDRE   ++ +++ A D G PP+S    I +NVLD+ND  P F     SN  VK+       T +  + A D+DEG+N E+EY F S+      +LF ++P++G+I ++  +  +ES+    + L +  KD G+P LE    L++ +E  N
Sbjct:   31 MFSVGEETEPGSVVGNVAQVLGINLADIAKRRLHLGS----ERSRRHFALNPANGDLTVKERIDRESLCGSSSTCVLPIEIVAENPLELYSLEIEII--DINDNSPTFSVNDHIINITELVA-IPGIIFPLEIAHDPDVGKNGISQYKLNPTPYFSLSVKNRKDG-------------------TLIPE---LVLETVLDREEKEEHRLILIALDGGEPPRSGSCNIIVNVLDINDNPPVF---HKSNYKVKLLENPKLNTVLTTLNATDQDEGRNGEIEYYFDSHTSESAKELFHLHPQTGEIYIKGIVDYEESN---FHELSIRAKDKGVPELEGRCLLQVEVEDAN 344          
BLAST of Protocadherin-1 vs. Ensembl Xenopus
Match: pcdh10 (protocadherin 10 [Source:NCBI gene;Acc:779938])

HSP 1 Score: 288.115 bits (736), Expect = 5.554e-81
Identity = 207/654 (31.65%), Postives = 319/654 (48.78%), Query Frame = 3
Query:  396 YFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYI-INTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAK---IF---SINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP--------------FLPKSI---YLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLD 2285
            Y E+N  NGV+ +  +IDR+ +C        K+N  C L L +  ++      V  IEV DINDN P + Q+++  + SE +  G    L  A D D G N +  Y I+        SY  ++  T    NK   +LVLKK+LDRE+   + +++ A DGG P   G+  + + V D NDN PVFE+ +Y +S+ EN    T VIQL A D D   NG++ Y  SS   P+   +F I+  +G I +  ELDYE   +  + V+A D+G       C V++ + DLNDN PEI F     T    ++E+ +PG +VA+FSV D+DS ENG++ C +  + +  F   R+ +     Y I T  + DRE  +  T  ++  D G P  +++ S+ V V D+ND +P F++  Y  +V E+  PG Y+  ++ATDKDE  NA +SY I   D +   +F   SIN  +G ++     D E ++   F   A D G P   S A + +I+ D NDN P              FLP++    YL+            +V   D+DEG N+    +++     +L +        +  R +T                        R+    +E+V+E  D G PP S+  +I + ++D
Sbjct:   61 YLELNLENGVLYVNEKIDREQIC--------KQNPSCMLHLEVFLENPLEFFRV-EIEVLDINDNPPVFPQSDIQVEISESATPGTRFPLESAYDLDVGNNSLRTYEITTN------SYFNLDVQTQGDGNKF-AELVLKKQLDREQQALHRYVLTAIDGGTPQRTGTALLTIKVLDSNDNVPVFEQQIYTVSLPENSPPGTMVIQLNATDQDEGQNGEVVYSFSSHNSPKVRDIFGIDPRTGRIEIIGELDYEDSGSYQVYVQAKDLGPNAVPVHCKVLVKVLDLNDNPPEISFS----TVKESVSESASPGTVVALFSVTDRDSEENGQIHCEI--LGDVPF---RLKLSYKNYYTIVTEGTLDREAMATYTVTVLARDRGTPPLSSTKSIQVQVADVNDNSPRFTQAIYNVYVIENNVPGAYISAVSATDKDEEENANISYYILECDIQGMSVFTYVSINSENGYLYALRTFDYEQLKDFSFMVEARDGGTPPLSSNATVNIIIVDQNDNAPAIVSPQGRNGTAKEFLPRTAEPGYLF-----------TRVVAVDSDEGENARLTYSILRGNDMSLFRMDWRTGELRTARKITNK----------------------RDPHRPFELVVEVRDHGQPPLSSTALIQVQIVD 656          

HSP 2 Score: 173.326 bits (438), Expect = 2.592e-43
Identity = 169/590 (28.64%), Postives = 259/590 (43.90%), Query Frame = 3
Query:  900 KVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSG----YIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKV----TCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGK----VFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIY-LYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKL--FRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVK-VKPRTVS-GTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTI---QESHKVCCYVLIVVVKDNGIPRLEDTARLRIII 2609
            +V + V D NDN PVF ++   + ++E+    T      A D D   N    Y+I   T   Y  L       G     + ++ +LD E       ++ A D G  +R  T  + I + D NDN P   FE   +T    + EN  PG +V   +  D+D  +NG+V    + H  P   + F ++    P T   +I  +   D E       ++   D G         V V V D+ND  P  S  +    V+E   PGT +   + TD+D   N  +   I G     F + KL  K    +  E  LDRE++ +   T  A D G P   ST +I V V D+NDN P   ++IY +YV+EN+     +  V+ TD DE  N+     ++            E  IQ +  F  V+ +  N     L            D E    +  ++EA D G PP S+   + I ++D ND  P  + P G N T K   PRT   G    +++A+D DEG+N+ L YS    N  + LF M+  +G++   + I   ++ H+   + L+V V+D+G P L  TA +++ I
Sbjct:  105 RVEIEVLDINDNPPVFPQSDIQVEISESATPGTRFPLESAYDLDVGNNSLRTYEI---TTNSYFNLDVQTQGDGNKFAELVLKKQLDREQQALHRYVLTAIDGGTPQRTGTALLTIKVLDSNDNVP--VFEQQIYT--VSLPENSPPGTMVIQLNATDQDEGQNGEVVYSFSSHNSPKVRDIFGID----PRT--GRIEIIGELDYEDSGSYQVYVQAKDLGPNAVPVHCKVLVKVLDLNDNPPEISFSTVKESVSESASPGTVVALFSVTDRDSEENGQIHCEILGDVP--FRL-KLSYKNYYTIVTEGTLDREAMATYTVTVLARDRGTPPLSSTKSIQVQVADVNDNSPRFTQAIYNVYVIENNVPGAYISAVSATDKDEEENANISYYIL------------ECDIQGMSVFTYVSINSENGYLYAL---------RTFDYEQLKDFSFMVEARDGGTPPLSSNATVNIIIVDQNDNAPAIVSPQGRNGTAKEFLPRTAEPGYLFTRVVAVDSDEGENARLTYSILRGNDMS-LFRMDWRTGELRTARKITNKRDPHRP--FELVVEVRDHGQPPLSSTALIQVQI 654          

HSP 3 Score: 130.954 bits (328), Expect = 4.455e-30
Identity = 131/488 (26.84%), Postives = 216/488 (44.26%), Query Frame = 3
Query: 1227 VIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLE-RMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAK----IFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLP-KSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTL-IKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYS-FKSNNQTNDLFL---MNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIII--ESINGDSILSKENK 2651
            V I + D+NDN P   F  S      +I+E+  PG    + S  D D   N   T   E   N  F+L+ +         ++   K  DREQ++     +   D G P++T +  +++ V D ND  P F ++ Y   + E+  PGT +  +NATD+DEG N  + YS    ++     IF I+   G++ +  +LD E   S     +A D G         + V V D+NDN P +   ++   V E+ +    +   +VTD D   N +    ++ +    L +  K+ Y                          I+ E  LDRE    Y + + A DRG PP S+   I + V DVND  P+F   + +   V V    V G  I+ + A D+DE +N+ + Y   + + Q   +F    +N E+G +   +T  +  ++  +  +V  +D G P L   A + III  ++ N  +I+S + +
Sbjct:  106 VEIEVLDINDNPP--VFPQSDI--QVEISESATPGTRFPLESAYDLDVGNNSLRT--YEITTNSYFNLDVQTQGDGNKFAELVLKKQLDREQQALHRYVLTAIDGGTPQRTGTALLTIKVLDSNDNVPVFEQQIYTVSLPENSPPGTMVIQLNATDQDEGQNGEVVYSFSSHNSPKVRDIFGIDPRTGRIEIIGELDYEDSGSYQVYVQAKDLGPNAVPVHCKVLVKVLDLNDNPPEISFSTVKESVSESASPGTVVALFSVTDRDSEENGQIHCEILGDVPFRLKLSYKNYY-------------------------TIVTEGTLDREAMATYTVTVLARDRGTPPLSSTKSIQVQVADVNDNSPRF---TQAIYNVYVIENNVPGAYISAVSATDKDEEENANISYYILECDIQGMSVFTYVSINSENGYLYALRTF-DYEQLKDFSFMVEARDGGTPPLSSNATVNIIIVDQNDNAPAIVSPQGR 558          

HSP 4 Score: 110.923 bits (276), Expect = 5.771e-24
Identity = 123/416 (29.57%), Postives = 169/416 (40.62%), Query Frame = 3
Query:  237 FTIDIYEELPRKTKVIDLGAQATKWFPTDVNKLQDFGKPIYKFQFFNCEKSSVYFEINPLNGVITIERRIDRDNLCH---------LVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEIT-EFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQI--SSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAK--ITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMN 1442
            +T+ + E  P  T VI L A       TD ++ Q+ G+ +Y F   N  K    F I+P  G I I   +D ++            L P   P                   H  VLV +V D+NDN P  S + +    SE +  G   +L    D D   NG  +  I  ++    +LSY           K    +V +  LDRE +  Y   V A D G P  + +  + V V D NDNSP F +A+Y + V EN      +  + A D D E N  I Y I    +         SI S +GY++     DYE     S +VEA D G     S  TV I I D NDN+P I   P      AK  +     PG L       D D  EN ++T  +  +   + SL RM+
Sbjct:  234 YTVSLPENSPPGTMVIQLNA-------TDQDEGQN-GEVVYSFSSHNSPKVRDIFGIDPRTGRIEIIGELDYEDSGSYQVYVQAKDLGPNAVP------------------VHCKVLV-KVLDLNDNPPEISFSTVKESVSESASPGTVVALFSVTDRDSEENGQIHCEILGDVPFRLKLSY-----------KNYYTIVTEGTLDREAMATYTVTVLARDRGTPPLSSTKSIQVQVADVNDNSPRFTQAIYNVYVIENNVPGAYISAVSATDKDEEENANISYYILECDIQGMSVFTYVSINSENGYLYALRTFDYEQLKDFSFMVEARDGGTPPLSSNATVNIIIVDQNDNAPAI-VSPQGRNGTAKEFLPRTAEPGYLFTRVVAVDSDEGENARLTYSI--LRGNDMSLFRMD 608          
BLAST of Protocadherin-1 vs. Ensembl Xenopus
Match: pcdh10 (protocadherin 10 [Source:NCBI gene;Acc:779938])

HSP 1 Score: 288.115 bits (736), Expect = 6.485e-81
Identity = 207/654 (31.65%), Postives = 319/654 (48.78%), Query Frame = 3
Query:  396 YFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYI-INTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAK---IF---SINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP--------------FLPKSI---YLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLD 2285
            Y E+N  NGV+ +  +IDR+ +C        K+N  C L L +  ++      V  IEV DINDN P + Q+++  + SE +  G    L  A D D G N +  Y I+        SY  ++  T    NK   +LVLKK+LDRE+   + +++ A DGG P   G+  + + V D NDN PVFE+ +Y +S+ EN    T VIQL A D D   NG++ Y  SS   P+   +F I+  +G I +  ELDYE   +  + V+A D+G       C V++ + DLNDN PEI F     T    ++E+ +PG +VA+FSV D+DS ENG++ C +  + +  F   R+ +     Y I T  + DRE  +  T  ++  D G P  +++ S+ V V D+ND +P F++  Y  +V E+  PG Y+  ++ATDKDE  NA +SY I   D +   +F   SIN  +G ++     D E ++   F   A D G P   S A + +I+ D NDN P              FLP++    YL+            +V   D+DEG N+    +++     +L +        +  R +T                        R+    +E+V+E  D G PP S+  +I + ++D
Sbjct:   61 YLELNLENGVLYVNEKIDREQIC--------KQNPSCMLHLEVFLENPLEFFRV-EIEVLDINDNPPVFPQSDIQVEISESATPGTRFPLESAYDLDVGNNSLRTYEITTN------SYFNLDVQTQGDGNKF-AELVLKKQLDREQQALHRYVLTAIDGGTPQRTGTALLTIKVLDSNDNVPVFEQQIYTVSLPENSPPGTMVIQLNATDQDEGQNGEVVYSFSSHNSPKVRDIFGIDPRTGRIEIIGELDYEDSGSYQVYVQAKDLGPNAVPVHCKVLVKVLDLNDNPPEISFS----TVKESVSESASPGTVVALFSVTDRDSEENGQIHCEI--LGDVPF---RLKLSYKNYYTIVTEGTLDREAMATYTVTVLARDRGTPPLSSTKSIQVQVADVNDNSPRFTQAIYNVYVIENNVPGAYISAVSATDKDEEENANISYYILECDIQGMSVFTYVSINSENGYLYALRTFDYEQLKDFSFMVEARDGGTPPLSSNATVNIIIVDQNDNAPAIVSPQGRNGTAKEFLPRTAEPGYLF-----------TRVVAVDSDEGENARLTYSILRGNDMSLFRMDWRTGELRTARKITNK----------------------RDPHRPFELVVEVRDHGQPPLSSTALIQVQIVD 656          

HSP 2 Score: 173.326 bits (438), Expect = 2.927e-43
Identity = 169/590 (28.64%), Postives = 259/590 (43.90%), Query Frame = 3
Query:  900 KVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSG----YIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKV----TCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGK----VFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIY-LYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKL--FRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVK-VKPRTVS-GTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTI---QESHKVCCYVLIVVVKDNGIPRLEDTARLRIII 2609
            +V + V D NDN PVF ++   + ++E+    T      A D D   N    Y+I   T   Y  L       G     + ++ +LD E       ++ A D G  +R  T  + I + D NDN P   FE   +T    + EN  PG +V   +  D+D  +NG+V    + H  P   + F ++    P T   +I  +   D E       ++   D G         V V V D+ND  P  S  +    V+E   PGT +   + TD+D   N  +   I G     F + KL  K    +  E  LDRE++ +   T  A D G P   ST +I V V D+NDN P   ++IY +YV+EN+     +  V+ TD DE  N+     ++            E  IQ +  F  V+ +  N     L            D E    +  ++EA D G PP S+   + I ++D ND  P  + P G N T K   PRT   G    +++A+D DEG+N+ L YS    N  + LF M+  +G++   + I   ++ H+   + L+V V+D+G P L  TA +++ I
Sbjct:  105 RVEIEVLDINDNPPVFPQSDIQVEISESATPGTRFPLESAYDLDVGNNSLRTYEI---TTNSYFNLDVQTQGDGNKFAELVLKKQLDREQQALHRYVLTAIDGGTPQRTGTALLTIKVLDSNDNVP--VFEQQIYT--VSLPENSPPGTMVIQLNATDQDEGQNGEVVYSFSSHNSPKVRDIFGID----PRT--GRIEIIGELDYEDSGSYQVYVQAKDLGPNAVPVHCKVLVKVLDLNDNPPEISFSTVKESVSESASPGTVVALFSVTDRDSEENGQIHCEILGDVP--FRL-KLSYKNYYTIVTEGTLDREAMATYTVTVLARDRGTPPLSSTKSIQVQVADVNDNSPRFTQAIYNVYVIENNVPGAYISAVSATDKDEEENANISYYIL------------ECDIQGMSVFTYVSINSENGYLYAL---------RTFDYEQLKDFSFMVEARDGGTPPLSSNATVNIIIVDQNDNAPAIVSPQGRNGTAKEFLPRTAEPGYLFTRVVAVDSDEGENARLTYSILRGNDMS-LFRMDWRTGELRTARKITNKRDPHRP--FELVVEVRDHGQPPLSSTALIQVQI 654          

HSP 3 Score: 130.568 bits (327), Expect = 5.174e-30
Identity = 131/488 (26.84%), Postives = 216/488 (44.26%), Query Frame = 3
Query: 1227 VIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLE-RMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAK----IFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLP-KSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTL-IKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYS-FKSNNQTNDLFL---MNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIII--ESINGDSILSKENK 2651
            V I + D+NDN P   F  S      +I+E+  PG    + S  D D   N   T   E   N  F+L+ +         ++   K  DREQ++     +   D G P++T +  +++ V D ND  P F ++ Y   + E+  PGT +  +NATD+DEG N  + YS    ++     IF I+   G++ +  +LD E   S     +A D G         + V V D+NDN P +   ++   V E+ +    +   +VTD D   N +    ++ +    L +  K+ Y                          I+ E  LDRE    Y + + A DRG PP S+   I + V DVND  P+F   + +   V V    V G  I+ + A D+DE +N+ + Y   + + Q   +F    +N E+G +   +T  +  ++  +  +V  +D G P L   A + III  ++ N  +I+S + +
Sbjct:  106 VEIEVLDINDNPP--VFPQSDI--QVEISESATPGTRFPLESAYDLDVGNNSLRT--YEITTNSYFNLDVQTQGDGNKFAELVLKKQLDREQQALHRYVLTAIDGGTPQRTGTALLTIKVLDSNDNVPVFEQQIYTVSLPENSPPGTMVIQLNATDQDEGQNGEVVYSFSSHNSPKVRDIFGIDPRTGRIEIIGELDYEDSGSYQVYVQAKDLGPNAVPVHCKVLVKVLDLNDNPPEISFSTVKESVSESASPGTVVALFSVTDRDSEENGQIHCEILGDVPFRLKLSYKNYY-------------------------TIVTEGTLDREAMATYTVTVLARDRGTPPLSSTKSIQVQVADVNDNSPRF---TQAIYNVYVIENNVPGAYISAVSATDKDEEENANISYYILECDIQGMSVFTYVSINSENGYLYALRTF-DYEQLKDFSFMVEARDGGTPPLSSNATVNIIIVDQNDNAPAIVSPQGR 558          

HSP 4 Score: 110.923 bits (276), Expect = 5.988e-24
Identity = 123/416 (29.57%), Postives = 169/416 (40.62%), Query Frame = 3
Query:  237 FTIDIYEELPRKTKVIDLGAQATKWFPTDVNKLQDFGKPIYKFQFFNCEKSSVYFEINPLNGVITIERRIDRDNLCH---------LVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEIT-EFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQI--SSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAK--ITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMN 1442
            +T+ + E  P  T VI L A       TD ++ Q+ G+ +Y F   N  K    F I+P  G I I   +D ++            L P   P                   H  VLV +V D+NDN P  S + +    SE +  G   +L    D D   NG  +  I  ++    +LSY           K    +V +  LDRE +  Y   V A D G P  + +  + V V D NDNSP F +A+Y + V EN      +  + A D D E N  I Y I    +         SI S +GY++     DYE     S +VEA D G     S  TV I I D NDN+P I   P      AK  +     PG L       D D  EN ++T  +  +   + SL RM+
Sbjct:  234 YTVSLPENSPPGTMVIQLNA-------TDQDEGQN-GEVVYSFSSHNSPKVRDIFGIDPRTGRIEIIGELDYEDSGSYQVYVQAKDLGPNAVP------------------VHCKVLV-KVLDLNDNPPEISFSTVKESVSESASPGTVVALFSVTDRDSEENGQIHCEILGDVPFRLKLSY-----------KNYYTIVTEGTLDREAMATYTVTVLARDRGTPPLSSTKSIQVQVADVNDNSPRFTQAIYNVYVIENNVPGAYISAVSATDKDEEENANISYYILECDIQGMSVFTYVSINSENGYLYALRTFDYEQLKDFSFMVEARDGGTPPLSSNATVNIIIVDQNDNAPAI-VSPQGRNGTAKEFLPRTAEPGYLFTRVVAVDSDEGENARLTYSI--LRGNDMSLFRMD 608          
BLAST of Protocadherin-1 vs. Ensembl Xenopus
Match: ENSXETT00000038928.1 (protocadherin gamma-C5-like [Source:NCBI gene;Acc:108646236])

HSP 1 Score: 283.108 bits (723), Expect = 5.634e-80
Identity = 210/649 (32.36%), Postives = 332/649 (51.16%), Query Frame = 3
Query:  381 EKSSVYFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEG-SEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKL------DGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFL--PKSIYLYVLE-----NHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLD 2285
            E+S  +F +NP NG +T+E RIDR++LC          ++ C L + I +++    +  L IE+ DINDNSP +S N+ + + +E  +  G    L +A D D G NGIS Y +S     F LS     +  +        LVL+  LDRE+ +++  I+ A DGG P  +GS ++ + V D NDN PVF+K+ Y + + EN + NT +  L A D D   NG+IEY   S T     +LF +   +G I+++  +DYE      L + A D G       C + + + D NDN PEI       + +  + EN A    VA F+V+D+DS +NG+VT  L P  N  F ++    PL   Y + T +  DRE+ S+    +   D G+P   T  + S+ + DIND AP F + +Y   ++E+  PG++L T++A D DEG+NA L+YS+      + SI+ L       G ++ +   D E+++    T RA DSG+PK  S A ++V + D+NDN+P L  PK     +++     + +A   + +++  D D G N+    +LV +T TTL K                +++  + +        IRE  L      +  +VI  +D G P  ST  II +N+++
Sbjct:   68 ERSRRHFVLNPANGDLTVEERIDRESLC--------GSSSTCVLPIEIVAENPL-ELYSLDIEIIDINDNSPTFSINDHIIKITELLTSPGVQFPLEIAHDADVGKNGISQYKLS-TTPYFSLSVKNRKDGTLIPE-----LVLETVLDREEKEEHRLILTALDGGEPPRSGSCQITINVFDINDNPPVFDKSNYKVKLLENPKLNTVLTTLNATDLDEGKNGEIEYYFDSHTSESAKELFYLNPQTGEIYIKGIVDYEESNFHELSIRAKDKGVPEMEGRCLLQVEVEDANDNPPEIILT----STSTDVPENAALETAVAFFTVRDRDSGKNGEVTLSLSP--NLPFKIK----PLKNHYSLVTDQLLDREKISQYDIQMTAKDLGSPTLQTQVTFSLNISDINDNAPVFLQANYNAIIHENKDPGSFLCTVSAFDSDEGVNAELTYSLVDSKIDVVSISSLVYIDPKSGNIYSQRAFDYENIQVFQITVRAEDSGFPKLFSNATVSVYLLDVNDNYPTLLYPKYSRELIIDERIPSSASAGYLVTKISAVDLDSGHNAWLLFSLVDDTDTTLFK--------------VSAYTGEVRT--------IRE--LQETDYKEQRLVISISDHGEPTLSTTVIILVNIIE 667          

HSP 2 Score: 138.272 bits (347), Expect = 1.533e-32
Identity = 161/589 (27.33%), Postives = 247/589 (41.94%), Query Frame = 3
Query:  909 VAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLK---AIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIH---VRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVT----CHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETD--LDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTV---KVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKI----SLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRI-IIE 2612
            + + D NDNSP F    +II + E L S  P +Q     A DAD   NG  +Y++S  T P ++       +   I    +   LD E      LI+ A D G   R  +C + IN+ D+NDN P   F+ S +    K+ EN     ++   +  D D  +NG++      H    A E F L     P T    I  +   D E+ +     I   D+G P       + V VED ND  P     S    V E+    T +      D+D G N  ++ S+       F I  L     L TD  LDRE +        A D G P   +    ++ + DINDN P FL  +    + EN      L  V+  D+DEG+N+E   +LV         + D   I            +SL  + P    I  +   D E    ++I + A D G P   +   + + +LDVND  P  ++P  S   +   ++     +G  + +I A+D D G N+ L +S   +  T  LF ++  +G++     LQ+T  +  +     L++ + D+G P L  T  + + IIE
Sbjct:  120 IEIIDINDNSPTFSINDHIIKITELLTS--PGVQFPLEIAHDADVGKNGISQYKLS--TTPYFSLSVKNRKDGTLIPELVLETVLDREEKEEHRLILTALDGGEPPRSGSCQITINVFDINDNPP--VFDKSNY--KVKLLENPKLNTVLTTLNATDLDEGKNGEIEYYFDSHTSESAKELFYLN----PQTGEIYIKGI--VDYEESNFHELSIRAKDKGVPEMEGRCLLQVEVEDANDNPPEIILTSTSTDVPENAALETAVAFFTVRDRDSGKNGEVTLSL--SPNLPFKIKPLKNHYSLVTDQLLDREKISQYDIQMTAKDLGSPTLQTQVTFSLNISDINDNAPVFLQANYNAIIHENKDPGSFLCTVSAFDSDEGVNAELTYSLVD-------SKIDVVSI------------SSLVYIDPKSGNIYSQRAFDYENIQVFQITVRAEDSGFPKLFSNATVSVYLLDVNDNYPTLLYPKYSRELIIDERIPSSASAGYLVTKISAVDLDSGHNAWLLFSLVDDTDTT-LFKVSAYTGEVRTIRELQETDYKEQR-----LVISISDHGEPTLSTTVIILVNIIE 667          

HSP 3 Score: 134.42 bits (337), Expect = 2.789e-31
Identity = 133/482 (27.59%), Postives = 210/482 (43.57%), Query Frame = 3
Query: 1233 INIRDLNDNSPEIYFEPSRFTNN---AKITEN-EAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMN------IPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSY---SIFGKDAK-IFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNN----QTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESIN 2621
            I I D+NDNSP        F+ N    KITE   +PG    +    D D  +NG     L       FSL   N      IP  V+  +      DRE+K +    +   D G P ++ S  +++ V DIND  P F + +Y   + E+ K  T L T+NATD DEG N  + Y   S   + AK +F +N   G+++++  +D E       + RA D G P+      + V V+D NDN P  +  S    V EN   +  +    V D D G N E  ++L       +   K+ Y +                         + +  LDRE  ++Y+I + A D G+P   T+    +N+ D+ND  P F+    +N    +      G+ +  + A D DEG N+EL YS   +       + L  ++P+SG I  Q+   +   +  + + V  +D+G P+L   A + + +  +N
Sbjct:  120 IEIIDINDNSP-------TFSINDHIIKITELLTSPGVQFPLEIAHDADVGKNGISQYKLS--TTPYFSLSVKNRKDGTLIPELVLETV-----LDREEKEEHRLILTALDGGEPPRSGSCQITINVFDINDNPPVFDKSNYKVKLLENPKLNTVLTTLNATDLDEGKNGEIEYYFDSHTSESAKELFYLNPQTGEIYIKGIVDYEESNFHELSIRAKDKGVPEMEGRCLLQVEVEDANDNPPEIILTSTSTDVPENAALETAVAFFTVRDRDSGKNGEVTLSLSPNLPFKIKPLKNHYSL-------------------------VTDQLLDREKISQYDIQMTAKDLGSPTLQTQVTFSLNISDINDNAPVFL---QANYNAIIHENKDPGSFLCTVSAFDSDEGVNAELTYSLVDSKIDVVSISSLVYIDPKSGNIYSQRAF-DYENIQVFQITVRAEDSGFPKLFSNATVSVYLLDVN 558          

HSP 4 Score: 95.1301 bits (235), Expect = 4.463e-19
Identity = 99/350 (28.29%), Postives = 166/350 (47.43%), Query Frame = 3
Query: 1629 IFHVNEDVKPGTYL------FTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESV---ESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLY----VLENHTADVPLVQVNVTDADEGLN--SETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNN--QTNDLFLMNPESGKISLQQTI--QESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESIN 2621
            IF V+E+++PG+ +        IN  D  +    L S     +  + F +N  +G + +E  +DRES+    S         +  P +L + +I +I  DINDN P    + ++     +L +     PL   +  DAD G N  S+ K++     + ++  RKD                    +L+P+   ++ E+ LDRE   ++ +++ A D G PP+S    I INV D+ND  P F     SN  VK+       T +  + A D DEGKN E+EY F S+      +LF +NP++G+I ++  +  +ES+    + L +  KD G+P +E    L++ +E  N
Sbjct:   31 IFSVDEEMEPGSVVGNVALALGINLADIAKRRLHLGS----ERSRRHFVLNPANGDLTVEERIDRESLCGSSSTCVLPIEIVAENPLELYSLDIEII--DINDNSPTFSINDHIIKITELLTSPGVQFPLEIAH--DADVGKNGISQYKLSTTPYFSLSVKNRKDG-------------------TLIPE---LVLETVLDREEKEEHRLILTALDGGEPPRSGSCQITINVFDINDNPPVF---DKSNYKVKLLENPKLNTVLTTLNATDLDEGKNGEIEYYFDSHTSESAKELFYLNPQTGEIYIKGIVDYEESN---FHELSIRAKDKGVPEMEGRCLLQVEVEDAN 344          
BLAST of Protocadherin-1 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 282.722 bits (722), Expect = 6.333e-79
Identity = 237/776 (30.54%), Postives = 365/776 (47.04%), Query Frame = 3
Query:  339 DFGKPIYKFQFFNCEKSSVYFEINPLNG-VITIERRIDRDNL--CHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLV---IEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNN----AKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLT---VMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEK--SYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAK--IFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVK-VKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIII 2609
            D+G P  K   +  E    Y  ++   G + T E  IDR++L  C  +     +   +C L+  +   D  S +  L+   IE+ DINDN+P ++   +     E + IG    +  A D D G NG+S Y +   I   E   +         +++Q +L++   LDRE+ D Y+  +   DGG P+   S  + +++ D NDN+P FEK  Y   + EN      V+Q+KA D+D  +N +I+Y     +     +L  ++ ++G I V+  +D E   T+   V A D G   + +   V I IRD NDN P I         +    A I+E+      VA+  V D D   N  VTC +    +  F L++++   +     Y + T  + D E   + T  IV  D GNP  +++ S+ V V D+ND AP FS+     +F  N D+     +  ++ATD D G N+ L YSI    +   IFSIN   G++ + T LDRE  E   F   A D G P    TA++ + V D NDN P F+       V+EN     P+  V V DAD+G N+   +++  E+         E+ IQ     +  S S                   DRE  + Y   ++A D G+PP+S+   + INVLD ND  P  + P  SN + K + P+T  GT +  + A D D G N+EL+YS  S N   +LF ++  +G+++L++ I   H    + L+V V D G P    TA +   I
Sbjct:   89 DYGYPDSK-HLYKLELGHPYLRVDGKTGDIYTTETSIDRESLRECQNL-----EPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYEL---IVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASD-TVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVA--GDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDIN--DLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESG--------EFVIQNGTGTILSSIS------------------FDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVP--SNISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPF-ELFQISHNNGEVTLEKAIIRKH-YGLHRLVVKVTDKGKPSRHGTALVHFYI 820          
BLAST of Protocadherin-1 vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 298.901 bits (764), Expect = 1.433e-84
Identity = 237/778 (30.46%), Postives = 366/778 (47.04%), Query Frame = 3
Query:  339 DFGKPIYKFQFFNCEKSSVYFEINPLNG-VITIERRIDRDNL--CH-LVPTCCPKKNNQCNLDLTIKSDD----DFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSI--SPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYA-KLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNN----AKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLT---VMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAK--IFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIII 2609
            D+G P      +  E  + Y  ++   G + T E  IDR+ L  C   +P       N C L+  +   D        ++   IEV+DINDN+P ++   +     E + IG    + +A D D G NG++ Y +   PE  E     +          ++Q +L++   LDRE+ D Y+  +   DGGNP    S  + V V D NDN+P FE+  Y   ++EN      VIQ+KA D+D   N +I+Y       PE   +L  ++ N+G I V+  +D E  +T+   V A D G   + +   V++ ++D+NDN+P I         +    A I+E+ A    VA+  V D+D  EN  VTC +    +  F L + +   +     Y + T    D E+    T  IV  D GNP  +++ S+ V V D+ND AP F++        E+ KPG  +  + A+D D G NA L YS+  + A   +F+I+  +G++ ++T LDRE  +S      AAD G P    TA + V V D NDN P F+       V+EN  A  P+  V V D D+G N+  ++++  +          ++ IQ     +  S S                   DRE  + Y   ++A D G PP+S    + INVLD ND  P    PS ++  + + P+T  G T++Q+ A D D G N+EL YS    N    LF +   SG I+L++ I+  H    + L+V V D G P    TA + + +
Sbjct:   58 DYGLPDVG-HLYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRECQNQIP------GNPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPEAQE-----LFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQ--APEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVV--AGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNG--------DFVIQNGTGTILSSLS------------------FDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRL-LTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGNPYG-LFQIGSHSGAITLEKEIERRHH-GLHRLVVKVSDRGKPPRYGTALVHLYV 790          
BLAST of Protocadherin-1 vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 298.901 bits (764), Expect = 1.433e-84
Identity = 237/778 (30.46%), Postives = 366/778 (47.04%), Query Frame = 3
Query:  339 DFGKPIYKFQFFNCEKSSVYFEINPLNG-VITIERRIDRDNL--CH-LVPTCCPKKNNQCNLDLTIKSDD----DFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSI--SPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYA-KLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNN----AKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLT---VMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAK--IFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIII 2609
            D+G P      +  E  + Y  ++   G + T E  IDR+ L  C   +P       N C L+  +   D        ++   IEV+DINDN+P ++   +     E + IG    + +A D D G NG++ Y +   PE  E     +          ++Q +L++   LDRE+ D Y+  +   DGGNP    S  + V V D NDN+P FE+  Y   ++EN      VIQ+KA D+D   N +I+Y       PE   +L  ++ N+G I V+  +D E  +T+   V A D G   + +   V++ ++D+NDN+P I         +    A I+E+ A    VA+  V D+D  EN  VTC +    +  F L + +   +     Y + T    D E+    T  IV  D GNP  +++ S+ V V D+ND AP F++        E+ KPG  +  + A+D D G NA L YS+  + A   +F+I+  +G++ ++T LDRE  +S      AAD G P    TA + V V D NDN P F+       V+EN  A  P+  V V D D+G N+  ++++  +          ++ IQ     +  S S                   DRE  + Y   ++A D G PP+S    + INVLD ND  P    PS ++  + + P+T  G T++Q+ A D D G N+EL YS    N    LF +   SG I+L++ I+  H    + L+V V D G P    TA + + +
Sbjct:   58 DYGLPDVG-HLYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRECQNQIP------GNPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPEAQE-----LFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQ--APEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVV--AGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNG--------DFVIQNGTGTILSSLS------------------FDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRL-LTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGNPYG-LFQIGSHSGAITLEKEIERRHH-GLHRLVVKVSDRGKPPRYGTALVHLYV 790          
BLAST of Protocadherin-1 vs. Ensembl Mouse
Match: Pcdh10 (protocadherin 10 [Source:MGI Symbol;Acc:MGI:1338042])

HSP 1 Score: 279.641 bits (714), Expect = 8.370e-79
Identity = 214/674 (31.75%), Postives = 318/674 (47.18%), Query Frame = 3
Query:  396 YFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYI-INTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSF-------------------NGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFG---KDAKIF---SINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLS-TANITVIVKDINDNFP----------------FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKL-IIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLD 2285
            Y ++N   GV+ +  +IDR+ +C   P+C         L L +  ++    +  + IEV DINDN P + + +L  + SE +  G    L  A D D GTN +  Y I+P       SY  ++  T    N+   +LVL+K LDRE+   + +++ A DGG                        G+  + + V D NDN P F++ VY +S+ EN    T VIQL A D D   NG++ Y  SS   P   +LF +   +G + V  ELDYE      + V+A D+G     + C V++ + D NDN+PEI F     T    ++E  APG +VA+FSV D+DS ENG+V C L  + +  F   R+       Y I T    DRE     T  +V  D G P  +TS S+ V V D+ND AP FS+  Y  +V E+  PG Y++ ++ATD+DEG NA L+YSI     +   +F   SIN  +G ++     D E ++   F   A D+G P+ L+  A + +++ D NDN P                 LP+S     L        L +V   DAD+G N+    ++V         R +E     LFR   ++           G+L   R     R+    YE+VIE  D G PP S+   + + ++D
Sbjct:   63 YLDLNLETGVLYVNEKIDREQICKQSPSCV--------LHLEVFLENPL-ELFRVEIEVLDINDNPPSFPEPDLTVEISESATPGTRFPLESAFDPDVGTNSLRDYEITPN------SYFSLDVQTQGDGNRF-AELVLEKPLDREQQAVHRYVLTAVDGGGGGGGGEGGGGGGGAGLPPQQQRTGTALLTIRVLDSNDNVPAFDQPVYTVSLPENSPPGTLVIQLNATDPDEGQNGEVVYSFSSHISPRARELFGLSPRTGRLEVSGELDYEESPVYQVYVQAKDLGPNAVPAHCKVLVRVLDANDNAPEISFS----TVKEAVSEGAAPGTVVALFSVTDRDSEENGQVQCEL--LGDVPF---RLKSSFKNYYTIVTEAPLDREAGDSYTLTVVARDRGEPALSTSKSIQVQVSDVNDNAPRFSQPVYDVYVTENNVPGAYIYAVSATDRDEGANAKLTYSILECQIQGMSVFTYVSINSDNGYLYALRSFDYEQIKDFSFQVEARDAGSPQALAGNATVNILIVDQNDNAPAIVAPLPGRNGTPAREVLPRSAEPGYL--------LTRVAAVDADDGENARLTYSIV---------RGNE---MNLFRLDWRT-----------GELRTARRVPAKRDPQRPYELVIEVRDHGQPPLSSTATLVVQLVD 680          

HSP 2 Score: 147.132 bits (370), Expect = 2.199e-35
Identity = 165/613 (26.92%), Postives = 258/613 (42.09%), Query Frame = 3
Query:  900 KVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSG----YIHVRWELDYETYTTISLIVEANDMGNL-------------------RRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKV----TCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDA-KIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIY-LYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKL--FRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVL--DVNDCKPKFIFP-SGSNSTV--KVKPRTV-SGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVC-CYVLIVVVKDNGIPRLEDTARLRIIIESING 2624
            +V + V D NDN P F +    + ++E+    T      A D D   N   +Y+I   T   Y  L       G     + +   LD E       ++ A D G                     +R  T  + I + D NDN P   F+   +T    + EN  PG LV   +  D D  +NG+V    + H+ P A E F L     P T   ++S     D E+      ++   D G         V V V D ND AP  S  +    V+E   PGT +   + TD+D   N  +   + G    ++ S  K    +  E  LDRE+ +S   T  A D G P   ++ +I V V D+NDN P   + +Y +YV EN+     +  V+ TD DEG N++   +++            E  IQ +  F  V+ +  N     L            D E    +   +EA D G+P ++  G   +N+L  D ND  P  + P  G N T   +V PR+   G  + ++ A+D D+G+N+ L YS    N+ N LF ++  +G++   + +         Y L++ V+D+G P L  TA L  +++ ++G
Sbjct:  107 RVEIEVLDINDNPPSFPEPDLTVEISESATPGTRFPLESAFDPDVGTNSLRDYEI---TPNSYFSLDVQTQGDGNRFAELVLEKPLDREQQAVHRYVLTAVDGGGGGGGGEGGGGGGGAGLPPQQQRTGTALLTIRVLDSNDNVPA--FDQPVYT--VSLPENSPPGTLVIQLNATDPDEGQNGEVVYSFSSHISPRARELFGLS----PRTGRLEVS--GELDYEESPVYQVYVQAKDLGPNAVPAHCKVLVRVLDANDNAPEISFSTVKEAVSEGAAPGTVVALFSVTDRDSEENGQVQCELLGDVPFRLKSSFKNYYTIVTEAPLDREAGDSYTLTVVARDRGEPALSTSKSIQVQVSDVNDNAPRFSQPVYDVYVTENNVPGAYIYAVSATDRDEGANAKLTYSIL------------ECQIQGMSVFTYVSINSDNGYLYAL---------RSFDYEQIKDFSFQVEARDAGSP-QALAGNATVNILIVDQNDNAPAIVAPLPGRNGTPAREVLPRSAEPGYLLTRVAAVDADDGENARLTYSIVRGNEMN-LFRLDWRTGELRTARRVPAKRDPQRPYELVIEVRDHGQPPLSSTATL--VVQLVDG 681          
BLAST of Protocadherin-1 vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 280.796 bits (717), Expect = 2.969e-78
Identity = 214/689 (31.06%), Postives = 330/689 (47.90%), Query Frame = 3
Query:  582 NDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSI--SPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYA-KLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNN----AKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLT---VMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAK--IFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIII 2609
            NDN+P ++   +     E + IG    + +A D D G NG++ Y +   PE  E     +          ++Q +L++   LDRE+ D Y+  +   DGGNP    S  + V V D NDN+P FE+  Y   ++EN      VIQ+KA D+D   N +I+Y       PE   +L  ++ N+G I V+  +D E  +T+   V A D G   + +   V++ ++D+NDN+P I         +    A I+E+ A    VA+  V D+D  EN  VTC +    +  F L + +   +     Y + T    D E+    T  IV  D GNP  +++ S+ V V D+ND AP F++        E+ KPG  +  + A+D D G NA L YS+  + A   +F+I+  +G++ ++T LDRE  +S      AAD G P    TA + V V D NDN P F+       V+EN  A  P+  V V D D+G N+  ++++  +          ++ IQ     +  S S                   DRE  + Y   ++A D G PP+S    + INVLD ND  P    PS ++  + + P+T  G T++Q+ A D D G N+EL YS    N    LF +   SG I+L++ I+  H    + L+V V D G P    TA + + +
Sbjct:    1 NDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPEAQE-----LFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQ--APEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVV--AGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNG--------DFVIQNGTGTILSSLS------------------FDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRL-LTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGNPYG-LFQIGSHSGAITLEKEIERRHH-GLHRLVVKVSDRGKPPRYGTALVHLYV 651          

HSP 2 Score: 160.614 bits (405), Expect = 1.915e-39
Identity = 159/611 (26.02%), Postives = 255/611 (41.73%), Query Frame = 3
Query:  513 DLTIKSDDDF----SHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNG-ISY-YSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFE-KAVYIIS-------VNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSG---YIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHL--EPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFL--PKSIYLYVLENHTADVPLV-QVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINV 2279
            DLTIK  D      +   +L + V D NDN+P + +     + SE S IG S     A D+D G N  I Y +  +PE+    L    NT  +               +DRE +    F V A D G    +   +V+V V D NDN+P  E + + +++       ++E++   T V  ++  D D   N  +   ++     +  +     S+S    ++     LDYE     ++ + A D GN    ST ++ + + D+NDN+P      ++        EN  PG++VA  +  D DS  N ++   L  EP A   F++   N       +I    S DREQ+      +V  D G+P    + +V V V D ND  P F    Y F V E++   + +  +   D D+G NA +  S+  +D   F I    G +      DRE   +  F  +A D G P + +   +T+ V D NDN PF+  P +    +L   T     V QV   D D G+N+E                        L   +       LF +      I  E  ++R     + +V++ +DRG PP+    ++++ V
Sbjct:   86 DLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQAPEVVRRLLRLDRNTGLITVQGP----------VDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVF----TQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPEN------GEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVE-QDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRLLTPQTRLGETVSQVTAEDIDSGINAE------------------------LTYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYV 651          

HSP 3 Score: 65.4698 bits (158), Expect = 4.129e-10
Identity = 68/281 (24.20%), Postives = 114/281 (40.57%), Query Frame = 3
Query:  399 FEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEK----AVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTV 1229
            F I+P NG I ++  +DR+           + + +  +    +          +++ V D NDN P +  +       E         +   +D D G N     S+  +  +F +     T T++ S             DRE+   Y F + A DGG P  +  + V + V DENDN+P        +  +++    L     V Q+ A D DS +N ++ Y I+      Y  LF I S+SG I +  E++   +    L+V+ +D G   R  T  V
Sbjct:  394 FTISPENGEIRVKTSLDREQ----------RDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNGDFVIQN--GTGTILSS----------LSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRLLTPQTRLGET--VSQVTAEDIDSGINAELTYSIAGGNP--YG-LFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALV 647          
BLAST of Protocadherin-1 vs. Ensembl Mouse
Match: Pcdhgb8 (protocadherin gamma subfamily B, 8 [Source:MGI Symbol;Acc:MGI:1935200])

HSP 1 Score: 278.485 bits (711), Expect = 3.679e-78
Identity = 210/666 (31.53%), Postives = 326/666 (48.95%), Query Frame = 3
Query:  327 NKLQDFGKPIYKFQFFNCE--KSSVYFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAK------IFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFL------PKSIYLYVLENHTADVP--LVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSL-LPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYI 2273
            N  +D G P+      N        Y  +NP NG I +  RIDR+ LC   P C         L L I +++  +   V V+ ++DINDN P + QN +V Q +E +  G    L  A+D D G N +  Y +S  + E   S ++  NT     K+  +LVL+K LDREK      ++ A DGG P   G+ ++ + VTD NDN PVF ++ Y +S+ E++ + T V+ + A D D  +N ++ Y   SL + +    F ++  SG I  +  +D+ET  T ++ +EA D G +   S C V++ I D NDN+PE+ F  +  +N+  ITE+  PG +VA+F   DKDS ENG+V+C ++     E    R+    +  YK+ T    DREQ  +    I+  D+G P  ++S SV++ V DIND AP F + SY+  V E+  PG  +  ++A D D G N  +SYSI   D +        S+N+  G VF +   D E + S   T +A D G P   +  ++ V+V D NDN P +      P    L+ +    A+    + +V   DAD G N+                         L   V ++    LFSL L  G++    +  DR+ + +  +++   D G PP S    +++
Sbjct:   50 NLAEDLGLPVQDLLTRNLRVIAEKPYLSVNPENGNIVVSDRIDREFLCFQSPLCV--------LPLEIVAENPLNVFHVSVV-IEDINDNPPRFLQNSIVLQINELAIPGTRFGLESAIDADVGLNSLQSYQLS--LNE-HFSLVVKDNT---EGKDAPELVLEKPLDREKQSSQLLVLTAVDGGEPVLTGTAQIQIEVTDANDNPPVFSQSTYKVSLREDMAAGTSVLTVIATDQDEGVNAEVTYSFKSLGE-DIRDKFILDHQSGEIKSKGPIDFETKRTYTMNIEAKDGGGM--ASECKVVVEILDENDNAPEVVF--TSVSNS--ITEDAEPGTVVALFKTYDKDSEENGRVSCFVK-----ETVPFRIESSASNYYKLVTDGILDREQTPEYNVTIIATDKGKPPLSSSTSVTLHVGDINDNAPVFHQTSYLIQVAENNPPGASIAQVSAFDPDLGSNGFISYSIIASDLEPKSLWSYVSVNQDSGVVFAQRAFDHEQLRSFQLTLQARDQGKPSLSANVSMRVLVGDRNDNAPRVLYPTLEPDGSALFDMVPRAAEPGYLVTKVVAVDADSGHNA------------------------WLSYHVLQASDPGLFSLGLRTGEVRTARALGDRD-SARQRLLVAVRDGGQPPLSATATLHL 663          

HSP 2 Score: 142.124 bits (357), Expect = 8.613e-34
Identity = 158/611 (25.86%), Postives = 255/611 (41.73%), Query Frame = 3
Query:  903 VIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGY----IHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIA---NEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVF-LETD--LDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLY-VLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPS---GSNSTVKVKPRTV-SGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESINGDSILSKENKMKDNVEYSNEESD 2690
            V V + D NDN P F +   ++ +NE     T      AIDAD  +N    YQ+S     E+  L   ++  G     + +   LD E  ++  L++ A D G      T  + I + D NDN P      S+ T    + E+ A G  V      D+D   N +VT   + +     ++F L+  +       +I +    D E K   T +I   D G     +   V V + D ND AP     S    + ED +PGT +      DKD   N  +S   F K+   F I       + L TD  LDRE     + T  A D G P   S+ ++T+ V DINDN P   ++ YL  V EN+     + QV+  D D G N     ++++                    D+      S  S+  D  ++  +   D E    +++ ++A D+G P  S    + + V D ND  P+ ++P+     ++   + PR    G  + +++A+D D G N+ L Y     +    LF +   +G++   + + +        L+V V+D G P L  TA L +I      DS+      ++D    S+ +S+
Sbjct:  120 VSVVIEDINDNPPRFLQNSIVLQINELAIPGTRFGLESAIDADVGLNSLQSYQLS---LNEHFSLVVKDNTEGKDAPELVLEKPLDREKQSSQLLVLTAVDGGEPVLTGTAQIQIEVTDANDNPPVF----SQSTYKVSLREDMAAGTSVLTVIATDQDEGVNAEVTYSFKSLGEDIRDKFILDHQS------GEIKSKGPIDFETKRTYTMNIEAKDGGG--MASECKVVVEILDENDNAPEVVFTSVSNSITEDAEPGTVVALFKTYDKDSEENGRVS--CFVKETVPFRIESSASNYYKLVTDGILDREQTPEYNVTIIATDKGKPPLSSSTSVTLHVGDINDNAPVFHQTSYLIQVAENNPPGASIAQVSAFDPDLGSNGFISYSIIAS-------------------DLEPKSLWSYVSVNQDSGVVFAQRAFDHEQLRSFQLTLQARDQGKPSLSANVSMRVLVGDRNDNAPRVLYPTLEPDGSALFDMVPRAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASDPG-LFSLGLRTGEVRTARALGDRDS-ARQRLLVAVRDGGQPPLSATATLHLIF----ADSLQEVLPDLRDEPLLSDSQSE 688          
BLAST of Protocadherin-1 vs. UniProt/SwissProt
Match: sp|Q08174|PCDH1_HUMAN (Protocadherin-1 OS=Homo sapiens OX=9606 GN=PCDH1 PE=1 SV=2)

HSP 1 Score: 296.204 bits (757), Expect = 1.097e-82
Identity = 241/795 (30.31%), Postives = 372/795 (46.79%), Query Frame = 3
Query:  339 DFGKPIYKFQFFNCEKSSVYFEINPLNG-VITIERRIDRDNLCHLVPTCCPKK--NNQCNLDLTIKSDD----DFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSI--SPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYA-KLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNN----AKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLT---VMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAK--IFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARL----------RIIIESINGDSI 2633
            D+G P      +  E  + Y  ++   G + T E  IDR+ L       C  +   + C L+  +   D        ++   IEV+DINDN+P ++   +     E + IG    + +A D D G NG++ Y +   PE  E     +          ++Q +L++   LDRE+ D Y+  +   DGG+P    S  + V V D NDN+P FE+  Y   ++EN      VIQ+KA D+D   N +IEY       PE   +L  ++ N+G I V+  +D E  +T+   V A D G   + +   V++ ++D+NDN+P I         +    A I+E+ A    VA+  V D+D  EN  VTC +    +  F L + +   +     Y + T    D E+    T  IV  D GNP  +++ S+ V V D+ND AP F++        E+ KPG  +  I A+D D G NA L YS+  + A   +F+I+   G++ ++T LDRE  ES      AAD G P    TA + V V D NDN P F+       V+EN  A  P+  V V D D+G N++ ++++  +          ++ IQ     +  S S                   DRE  + Y   ++A D G PP+S    + INVLD ND  P    PS ++  + + P+T  G T++Q+ A D D G N+EL YS    N    LF +   SG I+L++ I+  H    + L+V V D G P    TA +          R ++E++ G S+
Sbjct:   80 DYGFPDVG-HLYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRE-----CQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQE-----LFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQ--APEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVV--AGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVEQDNG--------DFVIQNGTGTILSSLS------------------FDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKL-LTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPYG-LFQIGSHSGAITLEKEIERRHH-GLHRLVVKVSDRGKPPRYGTALVHLYVNETLANRTLLETLLGHSL 830          
BLAST of Protocadherin-1 vs. UniProt/SwissProt
Match: sp|Q9P2E7|PCD10_HUMAN (Protocadherin-10 OS=Homo sapiens OX=9606 GN=PCDH10 PE=2 SV=2)

HSP 1 Score: 280.411 bits (716), Expect = 2.161e-77
Identity = 212/673 (31.50%), Postives = 316/673 (46.95%), Query Frame = 3
Query:  396 YFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSF-------------------NGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFG---KDAKIF---SINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLS-TANITVIVKDINDNFP----------------FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKL-IIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLD 2285
            Y ++N   GV+ +  +IDR+ +C   P+C         L L +  ++    +  + IEV DINDN P + + +L  + SE +  G    L  A D D GTN +  Y I+P  + F L      +   ++      LVL+K LDRE+   + +++ A DGG                        G+  + + V D NDN P F++ VY +S+ EN    T VIQL A D D   NG++ Y  SS   P   +LF +   +G + V  ELDYE      + V+A D+G     + C V++ + D NDN+PEI F     T    ++E  APG +VA+FSV D+DS ENG+V C L  + +  F   R+       Y I T    DRE     T  +V  D G P  +TS S+ V V D+ND AP FS+  Y  +V E+  PG Y++ ++ATD+DEG NA L+YSI     +   +F   SIN  +G ++     D E ++   F   A D+G P+ L+  A + +++ D NDN P                 LP+S     L        L +V   DAD+G N+    ++V         R +E     LFR   ++           G+L   R     R+    YE+VIE  D G PP S+   + + ++D
Sbjct:   63 YLDLNLETGVLYVNEKIDREQICKQSPSCV--------LHLEVFLENPL-ELFQVEIEVLDINDNPPSFPEPDLTVEISESATPGTRFPLESAFDPDVGTNSLRDYEITPN-SYFSLDVQTQGDGNRFAE-----LVLEKPLDREQQAVHRYVLTAVDGGGGGGVGEGGGGGGGAGLPPQQQRTGTALLTIRVLDSNDNVPAFDQPVYTVSLPENSPPGTLVIQLNATDPDEGQNGEVVYSFSSHISPRARELFGLSPRTGRLEVSGELDYEESPVYQVYVQAKDLGPNAVPAHCKVLVRVLDANDNAPEISFS----TVKEAVSEGAAPGTVVALFSVTDRDSEENGQVQCEL--LGDVPF---RLKSSFKNYYTIVTEAPLDREAGDSYTLTVVARDRGEPALSTSKSIQVQVSDVNDNAPRFSQPVYDVYVTENNVPGAYIYAVSATDRDEGANAQLAYSILECQIQGMSVFTYVSINSENGYLYALRSFDYEQLKDFSFQVEARDAGSPQALAGNATVNILIVDQNDNAPAIVAPLPGRNGTPAREVLPRSAEPGYL--------LTRVAAVDADDGENARLTYSIV---------RGNE---MNLFRMDWRT-----------GELRTARRVPAKRDPQRPYELVIEVRDHGQPPLSSTATLVVQLVD 680          

HSP 2 Score: 149.828 bits (377), Expect = 3.506e-35
Identity = 166/613 (27.08%), Postives = 258/613 (42.09%), Query Frame = 3
Query:  900 KVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSG----YIHVRWELDYETYTTISLIVEANDMGNL-------------------RRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKV----TCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDA-KIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIY-LYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKL--FRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVL--DVNDCKPKFIFP-SGSNSTV--KVKPRTV-SGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVC-CYVLIVVVKDNGIPRLEDTARLRIIIESING 2624
            +V + V D NDN P F +    + ++E+    T      A D D   N   +Y+I   T   Y  L       G     + +   LD E       ++ A D G                     +R  T  + I + D NDN P   F+   +T    + EN  PG LV   +  D D  +NG+V    + H+ P A E F L     P T   ++S     D E+      ++   D G         V V V D ND AP  S  +    V+E   PGT +   + TD+D   N  +   + G    ++ S  K    +  E  LDRE+ +S   T  A D G P   ++ +I V V D+NDN P   + +Y +YV EN+     +  V+ TD DEG N++   +++            E  IQ +  F  V+ +  N     L            D E    +   +EA D G+P ++  G   +N+L  D ND  P  + P  G N T   +V PR+   G  + ++ A+D D+G+N+ L YS    N+ N LF M+  +G++   + +         Y L++ V+D+G P L  TA L  +++ ++G
Sbjct:  107 QVEIEVLDINDNPPSFPEPDLTVEISESATPGTRFPLESAFDPDVGTNSLRDYEI---TPNSYFSLDVQTQGDGNRFAELVLEKPLDREQQAVHRYVLTAVDGGGGGGVGEGGGGGGGAGLPPQQQRTGTALLTIRVLDSNDNVPA--FDQPVYT--VSLPENSPPGTLVIQLNATDPDEGQNGEVVYSFSSHISPRARELFGLS----PRTGRLEVS--GELDYEESPVYQVYVQAKDLGPNAVPAHCKVLVRVLDANDNAPEISFSTVKEAVSEGAAPGTVVALFSVTDRDSEENGQVQCELLGDVPFRLKSSFKNYYTIVTEAPLDREAGDSYTLTVVARDRGEPALSTSKSIQVQVSDVNDNAPRFSQPVYDVYVTENNVPGAYIYAVSATDRDEGANAQLAYSIL------------ECQIQGMSVFTYVSINSENGYLYAL---------RSFDYEQLKDFSFQVEARDAGSP-QALAGNATVNILIVDQNDNAPAIVAPLPGRNGTPAREVLPRSAEPGYLLTRVAAVDADDGENARLTYSIVRGNEMN-LFRMDWRTGELRTARRVPAKRDPQRPYELVIEVRDHGQPPLSSTATL--VVQLVDG 681          
BLAST of Protocadherin-1 vs. UniProt/SwissProt
Match: sp|Q9HC56|PCDH9_HUMAN (Protocadherin-9 OS=Homo sapiens OX=9606 GN=PCDH9 PE=1 SV=2)

HSP 1 Score: 281.182 bits (718), Expect = 6.183e-77
Identity = 225/723 (31.12%), Postives = 348/723 (48.13%), Query Frame = 3
Query:  423 VITIERRIDRDNLCHLVPTCCPKKNNQCNLDL-TIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEI--YFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKP-RTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPR 2576
            + T   RIDR+ LC         + N+C  +L  +   +DF  +I + I VKD NDN+P +    +     E + I     +  A D D G NG+ +Y +    + F L  I+ T       ++  +L++++ LDRE+ D Y   +   DGG P  + +  + V V+D NDN PVF++    + + EN    T VIQL A DAD   N +I Y   +   P   +LF++ + +G I V+  LD E      + V A+D  +    +  TV IN+ D+NDN P I   +  S       ++E +     +A+ +V DKD++ NGKV C +E      F L+ +       Y + T    D E   + +  IV  D G P    +  V V +ED ND  P F++      V+E+ + G YL TI+ATD+D G NA + Y + G +A  F +++  G +      DRE  E   FT  A D+G P   S A + V V D NDN P F       +V EN      +  + VTDAD G N    ++++++                          N  F L P   +I      DRE  + Y   ++ATD G PP+S+   + INV+DVND  P  I P  SN++ K+ P   + G+ +A++ A+D D G N+EL+Y+  S N    LF ++P +G I+L++    +  V  + L+V + D G P+
Sbjct:   85 IFTTSNRIDREKLCA---GASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLD-IVETP----EGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--ARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIE--REVPFHLKAV---YDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQL-GPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILND--------------------------NDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPP-SNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSGNNKG-LFRIDPVTGNITLEEKPAPT-DVGLHRLVVNISDLGYPK 762          

HSP 2 Score: 152.91 bits (385), Expect = 4.270e-36
Identity = 169/617 (27.39%), Postives = 264/617 (42.79%), Query Frame = 3
Query:  243 IDIYEELPRKTKVIDLGAQATKWFPTDVNKLQDFGKPIYKFQFFNCEKSSVYFEINPLNGVITIERRIDRDNLC-HLVPTCCPKKNNQCNLDLTIKSDDDFS--HIIVLVIEVKDINDNSPFWSQNELVTQ------FSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNA---KITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHF----SEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIF-GKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLV 2042
            + I E  P  T VI L A       TD + +    +  Y F       +   F +N   G+IT++R +DR+    H V               T+ + D  S      + I V D+NDN P      +++        SE   +    +L    D D   NG     I  E+  F L  + +   ++ ++           LD E   ++ F + A D G PS N +  V V + DENDN P+F + V  +SV+EN +    +  + A D DS  N  I YQ+        A  F ++  +G +      D E        V A D G     S   VI+ + D NDNSP       +FT+N     ++EN      V V +V D D+ EN  VT  +    N+ F L+    P + + K +   SFDREQ+S  T  +   D G P ++++  V++ V D+ND +P      S  S+   V     PG+ +  + A D D G+NA L Y+I  G +  +F I+ + G + LE       V         +D GYPK L T  + ++   +ND       + Y+Y L   T + PL + N+ D+ +   +E  +T++
Sbjct:  259 VHIPENAPVGTSVIQLHA-------TDAD-IGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKV---------------TVLASDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREV-PFHLKAVYDNQYLLETSS---------LLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGP-----NASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSP-------KFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSIL-NDNDNFVLD----PYSGVIKSNV--SFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKL-VPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKSLHT--LVLVFLYVNDT---AGNASYIYDLIRRTMETPLDR-NIGDSSQPYQNEDYLTIM 816          

HSP 3 Score: 127.872 bits (320), Expect = 2.414e-28
Identity = 141/585 (24.10%), Postives = 254/585 (43.42%), Query Frame = 3
Query:  963 IISVNENLQSNTPV------IQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYI--------------HVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEE-FSLERMNIPLTVMY-KISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDA-----KIFSINKLDGKVFLETDLDRESVESLHFTTRAAD-SGYPKQLSTANITVIVKDINDNFPFL-------PKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGL-DREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIII 2609
            I ++ E L  N P+      + +  I+A +  +  + Y++  ++K   A L  + S++G I                 +  + E +  + +++  ND   L +     + I ++D NDN+P     PS   N   I EN        + S  D D+  NG    H E +  +  F L+ +  P    + ++   ++ DREQK      I   D G P+++++  + V V D+ND  P F E     H+ E+   GT +  ++ATD D G NA + Y IFG        ++F++N   G + ++  LDRE       T  A+D S  P +   A +T+ V D+NDN P +       P +  +Y+ E    +  +  + V+D D  +N +             I+R+  + ++ ++                D + ++  S L D E T ++   I A+D G P  +   ++ + + D ND  P F  P    S  +   R +  TTI+   A DED GKN+++ Y    N      F ++ ++G ++  +      +   ++  V  +DNG P L+  A + + +
Sbjct:   27 IYTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRL--VSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRLIK-----IKIIVKDTNDNAPMF---PSPVIN-ISIPENTLINSRFPIPSATDPDTGFNG--VQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRY-IFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPAR---ATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGK---------VICFIEREVPFHLKAVY----------------DNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTIS---ATDEDSGKNADIVYQLGPNAS---FFDLDRKTGVLTASRVFDREEQER-FIFTVTARDNGTPPLQSQAAVIVTV 562          
BLAST of Protocadherin-1 vs. UniProt/SwissProt
Match: sp|Q6X862|PC11X_GORGO (Protocadherin-11 X-linked OS=Gorilla gorilla gorilla OX=9595 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 278.1 bits (710), Expect = 1.433e-75
Identity = 219/708 (30.93%), Postives = 336/708 (47.46%), Query Frame = 3
Query:  423 VITIERRIDRDNLCHLVPTCCPKKNNQC--NLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSP--EIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTC--------HLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKI-FSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIY-LYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQ 2504
            + T   RIDR+ LC  +P     ++  C   +++ I  D+ F  ++ +   ++DINDN+P +    +     E S I    +L  A+D D G NG+  Y +      F L  I           +  +L+++K+LDREK D Y   V   DGG P  + +  + V+VTD NDN PVF++    +S+ EN    T V QL A DAD   N KI +  S+L      +LF + + +G I ++  LD E      L+V A+D G +   +   V++N+ D+NDN P  +I +  +   +   ++EN      +A+ +V DKD++ NG+VTC         L P+ + +F LE             T    D E   +    ++  D G P    S  + + V+D ND AP F++      + E+  PG  L  ++ATD D G NA ++Y + G DA   FS+++  G + +   LDRE  +   FT  A D+G P   S   + V + D NDN P    + Y  YV EN      +  + VTD D G NS   ++++ E                          N  F++     +I      DRE    Y   ++A D G   +S+   + INV+DVND KP FI P  + S   V P T  GT + Q+IA+D D G N+E+ YS    N T DLF ++ E+G I+L +
Sbjct:   84 IFTTGARIDREKLCAGIP-----RDEHCFYEVEVAILPDEIF-RLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNMFGLDVIETPE-----GDKMPQLIVQKELDREKKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMP--ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLE-------------TAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINY-LLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDE--------------------------NDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGN-TRDLFAIDQETGNITLME 737          

HSP 2 Score: 146.747 bits (369), Expect = 3.596e-34
Identity = 157/552 (28.44%), Postives = 241/552 (43.66%), Query Frame = 3
Query:  288 LGAQATKWFPTDVNKLQDFGKPIYKFQFFNCEKSSVYFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLV-IEVKDINDNSPFWSQNELVTQ------FSEGSEIGDSKSLTVALDNDFGTNG-ISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQL---KAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNA---KITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLE------RMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHF----SEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAK-IFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQL 1868
            +G   T+   TD + + +  K  + F       +   F +N   G+ITI+  +DR+             N++    L + SD        +V + V D+NDN P      +V         SE   +    +L    D D   NG ++ +      T+ E+ + +     ++SN  Q  L     LD E   +Y   + A D G P  N S  + + V DENDN+PVF ++   +S+ EN   N+P IQL    A DADS  N +I Y +     PE    FS++  +G + V  +LD E        + A D G     S  TV ++I D NDNSP        FT+N     + EN      V + +V D D  +N  VT  +    N++F+++      R NI            SFDRE++   T ++   D G   +++S  V++ V D+ND  P F    S  SY   V     PGT +F + A D D G+NA + YSI G + + +F+I++  G + L    D   +       +A D G P  L
Sbjct:  264 VGTSVTQLHATDAD-IGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREE----------TPNHKL---LVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCF------TDHEIPFRLRP---VFSN--QFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPEN---NSPGIQLTKVSATDADSGPNAEINYLLGPDAPPE----FSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSP-------VFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILD-ENDDFTIDSQTGVIRPNI------------SFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYEL-VLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSL 762          

HSP 3 Score: 116.701 bits (291), Expect = 6.416e-25
Identity = 124/459 (27.02%), Postives = 200/459 (43.57%), Query Frame = 3
Query: 1239 IRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLT-VMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYS----IFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFL-------PKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRL 2579
            I D+NDN+P     P+   N   I EN A      + +  D D   NG     L    N  F L+ +  P    M ++   K  DRE+K      +   D G P+++++  + V V D ND  P F E      + E+   GT +  ++ATD D G NA + +S    +     ++F +N   G + ++  LDRE   +      A+D G     + A + V V D+NDN P +       P +  + + EN   +  +  + VTD D   N   +VT  ++          E P +   R V   FSN          L+   + LD E T +Y I + A D G PP +   +++I V D ND  P F   + S  TV +      G  + ++ A D D G N+E+ Y    +      F ++  +G +++ + + +  K   Y+  ++ KDNG+P L
Sbjct:  129 IEDINDNAP---LFPATVIN-ISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNM-FGLDVIETPEGDKMPQLIVQKELDREKKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGL--MPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNG--RVTCFTD---------HEIPFR--LRPV---FSNQF--------LLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVF---TQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPE--FSLDRRTGMLTVVKKL-DREKEDKYLFTILAKDNGVPPL 550          
BLAST of Protocadherin-1 vs. UniProt/SwissProt
Match: sp|Q71M42|PC11X_PANTR (Protocadherin-11 X-linked OS=Pan troglodytes OX=9598 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 277.33 bits (708), Expect = 2.387e-75
Identity = 218/708 (30.79%), Postives = 337/708 (47.60%), Query Frame = 3
Query:  423 VITIERRIDRDNLCHLVPTCCPKKNNQC--NLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSP--EIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTC--------HLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKI-FSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIY-LYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQ 2504
            + T   RIDR+ LC  +P     ++  C   +++ I  D+ F  ++ +   ++DINDN+P +    +     E S I    +L  A+D D GTNG+  Y +      F L  I           +  +L+++K+LDRE+ D Y   V   DGG P  + +  + V+VTD NDN PVF++    +S+ EN    T V QL A DAD   N KI +  S+L      +LF + + +G I ++  LD E      L+V A+D G +   +   V++N+ D+NDN P  +I +  +   +   ++EN      +A+ +V DKD++ NG+VTC         L P+ + +F LE             T    D E   +    ++  D G P    S  + + V+D ND AP F++      + E+  PG  L  ++ATD D G NA ++Y + G DA   FS+++  G + +   LDRE  +   FT  A D+G P   S   + V + D NDN P    + Y  YV EN      +  + VTD D G NS   ++++ E                          N  F++     +I      DRE    Y   ++A D G   +S+   + INV+DVND KP FI P  + S   V P T  GT + Q++A+D D G N+E+ YS    N T DLF ++ E+G I+L +
Sbjct:   84 IFTTGARIDREKLCAGIP-----RDEHCFYEVEVAILPDEIF-RLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGTNGVQNYELIKSQNIFGLDVIETPE-----GDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMP--ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLE-------------TAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINY-LLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDE--------------------------NDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPSTNPGTVVFQVMAVDNDTGMNAEVRYSIVGGN-TRDLFAIDQETGNITLME 737          

HSP 2 Score: 147.902 bits (372), Expect = 1.785e-34
Identity = 157/552 (28.44%), Postives = 241/552 (43.66%), Query Frame = 3
Query:  288 LGAQATKWFPTDVNKLQDFGKPIYKFQFFNCEKSSVYFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLV-IEVKDINDNSPFWSQNELVTQ------FSEGSEIGDSKSLTVALDNDFGTNG-ISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQL---KAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNA---KITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLE------RMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHF----SEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAK-IFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQL 1868
            +G   T+   TD + + +  K  + F       +   F +N   G+ITI+  +DR+             N++    L + SD        +V + V D+NDN P      +V         SE   +    +L    D D   NG ++ +      T+ E+ + +     ++SN  Q  L     LD E   +Y   + A D G P  N S  + + V DENDN+PVF ++   +S+ EN   N+P IQL    A DADS  N +I Y +     PE    FS++  +G + V  +LD E        + A D G     S  TV ++I D NDNSP        FT+N     + EN      V + +V D D  +N  VT  +    N++F+++      R NI            SFDRE++   T ++   D G   +++S  V++ V D+ND  P F    S  SY   V     PGT +F + A D D G+NA + YSI G + + +F+I++  G + L    D   +       +A D G P  L
Sbjct:  264 VGTSVTQLHATDAD-IGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREE----------TPNHKL---LVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCF------TDHEIPFRLRP---VFSN--QFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPEN---NSPGIQLTKVSATDADSGPNAEINYLLGPDAPPE----FSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSP-------VFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILD-ENDDFTIDSQTGVIRPNI------------SFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYEL-VLPSTNPGTVVFQVMAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSL 762          

HSP 3 Score: 117.472 bits (293), Expect = 3.362e-25
Identity = 124/460 (26.96%), Postives = 203/460 (44.13%), Query Frame = 3
Query: 1239 IRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEE-FSLERMNIPLT-VMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYS----IFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFL-------PKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRL 2579
            I D+NDN+P     P+   N   I EN A      + +  D D   NG    + E I ++  F L+ +  P    M ++   K  DRE+K      +   D G P+++++  + V V D ND  P F E      + E+   GT +  ++ATD D G NA + +S    +     ++F +N   G + ++  LDRE   +      A+D G     + A + V V D+NDN P +       P +  + + EN   +  +  + VTD D   N   +VT  ++          E P +   R V   FSN          L+   + LD E T +Y I + A D G PP +   +++I V D ND  P F   + S  TV +      G  + ++ A D D G N+E+ Y    +      F ++  +G +++ + + +  K   Y+  ++ KDNG+P L
Sbjct:  129 IEDINDNAP---LFPATVIN-ISIPENSAINSKYTLPAAVDPDVGTNG--VQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGL--MPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNG--RVTCFTD---------HEIPFR--LRPV---FSNQF--------LLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVF---TQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPE--FSLDRRTGMLTVVKKL-DREKEDKYLFTILAKDNGVPPL 550          
BLAST of Protocadherin-1 vs. TrEMBL
Match: A0A4Z2CQZ4 (Protocadherin-9 isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_008258 PE=4 SV=1)

HSP 1 Score: 573.933 bits (1478), Expect = 0.000e+0
Identity = 331/815 (40.61%), Postives = 475/815 (58.28%), Query Frame = 3
Query:  357 YKFQFFNCEKSSVYFEINPLNGVITIERRIDRDNLCHLVPTCCP--------KKNNQ---------------CNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFW----------------SQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSY-----------------IINTNTMMYSN---------KEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEP-------IANEE-------------FSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETA--TTLIKRKDEY---PIQKLFRDVTKSFSNSL-----FSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQT--NDLFLMNPESGKISLQQTI 2510
            + +Q FN E  S YF ++ + GV+ + RRIDRD LC    +CC          KN+                C LDL I+SDD +S+II + + + DINDNSP W                 Q+ +    SE S IGD+  LT A+D D G+N I  Y I P   EFEL +                 I +++   YS+         + +L+L+++  LDRE    YEF + A DGG+PS N ++ + V +TD NDNSP+FEK  Y + + EN + +TP+IQ+KA D D   N +I+Y+ISSLTKPE+ +LF+++  +G+IHV+WE+DYE +  I L VEAND G+L R +TC V I + D ND+SPE++FEP+  TN A + ENE PG+LVAVFS QDKDS +NG+V+C L           N+E             FSL++M++P +++YK++T  SFDRE  SK+T  I C D G PR+ ++GSV+V + D+NDE P FS+  Y F+VNE+ + GT +  INATD DEG NA L++ + G +A  F INK  G + ++  LDRE++  LHF   A D+G P   ST+++T+ ++D+NDN P +   I  YVLENHTA + + ++   DAD G N+E   TL+  TA  +  I   D     P Q    ++ K+FS+SL     F +  DG++ +  S LDRE    YE+ I   D+G P  S+  I+ I++LDVND  P+FIFPS  N+TV V   T  GT I ++ AIDED  +N  L Y  K N  T  + LF ++P +G + L++++
Sbjct:  111 HYYQIFNSEPQSKYFHLDSITGVLRVARRIDRDQLCPTFKSCCTYLTDINYFNKNSHLNLMHNSIDNEHMSNCQLDLNIRSDDQYSNIITVSVHIIDINDNSPTWLLGGKSKFLNFPDDKQKQDVMHVYVSESSLIGDAVQLTPAVDQDAGSNNIMKYVIEPHSPEFELEWTSLDRDISMTNLQISSDIQSSDIQSYSDHLIRSPPGPRHELRLIVRSPLDRETKSLYEFNLTAIDGGSPSRNATVNLQVHITDFNDNSPIFEKDTYTVDLRENARPHTPIIQVKASDIDEGSNAQIKYRISSLTKPEFIRLFTLDPITGWIHVQWEVDYEIHKKIILTVEANDGGSLPRSTTCIVEITVLDENDHSPELHFEPAHLTNYAIVPENEKPGRLVAVFSAQDKDSGDNGRVSCRLAETRKWTFDTQNKEKLESLLLNPTETLFSLQQMHMPFSIIYKLTTAYSFDREFISKITVWITCSDYGIPRRNSTGSVAVRISDVNDEPPMFSQTHYYFNVNENTEIGTIINKINATDPDEGENAKLTFWLSGLNANYFDINKATGYLTVQKLLDRETINELHFRVHAEDNGMPSLNSTSDVTITIQDVNDNPPSVMSKIEFYVLENHTASLAIGKITAYDADIGRNAEVTFTLIHCTAYGSKTINSNDSIFHEPYQHHL-NIRKNFSHSLEVMYTFFIAKDGQIYLGRSKLDRESYPLYELTIRVEDQGIPKLSSTTIVLIHILDVNDNTPRFIFPSIGNNTVYVPKETKPGTYITRLHAIDEDSAENGRLTYGIKPNEHTIIDSLFELDPVTGDVILKRSL 924          

HSP 2 Score: 113.235 bits (282), Expect = 2.364e-21
Identity = 145/615 (23.58%), Postives = 246/615 (40.00%), Query Frame = 3
Query: 1005 IQLKAIDADSEM-NGKIEYQISSLTKPEYAKLFSIESNSGYIH-----VRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEF----SLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAP--HFSEKSYIFH---VNEDVKPGTYLFTINATDKDEGINALLSYSI--------------------FGKDAKIFSINKLDG------KVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLY-VLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSF--------KSNNQTNDLF-----------------------LMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESINGDS 2630
            ++  ++D D  M N +I   I S     Y+    I S  G  H     VR  LD ET +     + A D G+  R +T  + ++I D NDNSP   FE   +T    + EN  P   +      D D   N ++   +  +   EF    +L+ +   + V +++      D E   K+   +   D G+  ++T+  V + V D ND +P  HF E +++ +   V E+ KPG  +   +A DKD G N  +S  +                          +FS+ ++        K+      DRE +  +      +D G P++ ST ++ V + D+ND  P   ++ Y + V EN      + ++N TD DEG N++    L    A               + D+ K+           G L +++  LDRE   +    + A D G P  ++   + I + DVND  P  +    S     V     +   I +I A D D G+N+E+ ++         K+ N  + +F                           + G+I L ++  +      Y L + V+D GIP+L  T  + I I  +N ++
Sbjct:  279 LEWTSLDRDISMTNLQISSDIQSSDIQSYSDHL-IRSPPGPRHELRLIVRSPLDRETKSLYEFNLTAIDGGSPSRNATVNLQVHITDFNDNSP--IFEKDTYT--VDLRENARPHTPIIQVKASDIDEGSNAQIKYRISSLTKPEFIRLFTLDPITGWIHVQWEV------DYEIHKKIILTVEANDGGSLPRSTTCIVEITVLDENDHSPELHF-EPAHLTNYAIVPENEKPGRLVAVFSAQDKDSGDNGRVSCRLAETRKWTFDTQNKEKLESLLLNPTETLFSLQQMHMPFSIIYKLTTAYSFDREFISKITVWITCSDYGIPRRNSTGSVAVRISDVNDEPPMFSQTHYYFNVNENTEIGTIINKINATDPDEGENAKLTFWLSGLNAN--------------YFDINKA----------TGYLTVQKL-LDRETINELHFRVHAEDNGMPSLNSTSDVTITIQDVNDNPPSVM----SKIEFYVLENHTASLAIGKITAYDADIGRNAEVTFTLIHCTAYGSKTINSNDSIFHEPYQHHLNIRKNFSHSLEVMYTFFIAKDGQIYLGRSKLDRESYPLYELTIRVEDQGIPKLSSTTIVLIHILDVNDNT 852          

HSP 3 Score: 63.5438 bits (153), Expect = 3.346e-6
Identity = 74/292 (25.34%), Postives = 127/292 (43.49%), Query Frame = 3
Query:  360 KFQFFNCEKSSVYFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSP-------FWSQNELVTQFSEG------SEIGDSKSLTVALDN--DFGTNGI-SYYSISPEITEFEL------SYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVF------EKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDY 1151
            K  F+    ++ YF+IN   G +T+++ +DR+ +  L      + N   +L+ T  SD        + I ++D+NDN P       F+         + G      ++IG +  +T  L +   +G+  I S  SI  E  +  L      S+ +      +  K+    + + KLDRE    YE  +   D G P  + +  V++ + D NDN+P F         VY   V +  +  T + +L AID DS  NG++ Y I          LF ++  +G + ++  LDY
Sbjct:  648 KLTFWLSGLNANYFDINKATGYLTVQKLLDRETINELHFRVHAEDNGMPSLNST--SD--------VTITIQDVNDNPPSVMSKIEFYVLENHTASLAIGKITAYDADIGRNAEVTFTLIHCTAYGSKTINSNDSIFHEPYQHHLNIRKNFSHSLEVMYTFFIAKDGQIYLGRSKLDRESYPLYELTIRVEDQGIPKLSSTTIVLIHILDVNDNTPRFIFPSIGNNTVY---VPKETKPGTYITRLHAIDEDSAENGRLTYGIKPNEHTIIDSLFELDPVTGDVILKRSLDY 926          
BLAST of Protocadherin-1 vs. TrEMBL
Match: A0A4Z2CQW3 (Protocadherin-9 isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_008258 PE=4 SV=1)

HSP 1 Score: 540.036 bits (1390), Expect = 3.907e-172
Identity = 312/762 (40.94%), Postives = 444/762 (58.27%), Query Frame = 3
Query:  357 YKFQFFNCEKSSVYFEINPLNGVITIERRIDRDNLCHLVPTCCP--------KKNNQ---------------CNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFW----------------SQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSY-----------------IINTNTMMYSN---------KEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEP-------IANEE-------------FSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETA--TTLIKRKDEY---PIQKLFRDVTKSFSNSL-----FSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRT 2357
            + +Q FN E  S YF ++ + GV+ + RRIDRD LC    +CC          KN+                C LDL I+SDD +S+II + + + DINDNSP W                 Q+ +    SE S IGD+  LT A+D D G+N I  Y I P   EFEL +                 I +++   YS+         + +L+L+++  LDRE    YEF + A DGG+PS N ++ + V +TD NDNSP+FEK  Y + + EN + +TP+IQ+KA D D   N +I+Y+ISSLTKPE+ +LF+++  +G+IHV+WE+DYE +  I L VEAND G+L R +TC V I + D ND+SPE++FEP+  TN A + ENE PG+LVAVFS QDKDS +NG+V+C L           N+E             FSL++M++P +++YK++T  SFDRE  SK+T  I C D G PR+ ++GSV+V + D+NDE P FS+  Y F+VNE+ + GT +  INATD DEG NA L++ + G +A  F INK  G + ++  LDRE++  LHF   A D+G P   ST+++T+ ++D+NDN P +   I  YVLENHTA + + ++   DAD G N+E   TL+  TA  +  I   D     P Q    ++ K+FS+SL     F +  DG++ +  S LDRE    YE+ I   D+G P  S+  I+ I++LDVND  P+FIFPS  N+TV V   T
Sbjct:  111 HYYQIFNSEPQSKYFHLDSITGVLRVARRIDRDQLCPTFKSCCTYLTDINYFNKNSHLNLMHNSIDNEHMSNCQLDLNIRSDDQYSNIITVSVHIIDINDNSPTWLLGGKSKFLNFPDDKQKQDVMHVYVSESSLIGDAVQLTPAVDQDAGSNNIMKYVIEPHSPEFELEWTSLDRDISMTNLQISSDIQSSDIQSYSDHLIRSPPGPRHELRLIVRSPLDRETKSLYEFNLTAIDGGSPSRNATVNLQVHITDFNDNSPIFEKDTYTVDLRENARPHTPIIQVKASDIDEGSNAQIKYRISSLTKPEFIRLFTLDPITGWIHVQWEVDYEIHKKIILTVEANDGGSLPRSTTCIVEITVLDENDHSPELHFEPAHLTNYAIVPENEKPGRLVAVFSAQDKDSGDNGRVSCRLAETRKWTFDTQNKEKLESLLLNPTETLFSLQQMHMPFSIIYKLTTAYSFDREFISKITVWITCSDYGIPRRNSTGSVAVRISDVNDEPPMFSQTHYYFNVNENTEIGTIINKINATDPDEGENAKLTFWLSGLNANYFDINKATGYLTVQKLLDRETINELHFRVHAEDNGMPSLNSTSDVTITIQDVNDNPPSVMSKIEFYVLENHTASLAIGKITAYDADIGRNAEVTFTLIHCTAYGSKTINSNDSIFHEPYQHHL-NIRKNFSHSLEVMYTFFIAKDGQIYLGRSKLDRESYPLYELTIRVEDQGIPKLSSTTIVLIHILDVNDNTPRFIFPSIGNNTVYVPKET 871          

HSP 2 Score: 112.464 bits (280), Expect = 2.712e-21
Identity = 145/615 (23.58%), Postives = 246/615 (40.00%), Query Frame = 3
Query: 1005 IQLKAIDADSEM-NGKIEYQISSLTKPEYAKLFSIESNSGYIH-----VRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEF----SLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAP--HFSEKSYIFH---VNEDVKPGTYLFTINATDKDEGINALLSYSI--------------------FGKDAKIFSINKLDG------KVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLY-VLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSF--------KSNNQTNDLF-----------------------LMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESINGDS 2630
            ++  ++D D  M N +I   I S     Y+    I S  G  H     VR  LD ET +     + A D G+  R +T  + ++I D NDNSP   FE   +T    + EN  P   +      D D   N ++   +  +   EF    +L+ +   + V +++      D E   K+   +   D G+  ++T+  V + V D ND +P  HF E +++ +   V E+ KPG  +   +A DKD G N  +S  +                          +FS+ ++        K+      DRE +  +      +D G P++ ST ++ V + D+ND  P   ++ Y + V EN      + ++N TD DEG N++    L    A               + D+ K+           G L +++  LDRE   +    + A D G P  ++   + I + DVND  P  +    S     V     +   I +I A D D G+N+E+ ++         K+ N  + +F                           + G+I L ++  +      Y L + V+D GIP+L  T  + I I  +N ++
Sbjct:  279 LEWTSLDRDISMTNLQISSDIQSSDIQSYSDHL-IRSPPGPRHELRLIVRSPLDRETKSLYEFNLTAIDGGSPSRNATVNLQVHITDFNDNSP--IFEKDTYT--VDLRENARPHTPIIQVKASDIDEGSNAQIKYRISSLTKPEFIRLFTLDPITGWIHVQWEV------DYEIHKKIILTVEANDGGSLPRSTTCIVEITVLDENDHSPELHF-EPAHLTNYAIVPENEKPGRLVAVFSAQDKDSGDNGRVSCRLAETRKWTFDTQNKEKLESLLLNPTETLFSLQQMHMPFSIIYKLTTAYSFDREFISKITVWITCSDYGIPRRNSTGSVAVRISDVNDEPPMFSQTHYYFNVNENTEIGTIINKINATDPDEGENAKLTFWLSGLNAN--------------YFDINKA----------TGYLTVQKL-LDRETINELHFRVHAEDNGMPSLNSTSDVTITIQDVNDNPPSVM----SKIEFYVLENHTASLAIGKITAYDADIGRNAEVTFTLIHCTAYGSKTINSNDSIFHEPYQHHLNIRKNFSHSLEVMYTFFIAKDGQIYLGRSKLDRESYPLYELTIRVEDQGIPKLSSTTIVLIHILDVNDNT 852          
BLAST of Protocadherin-1 vs. TrEMBL
Match: A0A1S8XA96 (Cadherin domain protein OS=Opisthorchis viverrini OX=6198 GN=X801_00458 PE=4 SV=1)

HSP 1 Score: 541.576 bits (1394), Expect = 5.106e-172
Identity = 313/854 (36.65%), Postives = 465/854 (54.45%), Query Frame = 3
Query:  231 KHFTIDIYEELPRKTKVIDLGAQATKWFPTDVNKLQDFGKPIYKFQFFNCEKSSVYFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNN---------------------------QCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFW--------------SQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTM--MYSN---------------KEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAP-GKLVAVFSVQDKDSNENGKVTCHL-EP--------------------IANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSN--------SLFSLL--PDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQT--NDLFLMNPESGKISLQQTIQE 2516
            +   + I EE P   +V +L      W            K I  FQ FN E  S YF+++P +G + I RRIDRD LC +  +CCP+                              +C LDL I+SDD +S+II++ + + D+NDN+P W               Q+ +    SE S IGDS +L  A D D G NGI  Y++ PE+ EF+L +  ++  +  +Y++               + +L+LV+KK LDRE+   Y+  V AFDGG+PS N S  + V VTD NDNSP F+K  Y + + EN + +T V+Q+ A+D D  +NG+I+Y+ S LTKPE+ ++F +++ +G+I V+WE+DYE Y  I L VEA D G L R STC V I + D ND++PEI FEP+  TN A + ENE P G+LVAVF+V D+D+ ENG+V C L EP                      N  F L+ M +P +VMYK++T   FDRE  S++T  IVC D G P + TSG+V+V + D+ND  P F  + +  +V EDV  G+ LFT+NATD DEG NA L+Y + G D   F++N+ +G++ +   +DRE   SLH    A D G P   S+A++ V V D+NDN P + + +   + ENH A  P+ Q+  +D D G N+E   +LV   A         +P++ +         N        +L++ L   DG++ + ++ LDRE    Y++V++A D G P  S    + I +LDVND  P F FPS  N+TV V   T  G  +  + A D D   N  + Y+ K + Q   +DLF ++ ++G++ L++++ +
Sbjct:   44 RKLRVQISEEEPEGQEVANLRFLINGWSENAKGFPNRSAKHIDNFQIFNSEPQSTYFQLDPTSGRLRIARRIDRDQLCPVFHSCCPRSAEDSLSIELDSSDPPANVAGEDVTGQFLPECRLDLNIRSDDQYSNIILVHVHIVDVNDNAPVWPHAADLKGGSEEQNGQHGITVHLSENSLIGDSTNLPSAYDADAGLNGIVRYTLKPEVPEFDLKWTTDSELIGRLYTDEQHLFTHGESQYLGARHELRLVVKKLLDREQCPFYDLTVTAFDGGSPSRNASTPLKVIVTDANDNSPRFQKDTYTVELMENSKPHTSVVQVTALDDDEGVNGRIKYRFSPLTKPEFMRMFKLDAVTGWIRVQWEVDYELYKKIILTVEAVDSGQLPRASTCVVEIVVLDENDHAPEIRFEPAFVTNYALVPENENPAGRLVAVFTVTDRDAGENGRVACQLAEPSRWHFQSPDPKIIKALISADPPNAFFKLQHMQVPFSVMYKLTTAAVFDREAISQITVLIVCSDYGQPPRNTSGAVAVRITDMNDVEPKFPRERFYMNVREDVLVGSILFTVNATDFDEGRNAKLTYWLSGPDMDYFAVNENNGEISVRRPMDRELKSSLHCRIHAVDQGTPPLNSSADVLVSVTDVNDNPPVITERVEFEIKENHAASAPIGQLTASDRDAGRNAEVSFSLVQCLA---------HPLEVMTSSSNAGQGNGSWTRQVETLYTFLVAKDGRIFLGQAKLDRESFPAYDLVVKAEDHGQPRLSATSTVLIRILDVNDNAPTFTFPSSGNNTVYVPRSTEPGLPLTTVQAFDRDSEDNGRVRYTLKGDRQGVHHDLFSLDSQTGELRLRRSVDQ 888          

HSP 2 Score: 124.02 bits (310), Expect = 7.230e-25
Identity = 158/673 (23.48%), Postives = 260/673 (38.63%), Query Frame = 3
Query:  897 IKVIVAVTDENDNSPVFEKAVYI--------------ISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEY-----------AKLFSIESN------SGYIHVRWEL--------DYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFS-EKSYIFH---VNEDVKPGTYLFTI-NATDKDEGINALLS--------YSIFGKDAKI-------------FSINKLDG------KVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKS-IYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSF------------KSNN----------QTNDLF-LMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESINGDS 2630
            I V V + D NDN+PV+  A  +              + ++EN           A DAD+ +NG + Y +     PE+            +L++ E +      S Y+  R EL        D E      L V A D G+  R ++  + + + D NDNSP   F+   +T   ++ EN  P   V   +  D D   NG++     P+   EF   RM     V   I      D E   K+   +   D G   + ++  V + V D ND AP    E +++ +   V E+  P   L  +   TD+D G N  ++        +     D KI             F +  +        K+      DRE++  +      +D G P + ++  + V + D+ND  P  P+   Y+ V E+      L  VN TD DEG N++    L           ++                        +G++ +R   +DRE+ +     I A D+G PP ++   + ++V DVND  P            ++K    +   I Q+ A D D G+N+E+ +S              S+N          Q   L+  +  + G+I L Q   +      Y L+V  +D+G PRL  T+ + I I  +N ++
Sbjct:  178 ILVHVHIVDVNDNAPVWPHAADLKGGSEEQNGQHGITVHLSENSLIGDSTNLPSAYDADAGLNGIVRYTLKPEV-PEFDLKWTTDSELIGRLYTDEQHLFTHGESQYLGARHELRLVVKKLLDREQCPFYDLTVTAFDGGSPSRNASTPLKVIVTDANDNSPR--FQKDTYT--VELMENSKPHTSVVQVTALDDDEGVNGRIKYRFSPLTKPEFM--RMFKLDAVTGWIRVQWEVDYELYKKIILTVEAVDSGQLPRASTCVVEIVVLDENDHAPEIRFEPAFVTNYALVPENENPAGRLVAVFTVTDRDAGENGRVACQLAEPSRWHFQSPDPKIIKALISADPPNAFFKLQHMQVPFSVMYKLTTAAVFDREAISQITVLIVCSDYGQPPRNTSGAVAVRITDMNDVEPKFPRERFYMNVREDVLVGSILFTVNATDFDEGRNAKLTYWLSGPDMDYFAVNEN------------------------NGEISVRRP-MDRELKSSLHCRIHAVDQGTPPLNSSADVLVSVTDVNDNPPVIT----ERVEFEIKENHAASAPIGQLTASDRDAGRNAEVSFSLVQCLAHPLEVMTSSSNAGQGNGSWTRQVETLYTFLVAKDGRIFLGQAKLDRESFPAYDLVVKAEDHGQPRLSATSTVLIRILDVNDNA 814          
BLAST of Protocadherin-1 vs. TrEMBL
Match: A0A419QA20 (Protocadherin-1 OS=Clonorchis sinensis OX=79923 GN=PCDH1 PE=4 SV=1)

HSP 1 Score: 543.502 bits (1399), Expect = 5.488e-171
Identity = 309/855 (36.14%), Postives = 461/855 (53.92%), Query Frame = 3
Query:  231 KHFTIDIYEELPRKTKVIDLGAQATKWFPTDVNKLQDFGKPIYKFQFFNCEKSSVYFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNN---------------------------QCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFW--------------SQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINT--NTMMYSNKEQXXXXXXXX---------------XDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAP-GKLVAVFSVQDKDSNENGKVTCHL-EP--------------------IANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSN-----------SLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQT--NDLFLMNPESGKISLQQTIQE 2516
            +   + I EE P   +V +L      W     +        I  FQ FN E  S YF+++P +G + I RRIDRD LC +  +CCP+                              +C LDL I+SDD +S+II++ + + D+NDN+P W               Q  ++   SE S IGDS +L  A D D G NGI  Y++ PE+ EF+L +  +   +  +Y++++QL    + +               LDRE+   Y   + AFDGG+PS N S  + V VTD NDNSP F+K  Y + + EN + +T V+Q+ A+D D  +NG+I+Y+ S LTKPE+ ++F++++ +G+I V+WE+DYE Y  I L VEA D G L R STC V I + D ND++PEI FEP+  TN A + ENE P G+LVAVF+V D+D+ ENG+V C L EP                      N  F L+ M +P +VMYK++T   FDRE  S++T  IVC D G P + TSG+V+V + D+ND AP F  + +  +V EDV  G+ LFT+NATD DEG NA L+Y + G D   F++N+  G++ +   +DRE   SLH    A D G P   S+A+I V V D+NDN P + + +   + ENH A  P+ Q+  +D D G N+E   +LV   A         +P++ L         N           + F +  DG++ + ++ LDRE  T Y+++++A D G P  +    + I +LDVND  P F FPS  N+TV V   T  G  +  + A D D  +N  + Y+ K + Q   +DLF ++ ++G++ L++++ +
Sbjct:   24 RKLRVQISEEEPEGREVANLRFLVNGWSENAKSFPNRSATRIDNFQIFNSEPQSTYFQLDPTSGRLRIARRIDRDQLCPVFHSCCPRSAEDSFPMELDSSDSVTNVAMEDGTGQYLPECRLDLNIRSDDQYSNIILVHVHIVDVNDNAPIWPHAADLKDGNEQRNGQRGIIVHLSENSLIGDSTNLPSAYDADAGLNGIVRYTLKPEVPEFDLKWASDNELSGRLYTDEQQLFTPGESQYLGARHELRLVVKKLLDREQCPFYNLTITAFDGGSPSRNASTPLKVIVTDANDNSPRFQKDTYTVELMENSKPHTSVVQVTALDDDEGVNGRIKYRFSPLTKPEFMRMFTLDAVTGWIRVQWEVDYELYKKIILTVEAVDSGQLPRASTCVVEIVVLDENDHAPEIRFEPAFVTNYALVPENENPAGRLVAVFTVTDRDAGENGRVACQLAEPSRWHFQSPDPKIIKALISADPPNAFFKLQHMQVPFSVMYKLTTAAVFDREVVSQITVLIVCSDYGQPPRNTSGAVAVRITDMNDVAPKFPRERFYMNVREDVLVGSILFTVNATDVDEGRNAKLTYWLSGPDMDYFAVNENSGEISVRRPMDRELKSSLHCRIHAVDQGTPPLNSSADILVSVTDVNDNPPIITERVEFEITENHAASAPVGQLRASDRDAGRNAEVSFSLVQCLA---------HPLEVLTSSSDAGQGNGSWTRQVEMLYTRFLVAKDGRIFLGQAKLDRESYTAYDLIVKAEDHGQPRLTATSTVLIRILDVNDNAPTFTFPSSGNNTVYVPRSTEPGLPLTTVHAFDRDTEENGRVRYNLKGDRQGIHHDLFALDSQTGELRLRRSVDQ 869          
BLAST of Protocadherin-1 vs. TrEMBL
Match: H2KQF7 (Protocadherin-1 OS=Clonorchis sinensis OX=79923 GN=CLF_103808 PE=4 SV=1)

HSP 1 Score: 543.117 bits (1398), Expect = 6.362e-169
Identity = 310/854 (36.30%), Postives = 462/854 (54.10%), Query Frame = 3
Query:  231 KHFTIDIYEELPRKTKVIDLGAQATKWFPTDVNKLQDFGKPIYKFQFFNCEKSSVYFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNN---------------------------QCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFW--------------SQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINT--NTMMYSNKEQXXXXXXXX---------------XDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAP-GKLVAVFSVQDKDSNENGKVTCHL-EP--------------------IANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNS--------LFSLL--PDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQT--NDLFLMNPESGKISLQQTIQE 2516
            +  ++ I EE P   +V +L      W     +        I  FQ FN E  S YF+++P +G + I RRIDRD LC +  +CCP+                              +C LDL I+SDD +S+II++ + + D+NDN+P W               +  ++   SE S IGDS +L  A D D G NGI  Y++ PE+ EF+L +  +   +  +Y++++QL    + +               LDRE+   Y   + AFDGG PS N S  + V VTD NDNSP F+K  Y + + EN + +T V+Q+ A+D D  +NG+I+Y+ S LTKPE+ ++F++++ +G+I V+WE+DYE Y  I L VEA D G L R STC V I + D ND++PEI FEP+  TN A + ENE P G+LVAVF+V D+D+ ENG+V C L EP                      N  F L+ M +P +VMYK++T   FDRE  S+VT  IVC D G P + TSG+V+V + D+ND AP F  + +  +V EDV  G+ LFT+NATD DEG NA L+Y + G D   F++N+  G++ +   +DRE   SLH    A D G P   S+A+I V V D+NDN P + + +   + ENH A  P+ Q+  +D D G N+E   +LV   A         +P++ L         N         L++ L   DG++ + ++ LDRE  T Y+++++A D G P  +    + I +LDVND  P F FPS  N+TV V   T  G  +  + A D D  +N  + Y+ K + Q   +DLF ++ ++G++ L++++ +
Sbjct:   24 RKLSVQISEEEPEGREVANLRFLVNGWSENAKSFPNRSATRIDNFQIFNSEPQSTYFQLDPTSGRLRIARRIDRDQLCPVFHSCCPRSAEDSFPMELDSSDSVTNVAMEDGTGQYLPECRLDLNIRSDDQYSNIILVHVHIVDVNDNAPIWPHAADLKDGNEQRNGRRGIIVHLSENSLIGDSTNLPSAYDADAGLNGIVRYTLKPEVPEFDLKWASDNELSGRLYTDEQQLFTPGESQYLGARHELRLVVKKLLDREQCPFYNLTITAFDGGAPSRNASTPLKVIVTDANDNSPRFQKDTYTVELMENSKPHTSVVQVTALDDDEGVNGRIKYRFSPLTKPEFMRMFTLDAVTGWIRVQWEVDYELYKKIILTVEAVDSGQLPRASTCVVEIVVLDENDHAPEIRFEPAFVTNYALVPENENPAGRLVAVFTVTDRDAGENGRVACQLAEPSRWHFQSPDPKIIKALISADPPNAFFKLQHMQVPFSVMYKLTTAAVFDREVVSQVTVLIVCSDYGQPPRNTSGAVAVRITDMNDVAPKFPRERFYMNVREDVLVGSILFTVNATDVDEGRNAKLTYWLSGPDMDYFAVNENSGEISVRRPMDRELKSSLHCRIHAVDQGTPPLNSSADILVSVTDVNDNPPIITERVEFEITENHAASAPVGQLRASDRDAGRNAEVSFSLVQCLA---------HPLEVLTSSSDAGQGNGSWTRQVEMLYTFLVAKDGRIFLGQAKLDRESYTAYDLIVKAEDHGQPRLTATSTVLIRILDVNDNAPTFTFPSSGNNTVYVPRSTEPGLPLTTVHAFDRDTEENGRVRYNLKGDRQGIHHDLFALDSQTGELRLRRSVDQ 868          
BLAST of Protocadherin-1 vs. Ensembl Cavefish
Match: pcdh7a (protocadherin 7a [Source:ZFIN;Acc:ZDB-GENE-120206-1])

HSP 1 Score: 303.523 bits (776), Expect = 1.433e-86
Identity = 244/805 (30.31%), Postives = 370/805 (45.96%), Query Frame = 3
Query:  372 FNCEKSSVYFEINPLNGVITIE-RRIDRDNL--CHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLV---IEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSI--------SPEITEF---------------ELSYIINTNTMMYS--------NKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEP-SRFT---NNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSL----ERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIII-ESINGDSILSKE 2645
            F  E  + +F+I+ + G +T   RRIDR+ L  C ++        N+C LD  +         + L    I V D+NDN+P +    L     E   IG    L  A D DFG NGI  Y +         P                    E   +    + ++          ++Q +L++K  LDRE  D YE ++   DGGNP  +    + VA+TD NDNSP FE+AVY   + EN    TPV+Q++A D D  +NG++EY   + T+    +L  ++  SG++ V   +D E  + +   V A D G   R    TVI+N+RD NDN P +      R       A + EN      VA+  V D+D  ENG VTC +  + +  F+L    E  N      + + T    D E     T  IV  D G+P  +++ ++ V V DIND AP F++     H  E+  PG  + T+ A D D G NA ++YS+       F I+  +G +     LDRE  E   F   A D G P    +A + V V D NDN P F+ +    YV EN  A+ P+  V VTDADEG N+E  + +  +        + +                 LFS+  +   I   +  DRE  + Y   + A D G PP+S    + + V D ND  P    P+  + T+ + P + + T +  ++A D D G N++L Y+    N    LF + P SG I+L + ++  H+   + L+V V D+G+P L  TA + + I ES+   +++  +
Sbjct:   69 FALESGAEFFKIDNVTGELTTSSRRIDREKLPQCQMI-----FDENECFLDFEVSVIGPLQSWVDLFEGRIVVTDVNDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIDRYELVQDSRDQRRPASATMPAGINNGAGDRRRGQEAGSVPAGRSNVFELQVADTPDGQKQPQLIVKGPLDREARDSYELVLRVRDGGNPPRSSQALLRVAITDVNDNSPRFERAVYEAEMGENTPPGTPVLQVRASDRDIGVNGQVEYVFGAATE-SVRRLLRLDEASGWLSVLHRIDREEVSQLRFTVTARDRGQPPRTDRATVILNVRDENDNVPVVEIRKIGRILVRDGAAMVPENVLVDTPVALVQVSDRDQGENGAVTCTV--VGDVPFTLKPAGENRN---KKKFFLHTSALLDYEATRDYTVTIVAVDSGSPSLSSNSTLMVRVVDINDHAPTFAQSLVEVHFAENNAPGERVVTVVAADADSGKNAEIAYSLDPSVNGAFYIDADNGDIRATGALDREQRERYEFRVIARDKGSPSLQGSATVVVQVTDRNDNAPKFVQEVFTFYVKENLLANSPVGMVTVTDADEGENAELCLFVEEDEEEEEAGGRRQ----------------ELFSIENNTGTIFSAASFDRESRSTYTFRVRAVDGGEPPRSATATVSLFVTDENDNAPSVTAPANESYTL-LPPASGARTVVRTVMASDGDAGSNADLRYALVGGNPFQ-LFEIGPSSGVITLAEPLERRHR-GLHRLVVRVNDSGVPSLCATALVHVFINESLTNATLVDAQ 843          

HSP 2 Score: 135.961 bits (341), Expect = 6.289e-32
Identity = 178/685 (25.99%), Postives = 267/685 (38.98%), Query Frame = 3
Query:  822 DREKIDKYEFIVNAFDGGNPSFNGSIKVI-------------VAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQI----------SSLTKP--------------EYAKLFSIESN--------------SGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAP--------HFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGK---DAKIFSINKLDGKVFLETD--LDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIY-LYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSEL-------EYSFKSNNQTNDLFLMNPESGKI-SLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIII--ESINGDSILSKENK 2651
            DREK+ + + I   FD      +  + VI             + VTD NDN+P F   V  +SV EN    T  +   A D D   NG   Y++          +S T P              E   + +  SN                 + V+  LD E   +  L++   D GN  R S   + + I D+NDNSP   FE  R    A++ EN  PG  V      D+D   NG+V             L R++        +S L   DRE+ S++   +   D G P +T   +V + V D ND  P            +     V E+V   T +  +  +D+D+G N  ++ ++ G      K    N+   K FL T   LD E+      T  A DSG P   S + + V V DIND+ P   +S+  ++  EN+     +V V   DAD G N+E   +L                             N  F +  D   I     LDRE   +YE  + A D+G+P       + + V D ND  PKF+       T  VK   ++ + +  +   D DEG+N+EL       E   ++  +  +LF +   +G I S     +ES     Y   V   D G P    TA + + +  E+ N  S+ +  N+
Sbjct:   95 DREKLPQCQMI---FDENECFLDFEVSVIGPLQSWVDLFEGRIVVTDVNDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIDRYELVQDSRDQRRPASATMPAGINNGAGDRRRGQEAGSVPAGRSNVFELQVADTPDGQKQPQLIVKGPLDREARDSYELVLRVRDGGNPPRSSQALLRVAITDVNDNSPR--FE--RAVYEAEMGENTPPGTPVLQVRASDRDIGVNGQVEYVFGAATESVRRLLRLD---EASGWLSVLHRIDREEVSQLRFTVTARDRGQPPRTDRATVILNVRDENDNVPVVEIRKIGRILVRDGAAMVPENVLVDTPVALVQVSDRDQGENGAVTCTVVGDVPFTLKPAGENRNKKKFFLHTSALLDYEATRDYTVTIVAVDSGSPSLSSNSTLMVRVVDINDHAPTFAQSLVEVHFAENNAPGERVVTVVAADADSGKNAEIAYSLDPSV-------------------------NGAFYIDADNGDIRATGALDREQRERYEFRVIARDKGSPSLQGSATVVVQVTDRNDNAPKFV---QEVFTFYVKENLLANSPVGMVTVTDADEGENAELCLFVEEDEEEEEAGGRRQELFSIENNTGTIFSAASFDRESRST--YTFRVRAVDGGEPPRSATATVSLFVTDENDNAPSVTAPANE 739          
BLAST of Protocadherin-1 vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 293.508 bits (750), Expect = 4.278e-83
Identity = 249/832 (29.93%), Postives = 365/832 (43.87%), Query Frame = 3
Query:  174 VGFCFAFQLPENSFESSNHKHFTIDIYEELPRKTKVIDLGAQATKWFPTDVNKLQDFGKPIYKFQFFNCEKSSVYFEINPLNG-VITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDD----DFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNN----AKITENEAPGKLVAVFSVQDKDSNENGKVTC--------HLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDA--KIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIII 2609
            VG+   F L  +S  S+        + EE P  T +  L A            L D G        +  E  + Y  ++   G + T E  IDR+ L       C  K   C L+  +   D        +I   IEV+DINDN+P +    L     E + +G + ++  A D D   NG+  Y +S      E S + +        ++  +L++   LDRE  D Y+  +NA DGG PS   S  + V +TD NDN+P FEK+ Y   V+EN      V+Q+KA D+D   NG+IEY I   + P   K+  IE ++G I V+  LD E  ++    V A D G   + ST  V I + D NDN+P +         +    A I+E+   G  VA+  V DKD  EN  VTC         L P  +     ++        Y + T    D E+       IV  D GNP  +++ S+ V V D ND +P FS   +     E+ +PG  +  + A D D G NA L YSI    +   +F I+   G+V   + LDRE  E   F   AAD G P    TA + + V D NDN P F+  S    VLEN     P+  V V D D+G N++ ++++  +    +++                               I+     DRE  + Y   ++A D G PP+S+   + INVLD ND  P    PS S S  ++ P     + +  + A D D G N+EL YS    N  ++LF ++P  G+I L + +   H    + L+V V D G P     A + I +
Sbjct:    5 VGWFLLFALLVDSINSA-LGGILYHVREEQPPNTLIGSLAAD---------QGLPDSG------HLYKLEVGAPYLRVDGKTGEIFTTEIPIDRETLKD-----CRIKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLS---AGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDP-VPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKK-------KYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVEPDVGNFVVQNGT--------------------------GTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKPSNS-SFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGN-PHELFYISPSDGEIKLTKELTRKHG-GLHRLVVKVSDRGKPSRHAIALVHIYV 775          
BLAST of Protocadherin-1 vs. Ensembl Cavefish
Match: pcdh7b (protocadherin 7 [Source:NCBI gene;Acc:103034658])

HSP 1 Score: 294.278 bits (752), Expect = 2.887e-82
Identity = 239/793 (30.14%), Postives = 368/793 (46.41%), Query Frame = 3
Query:  372 FNCEKSSVYFEINPLNG-VITIERRIDRDNL--CHLVPTCCPKKNNQCNLDL---TIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNK------------------------EQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSP--------EIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTC--------HLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIII 2609
            F  E  S YF+I+ + G + T ERRIDR+ L  C ++        N+C +D     I     +  +    + + DINDN+P +    L     E   IG    L  A D DFG NGI  Y +  +  E  +  + + +T  +S K                        +Q +L++K  LDRE+ D YE  +   DGG+P+ +    + V +TD NDNSP FEK+VY   + EN     P++QLKA+DAD  +NG+IEY   + T+    +L  ++ ++G++ V   +D E  + +   V A D G   +    T+IINI+D NDN P         IY         A + E+      +A+  V D+D   NG VTC         L+P +  E  + +        Y + T    D E   +    IV  D G+P  +++ S+ V V DIND  P F++ +      E+  PG  + T+ A D D G NA + YS+      IFSI+   G + + T LDRE  E   F   A D G P    +A + V+V D NDN P F+      YV EN   + P+  V V D+D+G N+E  +                Y  ++      ++ + ++FS +            DRE  T Y   ++A D G+PP+S    + + V+D ND  P   FP  S+ T+ + P +   T +  +IA D D G N++L YS    N    LF ++P++G ISL   +++ H    + L+V V D+G+P    T  + + +
Sbjct:   62 FTLESGSDYFKIDNITGDLSTNERRIDREKLQQCQMI-----FDENECFIDFEVSVIGPAQSWVDLFEGKVIILDINDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIERYELIQDGAESSVRRLGSASTDAHSGKRRFDDAQSRSSVFELQVADTTDGEKQPQLIIKGALDREQRDSYELTLRVRDGGDPARSSQAILRVMITDVNDNSPRFEKSVYEADLPENSSPGAPILQLKAMDADVGVNGQIEYVFGAATE-SVRRLLRLDESTGWLSVLHRIDREEVSQLRFTVMARDRGQPPKTDKATMIINIKDENDNVPNIDIRKIGRIYLR----DGVANVAEDVVVDTPIALVQVSDRDKGPNGVVTCTVVGDVPFQLKPASEIEGDMNKKK------YFLHTSAPLDYEAVQEYNVVIVAVDSGSPSLSSNNSLIVKVGDINDNPPIFTKSTVEVSFPENNAPGERVATVVALDADSGKNAEIFYSLDSSVNGIFSIDADSGDIRVNTILDREQTERYEFKVIAKDKGVPVMQGSATVVVLVADKNDNEPKFMQDVFTFYVKENLQPNSPVGMVTVMDSDKGQNAEMSL----------------YIEEEEEIFSIENNTGTIFSTV----------AFDREQKTTYSFRVKAVDGGDPPRSATATVSLFVMDENDNPPSVTFPINSSYTL-LPPSSNIRTVVRTVIATDTDTGVNADLSYSIIGGNPFK-LFEIDPDTGVISLVSKLEQKH-FGLHRLVVQVNDSGVPSQSTTTLVHVYV 809          
BLAST of Protocadherin-1 vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 293.893 bits (751), Expect = 4.410e-82
Identity = 249/837 (29.75%), Postives = 367/837 (43.85%), Query Frame = 3
Query:  159 IIKIFVGFCFAFQLPENSFESSNHKHFTIDIYEELPRKTKVIDLGAQATKWFPTDVNKLQDFGKPIYKFQFFNCEKSSVYFEINPLNG-VITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDD----DFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNN----AKITENEAPGKLVAVFSVQDKDSNENGKVTC--------HLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDA--KIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIII 2609
            ++   VG+   F L  +S  S+        + EE P  T +  L A            L D G        +  E  + Y  ++   G + T E  IDR+ L       C  K   C L+  +   D        +I   IEV+DINDN+P +    L     E + +G + ++  A D D   NG+  Y +S      E S + +        ++  +L++   LDRE  D Y+  +NA DGG PS   S  + V +TD NDN+P FEK+ Y   V+EN      V+Q+KA D+D   NG+IEY I   + P   K+  IE ++G I V+  LD E  ++    V A D G   + ST  V I + D NDN+P +         +    A I+E+   G  VA+  V DKD  EN  VTC         L P  +     ++        Y + T    D E+       IV  D GNP  +++ S+ V V D ND +P FS   +     E+ +PG  +  + A D D G NA L YSI    +   +F I+   G+V   + LDRE  E   F   AAD G P    TA + + V D NDN P F+  S    VLEN     P+  V V D D+G N++ ++++  +    +++                               I+     DRE  + Y   ++A D G PP+S+   + INVLD ND  P    PS S S  ++ P     + +  + A D D G N+EL YS    N  ++LF ++P  G+I L + +   H    + L+V V D G P     A + I +
Sbjct:   36 VMDFSVGWFLLFALLVDSINSA-LGGILYHVREEQPPNTLIGSLAAD---------QGLPDSG------HLYKLEVGAPYLRVDGKTGEIFTTEIPIDRETLKD-----CRIKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLS---AGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDP-VPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKK-------KYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVEPDVGNFVVQNGT--------------------------GTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKPSNS-SFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGN-PHELFYISPSDGEIKLTKELTRKHG-GLHRLVVKVSDRGKPSRHAIALVHIYV 811          
BLAST of Protocadherin-1 vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 290.041 bits (741), Expect = 1.918e-81
Identity = 244/762 (32.02%), Postives = 365/762 (47.90%), Query Frame = 3
Query:  348 KPIYK---FQFFNCEKSSVYFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQC--NLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNN-----AKITENEAPGKLVAVFSVQDKDSNENGKVTCH--------LEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAK-IFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIY-LYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIP 2573
            KP+YK         E S+          + T   RIDR+ LC  V         +C   +++ +  D+ F  ++ +   ++DINDN+P +    +     E + I +   +  A D D G NGI +Y +   ++EF L  II T        +  +L++++ LDRE  D +   +   DGGNP  + +  + V V+D NDN PVF+ +   ++V EN    T V QL A DAD   N +I +  S+   P   + F+I+S++G I V+  LD E+     LIV A+D       S  TVI+N+ D+NDN P I    +R+  N       ++EN      +A+ +V D+D++ NGKVTC+        L+P+ N++F LE             T    D E   +    IV  D G P   TS  V + ++D ND AP F +      + E+  PGT L  I ATD D G NAL+ YS+ G DA   F+I+   G + +   LDRE  E   FT  A D+G     S   + +IV+D NDN P    + Y  YV EN      +  + VTDAD G N+   VTL      ++I  KD + I                   P   +I      DRE  + Y  V++A D G    ++   + INV+DVND +P F+ PS + S   V   T  G+ + ++ AID D G N+EL+YS    +    LF ++  +G I+LQ+ I  + +   + L+V VKD G P
Sbjct:  104 KPVYKTGDVPLVRVEAST--------GEIFTTANRIDRERLCSGV-----FNEKRCFYEIEVAVLPDEIF-RLVKIRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGINGIQHYELVKSVSEFGLD-IIETP----EGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGS--ATPSRATVIVNVTDVNDNVPSI---DTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYTDHDVPFRLKPVFNDQFLLE-------------TAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSL-GPDAPDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAFTHAEYNFYVPENLPLYGTVGLITVTDADAGDNA--IVTL------SIINGKDNFIID------------------PKTGVIKPNITFDREQQSSYTFVVKAVDSGLIQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPFTTNPGSVVTRVFAIDNDTGMNAELQYSIIGGSPRG-LFAIDKTTGNITLQEKIANADQ-GLHRLVVKVKDLGQP 799          

HSP 2 Score: 147.902 bits (372), Expect = 1.471e-35
Identity = 160/564 (28.37%), Postives = 248/564 (43.97%), Query Frame = 3
Query:  288 LGAQATKWFPTDVNKLQDFGK-PIYKFQFFN--CEKSSVYFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFS-HIIVLVIEVKDINDNSPFWSQNELVTQ------FSEGSEIGDSKSLTVALDNDFGTNG-ISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHF----SEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAK-IFSINKLDGKVFLETDLDRESVESLH-FTTRAADSGYPKQL-STANITVIVKDINDNFPFL 1925
            +G   T+   TD     D G      F F N     +  +F I+   G+IT+++ +DR+             +N  +  + + SD   +     +++ V D+NDN P      ++         SE + +    +L    D D   NG ++ Y  +     F L  + N         +Q  L     LD E   +Y   + A D G P  N S  V++ + DENDN+PVF +    +S+ EN    T +I++ A DADS  N  I Y +     P+    F+I+  SG + V   LD E     S  V A D G+    S  TV + ++D NDNSP   F  + +  N  + EN      V + +V D D+ +N  VT  +     + F ++    P T + K +   +FDREQ+S  T  +   D G  + T+   V++ V D+ND  P F    S  SY   V     PG+ +  + A D D G+NA L YSI G   + +F+I+K  G + L+  +     + LH    +  D G P+ L S A + + V D   N  FL
Sbjct:  304 MGTSVTQLHATDA----DLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRE-------------SNPVHKLIVLASDGSATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCY--TDHDVPFRLKPVFN---------DQFLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLG----PDAPDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPA--FTHAEY--NFYVPENLPLYGTVGLITVTDADAGDNAIVTLSIIN-GKDNFIID----PKTGVIKPNI--TFDREQQSSYTFVVKAVDSGLIQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDL-VPFTTNPGSVVTRVFAIDNDTGMNAELQYSIIGGSPRGLFAIDKTTGNITLQEKIANAD-QGLHRLVVKVKDLGQPESLHSIALVHLFVNDTVSNATFL 822          
BLAST of Protocadherin-1 vs. Ensembl Sea Lamprey
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 273.092 bits (697), Expect = 6.954e-77
Identity = 241/760 (31.71%), Postives = 368/760 (48.42%), Query Frame = 3
Query:  357 YKFQFFNCEKSSV-YFEINPLNG-VITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIK----SDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPE----ITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYA-----KLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAP--GKLVAVFSVQDKDSNENGKVTCHLEPIANEE--FSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAK-IFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVK-VKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGI 2570
            YK      E ++     +NP  G +    R++DR+ LC           ++C++D+ +         F  +I + I V+DINDN+P ++   L     E +  G    +  A D D   NG+  Y + P     ++ FELS     N      ++   LV++K LDRE+   YE  + A DGG+P  +GS  + + VTD NDNSPVF++A   + + EN    T V+QL A D D+  N ++ Y++ + T    +     +LF ++ NSG + V   L+ E      +I+ A D G     +T TV + + D+NDNSP I         N  I  +EA      VA+ +V D D   NG VTC+   I N E  F L+++  P    Y + T ++ D E K++    I   D G    + + SV++ + D ND AP F+E +Y   V E+   G +L T++ATD+D   NA + Y   G DA  +F ++   G + L   LDRE   +  FT  A D G P     A + V V D+NDN P F       YV EN      +  V V D+DEG N   +++++                         + +  LFS+ P+  +I    G DRE    Y + ++ATD G P +S+   + I+V+D+ND  P  + P  SN+T K V PRT+ GT + ++ A+D D   N+EL Y     N  N LF ++P  G I+L + + E+H    + L+V V D GI
Sbjct:   71 YKVMLSKAEDAAPPLVRVNPRTGELFAAGRKMDREALC-----GGQDPGDECHVDVQVGVLPVQPGPFFKLIEVRINVEDINDNAPAFAAPVLTVSVPENAPAGKRFPIQPANDPDSEANGVRRYELLPSDPATVSAFELSVTETAN-----GEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEASHVNLPVALITVSDPDIGANGAVTCY---IYNPEVPFQLKKLTYP--NQYLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVY-FLGPDAPTMFHMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVGMVTVADSDEGENGRVRLSILG------------------------TDNRQLFSIDPESGMIRSNVGFDREQRHYYVLEVQATDGGEPVRSSTVKVVIHVMDINDNSPIVLMPP-SNTTYKFVVPRTLPGTIVTEVSAVDNDAEINAELRYHIVGGNPHN-LFHIDPVIGNITLMEPLTETHH-GLHRLVVRVSDIGI 787          

HSP 2 Score: 125.946 bits (315), Expect = 1.508e-29
Identity = 165/616 (26.79%), Postives = 245/616 (39.77%), Query Frame = 3
Query:  897 IKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSI---ESNSG----YIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEE---------FSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEG------------NPRQTTSGSVSVGVEDINDEAP-----HFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKL--DGKVFLET--DLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIY-LYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESINGDS 2630
            I+V + V D NDN+P F   V  +SV EN  +        A D DSE NG   Y++   + P     F +   E+ +G    Y+ VR  LD E      + + A D G+     +  + IN+ D NDNSP   F+ +    N +I EN   G  V      D+D+  N +V   L                F L++ +  +TV          +RE+       I+  D+G                    S ++ + DI   AP     + SE S   HVN  V        I  +D D G N  ++  I+  +   F + KL    +  LET   LD E+        +AAD+G      T ++T+ + D NDN P   +  Y + V EN+     L+ V+ TD D   N+E    L  +  T                         +F + P+  +I     LDRE    Y   I A D+G P       + +NVLDVND +P+F   S +     V       +T+  +   D DEG+N  +  S    +    LF ++PESG I          +   YVL V   D G P    T ++ I +  IN +S
Sbjct:  137 IEVRINVEDINDNAPAFAAPVLTVSVPENAPAGKRFPIQPANDPDSEANGVRRYELLP-SDPATVSAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSP--VFDQAEV--NVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVN------GLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDI--VAPVNGVIYISEAS---HVNLPVA------LITVSDPDIGANGAVTCYIYNPEVP-FQLKKLTYPNQYLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFLGPDAPT-------------------------MFHMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRF---SLAEFDFYVNENVPKHSTVGMVTVADSDEGENGRVRLSILGTDN-RQLFSIDPESGMIRSNVGFDREQR-HYYVLEVQATDGGEPVRSSTVKVVIHVMDINDNS 699          
BLAST of Protocadherin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010725.1 (pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 gene:ENSPMAG00000009713.1 transcript:ENSPMAT00000010725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 258.455 bits (659), Expect = 2.950e-72
Identity = 219/767 (28.55%), Postives = 344/767 (44.85%), Query Frame = 3
Query:  405 INPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLV---IEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISP------EITEFEL-------SYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVF-EKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQI-SSLTKPEYAKLFSIESNSGYIHVR--WELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSP--EIYFEPSRFT--NNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLE-PIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKS--------YIFHVNEDVKPGTYLFTINATDKDEGINALLSYS---IFGKD--AKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKS-----IYLYVLENHTADVPLV-QVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIA-QIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNG 2567
            +N L+G +++  R+DR+ LC   P  C        + +   +    S  + L+   + V+DIND++P +    L    SE   +G    L  A+D D GTN I +Y IS       ++  F L                      +  L L+++LDRE +  YE ++   DGGNP  +GS+ + + V D NDN+PVF +     + + E+ +  T V+QL+A D D+  NG I Y   + LT         ++  +G + VR   +LD ET     L+V A D G L R ++ TV + + D NDN+P  E+      +      KI EN   G  V + SV D D   +G V   LE P   E  S      P  V + + T +  D E+  +    ++  D G P+ +   ++ + V DIND  P F   +        Y   + E+   GT +  + ATD D G N  ++++   + G +  A++FS+N   G++ L T LDRE       +  A D G P++ + A + V V D NDN P F+  S     +Y + +E  T+    V  V+ +D DEG N+   + LV E     I    + P                      G ++     LDRE   +YE+ + A D G P  S    + I V D ND  P    P+ +++   V+  + +G  +   + A D D G N    Y     N    +FL+N +SG +SL +T+  S     + L+V V+D G
Sbjct:   76 VNELSGELSVALRLDREALCMEEPDACRSTGFMHTVQVAAMAKGQGSSNLRLLDVQLLVRDINDHAPAFRAPHLNVSISESEAVGRRVPLPRAIDPDAGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGAELAS------PNKVQFLLKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLVREAGPDWIGGAGDTP----------------------GGVVRTLVVLDREDRVQYELSVRAVDSGRPALSASCRVSITVSDTNDNAPVITSPNTNDTWKHVRTFSPAGMLVGVSVTANDIDAGDNGRPLYEIIGGNPKG-IFLLNADSGALSLARTVS-SLDEGLHRLVVRVRDRG 812          

HSP 2 Score: 142.124 bits (357), Expect = 1.488e-34
Identity = 158/620 (25.48%), Postives = 263/620 (42.42%), Query Frame = 3
Query:  897 IKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKP--EYAKLFSIES------------------NSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNI-PLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFS----EKSYI----FHVNEDVKPGTYLFTINATDKDEGINALLSYSI-FGKDAKIFSINKLDGKVFLETD--LDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFL--PKSI-------YLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSL-LPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVK---VKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESIN 2621
            + V + V D ND++P F      +S++E+      V   +AID D+  N    Y+IS+ +    +      +ES                  +   + +R +LD E   +  L++   D GN +   +  + I + D NDN+P ++ +P   T   +ITE+   G  V      D D+  NG +            +   +++   T +  +   +  DRE        +V  D G   ++ S +V+V + D ND AP F     +  Y+      + E++  GT +  I+ +D D G +  +   + F   A++ S NK+  +  L+T   LD E  +  + +  AAD G PK     N+ + V DINDN P    P SI        + + EN  A   ++ +  TDAD G N     TL SE A                    +S +  LFSL +  G+L +  + LDRE   +YE+ +EA D G+P +  + I+ + VLD ND  P F+  S S + +    V+  T  GT +  +   D DEG N+ +  +       + +       G +     + +      Y L V   D+G P L  + R+ I +   N
Sbjct:  128 LDVQLLVRDINDHAPAFRAPHLNVSISESEAVGRRVPLPRAIDPDAGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAP-VFVDPP--TRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGAELASPNKV--QFLLKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTL-SELAG------------------GESVAE-LFSLNMRTGQLTL-ATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLVREAGPDWIGGAGDTPGGVVRTLVVLDREDRVQYELSVRAVDSGRPALSASCRVSITVSDTN 721          

HSP 3 Score: 65.855 bits (159), Expect = 4.338e-11
Identity = 73/305 (23.93%), Postives = 133/305 (43.61%), Query Frame = 3
Query: 1758 INKLDGKVFLETDLDRESV--------ESLHFTTRAADSGYPKQLSTAN-----ITVIVKDINDNFP-FLPKSIYLYVLENHTAD--VPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFK---SNNQTNDLFLMNPESGKISLQQTIQ-ESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIE 2612
            +N+L G++ +   LDRE++         S  F      +   K   ++N     + ++V+DIND+ P F    + + + E+      VPL +    D D G NS     + + +   L              D      +    +     L +RE  LDRE    YE+++   D GNP  S   ++ I V+D ND  P F+ P      V++   +  GT++ Q+ A D D G N  + YSF    ++  T     ++  +G ++++   + +   +  + L+VV +D G  +L  +A + + +E
Sbjct:   76 VNELSGELSVALRLDREALCMEEPDACRSTGFMHTVQVAAMAKGQGSSNLRLLDVQLLVRDINDHAPAFRAPHLNVSISESEAVGRRVPLPRA--IDPDAGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQ-LDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDP--PTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGG--QLSRSASVTVTVE 373          
BLAST of Protocadherin-1 vs. Ensembl Sea Lamprey
Match: si:ch211-199f5.1 (protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660])

HSP 1 Score: 231.876 bits (590), Expect = 1.793e-63
Identity = 186/662 (28.10%), Postives = 306/662 (46.22%), Query Frame = 3
Query:  351 PIYKFQFFNCEKSSVYFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEI---YFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIF-----GKDAKIF-SINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLYVLENHTADVPLVQ----------VNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINV 2279
            P   F+    +  S+   +   +G ++    IDR+  C   P+C  + +  C L   +        ++   +E+ DIND++P ++++E+  + SE   +G    L  A D D G N +  Y +  E   F L+    T+   Y+      LV+K +LDRE+  +Y   + A+DGG+P  +G+  V + V D NDNSPVF +    ++V E+    T ++ L A D D   NG++ Y  SS    E  +LF ++  +G + ++ +LD+E  +   + ++A DMG     + C V++++ D+NDN+PEI   +   SR  +   ++E  A    V + +V D DS ENG V CHL    +  F L    +P    Y + T  S DREQ +     +   D G P +  +   +V + D ND  P F   +Y   + E+  PG Y+ T+ A D D   N +++Y++      G     + SIN   G ++    LD E++ SL F  +A D G P  ++ A ++V + D NDN P +        L N T  V L +          V   D+D   N E    +V      L +      I +L  +V   F+N+  + + D               T++ +V+   DRG+P  S    I I V
Sbjct:   60 PSRHFRLMRRDDFSL-VHVEEADGTVSAREVIDREQQCGQAPSCVIRFDVLCTLPRGL------FQLVHAEVELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHLD-ENERFGLALRARTDGAKYAE-----LVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSR-GDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHLR--GHPHFKL----LPYRDDYVVVTNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVPPLVTNATVSVRIVDENDNAPVVTHP----PLRNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRIVQGNERNLFR------INRLGGEV---FTNA--ASVTDAA----------ASATRHSLVVMVRDRGSPALSATAAIEIRV 676          

HSP 2 Score: 139.813 bits (351), Expect = 6.147e-34
Identity = 146/526 (27.76%), Postives = 230/526 (43.73%), Query Frame = 3
Query: 1095 LFSIESNSGYIHVRWELDYETYT--TISLIVEANDMGNLRRG--STCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKS-FDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGK-DAKIFSINKLD---GKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLP--DGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEY----SFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRL--EDTARLRIIIESIN 2621
            L  +E   G +  R  +D E       S ++  + +  L RG        + + D+ND++P+     +R   + +I+E+ A G  V +   +D D   N     HL+   NE F L          Y    +KS  DREQ+ + T  +  +D G+P ++ +  V + V D ND +P F++ S    V ED  PGT L T+NATD DEG N  + YS     DA++  + +LD   GK+ L+  LD E       + +A D G     +   + V V+DINDN P     I L  +     D   V        EG   E+ V LV+    + I   +   +    R       +  F LLP  D  +++  S LDRE    Y +V+EA+D G PP+       + +LD ND +P+F   +   S ++       G  +  + A D D   N  + Y    S  +    +    +NP SG I   + + +   +      V  +D+G+P L    T  +RI+ E+ N
Sbjct:   74 LVHVEEADGTVSAREVIDREQQCGQAPSCVIRFDVLCTLPRGLFQLVHAEVELLDINDHAPDF----ARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHLD--ENERFGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAP----EIKLDFIMQSRGDTVFVS-------EGAAYESFVGLVT---VSDIDSAENGLVACHLR------GHPHFKLLPYRDDYVVVTNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLE---NNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPL-DYEAMTSLTFQVQARDDGVPPLVTNATVSVRIVDENDN 569          
BLAST of Protocadherin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006996.1 (pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 gene:ENSPMAG00000006222.1 transcript:ENSPMAT00000006996.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 230.335 bits (586), Expect = 1.523e-61
Identity = 233/789 (29.53%), Postives = 339/789 (42.97%), Query Frame = 3
Query:  288 LGAQATKWFPTDVNKLQDFGKPIYKFQFFNCEKSSVYFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKI--DKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEY-QISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDM--GNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLK-SFDREQKSKVTAH------IVCFDEGNP--RQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKI-FSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYIN--VLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLR 2600
            LG    +   TD++    FG+  Y F        S  F ++P +G+I++   +D +       T   +          ++            I + D+NDN+P + ++  V    E            A D D   N    YSI P  T    SY   T +  Y       + L + LD EKI        + A DGG+P  N ++  IV V DENDNSP+F++  Y I++ EN+ +   V+ + A D D       EY Q+S +   E +  F I + SG I     LD E  +   LIV A D   GN ++    TV I + D+NDN P     P   T    I EN   G  +   S  D D NENG +   ++P  N  +   R+N       KI T     DRE  + ++        +   D G+P  R T S +V+V ++D+ND  P F    Y   V E +   + LF + ATD DEG N  ++YS+     +  F ++   G +     LDRE+V +      A D G P   ST  ++++V D+NDN P F P    + ++E+   D  ++ +N TDAD GLN+E    +          +  ++ +   FRD                 L+     LDRE    Y +VIEA D G       G   ++  VLDVND +P F+   GS   V V      G  I Q+ A D DEG N  + Y   S NQ  + FL+N  SG IS   T  +   V  + L V   +N    L    R+R
Sbjct:   45 LGTSVVQVLATDLDA-GVFGQVSYHFS-----DDSDKFSLDPASGLISVAAALDFEATPRFTVTVMARDGGGQETAGRVR------------INLLDVNDNTPVFQRDSYVGTARENDNSLTPVVRVRATDEDSPPNNQITYSILP--TSAYSSYFSITVSGGYG-----VVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQSP----EYGQLSLIYSLEGSTQFRINARSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVT----IVENTPGGTDIFTVSAADPDLNENGTLVYAIDP-PNPFY---RIN---AASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALPRPDFQLDAATGLITTLVQLDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPTFHPARSAVSLMESVARDSVVISLNCTDADSGLNAELSFFITGG------NQDGQFSVG--FRD----------------GLVRTVVSLDRETKASYSLVIEAIDNGPAGSRRTGTTTLDVLVLDVNDNRPLFL--EGSYE-VSVPENVTRGAIILQVQATDIDEGINGRVWYRIISGNQDGN-FLVNVSSGLISRGATPLDRETVALHALQVEAFNNDSVGLSSVIRVR 765          

HSP 2 Score: 179.489 bits (454), Expect = 9.818e-46
Identity = 177/602 (29.40%), Postives = 277/602 (46.01%), Query Frame = 3
Query:  891 GSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTL-KSFDREQ--KSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDE----GINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSG----YPKQLSTANITVIVKDINDNFPF---LPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESG--LDRE------VTTKYEIVIEATDRGNPPKSTKGIIYINVL--DVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKI-SLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESIN 2621
            GS +V + + +ENDN P+F   +Y +SV EN    T V+Q+ A D D+ + G++ Y  S     + +  FS++  SG I V   LD+E     ++ V A D G   + +   V IN+ D+NDN+P   F+   +   A+  EN+     V      D+DS  N ++T  + P +         +I ++  Y + TL ++ D E+     ++  I+  D G+P   ++ +  V V D ND +P F   SY   + E++  G  +  +NATD D+    G  +L+ YS+ G     F IN   G +   T LDRE+V       RA D G        ++T NIT++  D+NDN P    LP ++   ++EN      +  V+  D D   N             TL+   D  P    +R    S           GK  IR +G  LDRE        +   IV+   DRG+PP+       + VL  DVND +P F+   G    ++V     + +T+ Q+ A D DEG N  + YS  +     D F ++  +G I +L Q  +E+  V  Y L +V  D G P L  T  L +++  +N
Sbjct:   12 GSARVHITLINENDNRPIFSLPLYNVSVWENATLGTSVVQVLATDLDAGVFGQVSYHFS-----DDSDKFSLDPASGLISVAAALDFEATPRFTVTVMARDGGG--QETAGRVRINLLDVNDNTP--VFQRDSYVGTAR--ENDNSLTPVVRVRATDEDSPPNNQITYSILPTSAYS---SYFSITVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQSPEYGQLSLI-YSLEGSTQ--FRINARSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLL--DVNDNDPAWRDLPYAV--TIVENTPGGTDIFTVSAADPDLNENG------------TLVYAID--PPNPFYRINAAS-----------GK--IRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFV---GLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALPRPD-FQLDAATGLITTLVQLDREA--VAAYQLRLVATDRGTPALSSTTTLSLVVLDVN 559          

HSP 3 Score: 172.94 bits (437), Expect = 1.192e-43
Identity = 157/566 (27.74%), Postives = 251/566 (44.35%), Query Frame = 3
Query:  822 DREKIDKYEFIVNAFDGGNPSFNGSIK------VIVAVTDENDNSPVFEKA-VYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTK----PEYAKLFSIESNSGYIHV-RWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFL---PKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPP--KSTKGIIYINVLDVNDCKPKFI-FPSGSN--STVKVKPRTVSGTTIAQII-AIDEDEGKNSELEYSFKSNNQTN 2456
            DRE  D Y   V + DGG       +       V V VTDENDNSP FE     ++ V E+    T +  L A D D+  NG +  +  + T     P+Y  +   ES    + V + +   +T   I   + A D G+  R +T  + + + D+NDN P I+  P  +     + E  APG LVA     D D+  NG+VT  +E    ++ S+     P   + +++   + DRE ++  T  +V  D GNP  + S  V V V+D+NDE P F        V E +  G+++ T+ AT+  +G N   +Y I G     F+++   G V     L  +S E  + T  A D G P     A + V V D+ND+ P     P    + + E     + +V+V   D DEG N   + + +       +  +D     + FR    S             +I     LDRE    Y +++ A+D+G P   +ST+ +  + + D++D +P FI  P G     +  +   +  GT +  +  A+D D G N+ + Y   + N+ N
Sbjct: 1792 DREATDSYMLTVLSRDGGPREAIAVLTNKPGAYVYVNVTDENDNSPEFEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVP-IFLSPGGYA--VSVVELGAPGTLVASVWATDADAGPNGQVTFRIESGGGDKLSIG----PSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKATENYKGHNTKYTYKIAGIGKNAFTVHATSGLVTSTRLL--KSYERFNLTAVATDHGRPPLWGQAGLYVEVLDVNDHRPVFVLPPNGTVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGG---VGSRD----WESFRINATS------------GIISTARALDRESQAVYSLILLASDQGQPVSYESTQPLQVV-LDDIDDNEPVFIVLPDGGAPYQSFSIPEHSPPGTAVGNVSGAVDADVGANAIVYYFIAAGNEGN 2328          

HSP 4 Score: 172.17 bits (435), Expect = 1.765e-43
Identity = 202/786 (25.70%), Postives = 336/786 (42.75%), Query Frame = 3
Query:  387 SSVYFEINPLNGVITIE--RRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGS-EIGDSKSLTVALDNDFGT--NGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEY------------AKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCT------VIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTC----HLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHF-SEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDG--KVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTV----KVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTN----DLFLMNPESGKISLQQTI-QESHKVCCYVLIVVVKDNGIP-RLEDTARLRIIIESIN 2621
            SS YF I+   G +++   + +DR+ +             +  L + ++     +  + L + V D+NDN+P ++         E S  +G S  +  A+D D G    G   YSI+              N     ++    +V    +D E   +Y  +V A D   P    S ++ V++ +E D    F  A Y  +++E     T V+++ A     +   K+   ++ L +  +            A+L  I +  G I  +  LD E   +  L V + D G     +  T      V +N+ D NDNSPE  FE    T   ++ E+ APG L+ V    D+D+  NG V+     H       ++ L   N     +  ++    F  +    +   IV  D G+P ++T+ ++SV V D+ND  P F S   Y   V E   PGT + ++ ATD D G N  +++ I        SI   DG  +V    ++DRE+  +      A D G P    +A + V+V D+ND  P FL     + VLE+ +    +  V  T+  +G N+                 K  Y I  + ++     + S   L+   +L+        +   ++ +   ATD G PP   +  +Y+ VLDVND +P F+ P   N TV    +V P  +    I +++A+D DEG+N  + YSF           + F +N  SG IS  + + +ES  V  Y LI++  D G P   E T  L+++++ I+
Sbjct: 1547 SSAYFLIDRDRGNVSMALGQGLDREGI----------PGGRLELTILVQDGGRRNATVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIAS-----------GGNDTFGIDESTGLIVTVAPIDYETRPEYLLMVVATDQAPPFHTASCELRVSLQNELDEKLSFSLAAYQAALSEAAVPGTVVVRVAA--PQMKAPPKLPLPLAILVQKWHEDKRHKQQESDNAEL--IAALQGEITTQAALDREATDSYMLTVLSRDGGPREAIAVLTNKPGAYVYVNVTDENDNSPE--FEAGSAT-LVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESGVTIVDVAK-ADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVPIFLSPGGYAVSVVELGAPGTLVASVWATDADAGPNGQVTFRIESGGGDKLSIGPSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKATENYKGHNT-----------------KYTYKIAGIGKNAFTVHATS--GLVTSTRLL--------KSYERFNLTAVATDHGRPPLWGQAGLYVEVLDVNDHRPVFVLP--PNGTVVNITEVMPVVIR---IVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWESFRINATSGIISTARALDRESQAV--YSLILLASDQGQPVSYESTQPLQVVLDDID 2269          

HSP 5 Score: 122.865 bits (307), Expect = 2.391e-28
Identity = 156/599 (26.04%), Postives = 255/599 (42.57%), Query Frame = 3
Query:  891 GSIKVIVAVTDENDNSPVFEKAVYIISVNENLQ-SNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTIS-LIVEANDMGN---LRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHL---EPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGIN--ALLSYSI--FGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADS----GYPKQLSTANITVIVKDINDNFPFLPKSIY-LYVLENHTADVPLVQVN----VTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDRE--VTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEG--KNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIE 2612
             +  V++ +TDENDN+P F  A Y + + E    +   V  + A D D   N ++ Y I S      A  F I++ +G +     LD+E    +  L+V A D       R  ST TV +++ D+ND +P  +F  S +     ++E + PG  +A F   D+DS  NG++   +   +P    EF +   +  L V   +      DRE ++     I+  D G P   ++ +V V V D++D  P F        ++E       +  + A+D +EG N  ALL +S   F    + F  +   G V++   LDRE V     T    D+     Y ++ S   I  I+ D NDN P   +  Y   + EN      L  +N     +DAD G+N+    +L+  ++   +  +D         +V+ +                   GLDRE     + E+ I   D G    + +  + + VLDVND  P F   S +   ++  P    GT++  + A+D D G      + YS  S    ND F ++  +G I     I    +   Y+L+VV  D   P    +  LR+ ++
Sbjct: 1154 ATTSVLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEGDNARVVYAIVS---GNTAATFGIDNGTGVLTAVKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTP--WFLRS-YEGPIDVSEGQ-PGPRIATFMASDQDSGLNGELEYSIIDGDP--RNEFVISPADGDLRVRRYV----ELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVSRVRASDANEGRNCAALLQHSPTSFCNGERAFYADSQTGLVYVNRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTIL-DENDNSPVFSQVTYEAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAYSLLGGSSAYFLIDRDR-------GNVSMALGQ----------------GLDREGIPGGRLELTILVQDGGRRNATVR--LGVTVLDVNDNTPTFNVTSQTAHVLENSPAV--GTSVIVVKAMDRDLGVCDAGTVRYSIASGG--NDTFGIDESTGLIVTVAPIDYETR-PEYLLMVVATDQAPPFHTASCELRVSLQ 1708          

HSP 6 Score: 119.783 bits (299), Expect = 2.142e-27
Identity = 181/728 (24.86%), Postives = 299/728 (41.07%), Query Frame = 3
Query:  564 IEVKDINDNSPFWSQN-ELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSI---SPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYT--TISLIVEAN-DMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFS----VQDKDSNENGKVTCHLEPIANEEFSL--ERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKP-GTYLFTINATDKDEGI--NALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVK-DINDNFPFLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYP------IQKLFRD----VTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGI--------IYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTND----LFLMNPESGKISLQQTIQES--HKVCCYVLI-VVVKDNGIPRLEDTARLRIIIESIN 2621
            + V D+ND +P++ ++ E     SEG + G   +  +A D D G NG   YSI    P   EF +S               L++    +LDRE    Y   + A D G P  N ++ V V V D +DN PVF       S++E       V +++A DA+   N     Q S  +     + F  +S +G ++V   LD E      ++L V  N D  +  R  +  +I+ I D NDNSP      S+ T  A+I EN   G ++ V +      D D   N  +   L   ++  F +  +R N+ + +       +  DRE        +    +   R+  +  + V V D+ND  P F+  S   HV E+    GT +  + A D+D G+     + YSI       F I++  G +     +D E+         A D   P   ++  + V ++ ++++   F   S+  Y      A VP                   T+V   A   +K   + P      +QK   D      +S +  L + L  G+ I  ++ LDRE T  Y + + + D G  P+    +        +Y+NV D ND  P+  F +GS + V+V+     GT +  + A D D G N  +     ++  T      + ++  ESG +++    +     K   ++L  +V  D G P    T  L +I+  +N
Sbjct: 1270 VHVADVNDVTPWFLRSYEGPIDVSEG-QPGPRIATFMASDQDSGLNGELEYSIIDGDPR-NEFVIS----------PADGDLRVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVSRVRASDANEGRNCAALLQHSPTSFCNGERAFYADSQTGLVYVNRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVF----SQVTYEAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAYSLLGGSSAYFLIDRDRGNVSMALG------QGLDREGIPGGRLELTILVQDGGRRNATVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGGNDTFGIDESTGLIVTVAPIDYETRPEYLLMVVATDQAPPFHTASCELRVSLQNELDEKLSF---SLAAYQAALSEAAVP------------------GTVVVRVAAPQMKAPPKLPLPLAILVQKWHEDKRHKQQESDNAELIAAL-QGE-ITTQAALDREATDSYMLTVLSRDGG--PREAIAVLTNKPGAYVYVNVTDENDNSPE--FEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESG-VTIVDVAKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVN 1947          

HSP 7 Score: 86.2705 bits (212), Expect = 3.740e-17
Identity = 123/519 (23.70%), Postives = 201/519 (38.73%), Query Frame = 3
Query:  276 KVIDLGAQAT---KWFPTDVNKLQDFGKPIYKFQFFNCEKSSVYFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISP----EITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVF--EKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEY---QISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGN-LRRGSTCTVIINIRDLNDNSPEIYFEPSRFT--NNAKITENEAPGKLVA-VFSVQDKDSNENGKVTCHLEPIANE--EFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQT---TSGS------------VSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIF 1733
             V++LGA  T     + TD +   + G+  ++ +    +K      I P +G+I +    + D       T      ++ N  L+  +       IV V+ V D+ND  P +          E   +G   +   A +N  G N    Y I+       T    S ++ +  ++ S                  +++     A D G P   G   + V V D ND+ PVF       ++++ E +     ++++ A+D D   NG + Y       +   ++   F I + SG I     LD E+    SLI+ A+D G  +   ST  + + + D++DN P     P       +  I E+  PG  V  V    D D   N  +  +     NE  +F+L R  +       +  L   DRE        I+     NP  T   T+G             V V +EDIND+ P F+   Y   V  D K G+ L  + A D+D G N+++ Y I 
Sbjct: 1962 SVVELGAPGTLVASVWATDADAGPN-GQVTFRIESGGGDK----LSIGPSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSA-------IVRVL-VDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKATENYKGHNTKYTYKIAGIGKNAFTVHATSGLVTSTRLLKS-----------------YERFNLTAVATDHGRPPLWGQAGLYVEVLDVNDHRPVFVLPPNGTVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWES-FRINATSGIISTARALDRESQAVYSLILLASDQGQPVSYESTQPLQVVLDDIDDNEPVFIVLPDGGAPYQSFSIPEHSPPGTAVGNVSGAVDADVGANA-IVYYFIAAGNEGNKFNLSRWGL-------LVVLSDLDREVSPYYA--IIVKASSNPNWTPAVTTGPEFDPSKDRTLREVRVYLEDINDQWPVFTNHEYTAGVAVDAKVGSELLQLEAVDRDVGNNSIVLYRIL 2439          
BLAST of Protocadherin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008517.1 (pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 gene:ENSPMAG00000007697.1 transcript:ENSPMAT00000008517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 219.164 bits (557), Expect = 4.072e-58
Identity = 188/697 (26.97%), Postives = 309/697 (44.33%), Query Frame = 3
Query:  558 LVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYI-INTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAK-IFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIY-LYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISL-----QQTIQESHKVCCYVLIVVVKDNGIPR-LEDTARLRIIIESIN 2621
            LV+ V D+ND++P ++ +      SEG+  G       A+D D G N    YSI   ++  +L +  ++ +T + +   +        +DRE        ++A D G         + V + D ND  P+F +  Y+ +  EN      V+ + A D+D   NG + Y        +Y ++F ++S +G +     LD E      L+V+A D G+   GST  V + + DLNDN P  Y  P ++   A I ENE  G  V   +  D D   NG V   L       F +        V   +ST  S DRE+++     +   D G+ R  +   V++ V D  D  P F+   Y F V E+V PGT + +++A+  D  +NA ++Y I   D +  FSI    G++F    +DRE          A   G   +   A+++V+V D+N++ P   ++ Y + + E+   +     V  TD D G N E K                         ++ +      F + PDG+L +R   LDRE   +Y + + A D G  P S+   + + VLDVND KP F   + S+           G+ +  + A D D G N  + YSF+   Q N  F ++ E+G+I+      ++ +        +   VV  D G P+ L+D A +++ ++ +N
Sbjct:  327 LVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSI---VSGNDLGWFSVDESTGLVTTDGK--------VDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFY--PVQYF--ASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVN------AVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLD--LNANVTYLIVSGDQRGSFSIEWSGGRIFTANAIDREEQAFYQLRVVANSGGVAGE---ASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKY------------------------EIGEGNGGEKFGIFPDGQLYVRYE-LDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLF---NSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFE-KPQVN--FELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVN 966          

HSP 2 Score: 214.157 bits (544), Expect = 1.641e-56
Identity = 194/708 (27.40%), Postives = 313/708 (44.21%), Query Frame = 3
Query:  564 IEVKDINDNSP-FWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYS------------ISPE-ITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEI---YFEPSRFTNNAKITENEAPGKLVAVFSVQDKDS-NENGKVTCHLEPIANEE---FSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNP-RQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIF-GKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLY-VLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQ--KLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIII 2609
            + V D+NDN+P F     +   F E + +G    L  A+D D G NG+++++            + P  +T+    ++  T  +                DRE    Y   V A DGG+P   G ++V V V D NDN P FEK  Y  SV E+    +PV         + +   +      L  P        +  +G +  R  LD+E     +L + A D GN       T +I + D+NDN P I   Y  P+    +A + E+ APG + A+ +V D DS   NG+++  +  +   E   F L    +P   + K+++    DRE+       I+  D G P  ++ + S+ V V D+ND AP F+  +Y   ++E    G+Y+  + A D D G+NA L YSI  G D   FS+++  G V  +  +DRE   S+     A D G   + +  ++TV + D+ND  P   ++ Y+   +EN    + +V V+  D+D G N   +                + P Q  ++FR         L SL   GK+   +S LDRE   +Y +V++A DRG+PP  +   + + V D+ND  P F       S ++ +P     T +  + A D D G N  + Y   + +     F +N  +G +S + ++    +   Y L V   D G  R    A + I +
Sbjct:   11 VVVGDVNDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAVDRDVGPNGVNHHAYKIVSGNEEGRLVPPRPVTKRAFLHLATTGPL----------------DREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAED----SPV--------GAALRDLLHRGRGPLAVP-------FDPKTGMVSTRQPLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPA--ARSASVDESAAPGTVAALVTVTDADSPTANGELSVSI--VGGNERGHFVLHAPGVPGLRVLKVAS--QLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNF-----------DPDMPAQYREMFR---------LDSLT--GKVTTLKS-LDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGG---TAVTTVTATDPDRGANGTVRYQLTAGDAAR--FQVNAVTGAVSTRVSLDREER-AVYQLQVTALDGGHLRARSPAIVTITV 648          

HSP 3 Score: 206.838 bits (525), Expect = 3.694e-54
Identity = 178/596 (29.87%), Postives = 266/596 (44.63%), Query Frame = 3
Query:  822 DREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLE-PIANEEFSLERMNIPLTVMYKISTLKSFDREQ------KSKVTAHIVCFDEGNPRQTTS-GSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSI-FGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIY-LYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSET--ATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIP 2573
            DRE+   Y+  V A  GG     G   V V V D N+++PVF++A Y +S+ E+   N+    ++A D DS  NG+++Y+I      E   +F      G ++VR+ELD ET    SL V A D G     S+ TV + + D+NDN P   F  S +  +    E +  G LV      D D+  NG VT   E P  N E   E          +I++L+ FDRE        +  +  +V  D G P+      +V V V+D+ND  P F++  Y   V+E     T L  + A+D DEG+N  L Y+I  G +   F+++   G++ L   LDRE   S      A DSG     ++  + V V D NDN P   +S+  +  LE+      L+ +  +D D G + + +  +V+    AT  I R                 + S+F        + R   LD E    Y + + A D G PP+S+  I+ ++V D ND  P F+      S ++  P    GT +  + A D D   N EL YS          F ++PESG+I     I        + + V   D  IP
Sbjct:  720 DREEQAFYQLRVVANSGG---VAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIFP----DGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKP--LFNSSSYVFH--FCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVNFELDSE--------TGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHATFAIDRS----------------TGSVF--------LARR--LDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIP---IGTRVITVTARDPDADVNGELHYSIARQFPPGAHFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIP 1267          

HSP 4 Score: 201.83 bits (512), Expect = 1.043e-52
Identity = 169/590 (28.64%), Postives = 261/590 (44.24%), Query Frame = 3
Query:  882 SFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAP-GK----LVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNI-PLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAK-IFSINKLDGKVFLETDLDRESVESLHFTTRAADSGY--PKQLSTA-NITVIVKDINDNFPFLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESIN 2621
            SFN   +V ++V D NDN PVF      + V EN      +  L A DAD   N  + Y +  L+  E A  F +++ SG +     LD E   +  L V A+D  +    +   + + +RD NDNSP      SR   +  + E+ AP GK    ++      D DS   G+VT  L P  + +++     + P+T    ++  +  DRE ++         D G      +  + V V D ND AP     S    V ED  PGT L  I+ATD DEG+NA L +SI   D +  F++   DG++ +   LDRE     +   R +D     P +LS+A  +++I+ D+NDN P           E+      +  V   D D G NS  +  L ++                L   VT                ++RE  LDRE    Y + + A D+G PP ++   + + V D ND  P+F       +  + +P    GT + ++ A D DEG N EL Y   S + T D F ++P  G +++ + + +  +   Y L V  +D G P   DTA +R+ +  +N
Sbjct: 1498 SFN---QVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSV--LSGSEGA--FVVDAASGVLRASRRLDREERASYLLTVRASDGTH---ATDARLSVAVRDANDNSPRF----SRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVT--RPLDRESRACYVLRARATDGGG--LAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVGN-DGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFAL-NTVTGEVR------------LVRE--LDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEP---PGTEVLRLSAWDPDEGANGELRYDIASGDPTGD-FRLDPVLGTLAVARPL-DRERTASYELAVRARDGGGPARSDTASVRVTLSDVN 2048          

HSP 5 Score: 196.052 bits (497), Expect = 8.142e-51
Identity = 184/691 (26.63%), Postives = 306/691 (44.28%), Query Frame = 3
Query:  564 IEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQ-----LKAIDADSEMNGKIEYQISSLTKPEYA-KLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMN----IPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGN---PRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIF----------GKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIY-LYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTT-IAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKD 2561
            I V+D+NDN P ++  E+  +  E +  G+      A D D G N +  YS+   ++  E +++++  + +     +L        DRE+   Y   V A DG + +     ++ VAV D NDNSP F +  Y   V E+   +    +     + A DADS   G++ Y ++     ++A   F +   +G ++V   LD E+     L   A D G L   +T  + +N+ D NDN+P +  +    +  A++ E+  PG  +   S  D D   N ++          EFS+   +      +    ++S  ++ DRE++S     +   D       R +++  VS+ + D+ND AP F+         ED   G  + T+ A D D G N+ + Y++           G     F++N + G+V L  +LDRE+ +S   T  A D G P   STA + V V D NDN P  P+  Y   + E+      +++++  D DEG N E +  + S                    D T  F   L  +L  G L +    LDRE T  YE+ + A D G P +S    + + + DVNDC P F     S  TV  +  T      I Q++A D+D G + ++ Y+    N     F ++P+ G + L +++    +   +VLI+   D
Sbjct: 1504 ISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSV---LSGSEGAFVVDAASGVLRASRRL--------DREERASYLLTVRASDGTHAT---DARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGGL--AATARLYVNVLDANDNAPSVQND----SLAAEVPEDAPPGTSLLRISATDDDEGVNAEL----------EFSISSGDPEGRFAVGNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSAL-APEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASG-------------------DPTGDFR--LDPVL--GTLAVARP-LDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQL---SPYTVHARENTQGPPVLILQVVARDDDLGSSGQVTYAAAGGNDGG-AFSVSPD-GHVHLLRSLDREAQ-PQHVLIITATD 2133          

HSP 6 Score: 184.882 bits (468), Expect = 1.881e-47
Identity = 201/739 (27.20%), Postives = 316/739 (42.76%), Query Frame = 3
Query:  399 FEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISP-EITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHL-EPIANEEFSLERMNIP---LTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESV------ESLHFTTRAADSGYPKQLS-TANITVIVKDINDNFPFLPKSIY-LYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQ-ESHKVCCYVLIVVVKDNGIP 2573
            F ++ L G +T  + +DR+ L         +      L  T K          + + V D+NDN P +   +      E    G + +   A D D G NG   Y ++  +   F+++ +    +   S            LDRE+   Y+  V A DGG+        V + V D  D  P F +  Y   V EN+   T V  + A   D  +N  + Y I S    +    FSIE + G I     +D E      L V AN  G        +V + + D+N+++P   F+  R +    I E+E            DKDS +NG+V   + E    E+F +     P   L V Y++      DRE + + +  +   D G    ++S +V+V V D+ND  P F+  SY+FH  E+ + G+ +  + ATD D G N  ++YS F K    F ++   G++      DRE++       S  F+  A D G PK L   A + V V+D+NDN P   KS+Y   V E+ +    L++V  +D DEG+N   +           I   +E          T   S    +LL           LDRE T  Y +V+ ATD G  P +    + + VLD ND  P+F   + S  +V     T  G  +  + A DED G + ++ Y+  + N T+  F ++  +G + L + +  E+ ++  Y L V  +D G P
Sbjct:  497 FRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAK----------VTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVNAVTGAVSTRVS------------LDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLD--LNANVTYLIVS---GDQRGSFSIEWSGGRIFTANAIDREEQAFYQLRVVANSGG---VAGEASVSVLVHDVNNHAP--VFD--RASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGI----FPDGQLYVRYEL------DRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYS-FEKPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYA---------INEGNEG------GKFTVDASTGQITLL---------GSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRF---TESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGN-THATFAIDRSTGSVFLARRLDFETQRL--YRLNVSAEDGGRP 1160          

HSP 7 Score: 176.407 bits (446), Expect = 9.494e-45
Identity = 169/633 (26.70%), Postives = 272/633 (42.97%), Query Frame = 3
Query:  399 FEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIK-SDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTV-----ALDNDFGTNGISYYSISP-EITEF-ELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGN---LRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLE----------PIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKI-FSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATD 2231
            F ++  +GV+   RR+DR+     +              LT++ SD   +    L + V+D NDNSP +S++      +E +      +  V     A D D G  G   Y+++P E +++ + ++ ++  T   +        + + LDRE    Y     A DGG      + ++ V V D NDN+P  +       V E+    T ++++ A D D  +N ++E+ ISS   PE    F++  N G + V   LD E  +  +L+V  +D       R  S   V + + D+NDN+P   F   R   +A   E+   G +VA     D DS  N  V   L                 F+L       TV  ++  ++  DRE +      ++  D+G P  T++ +++V V D ND AP F  + Y   + ED  PGT +  ++A D DEG N  L Y I   D    F ++ + G + +   LDRE   S     RA D G P +  TA++ V + D+ND  P    S Y      +T   P++ + V   D+ L S  +VT  +                              FS+ PDG + +  S LDRE   ++ ++I ATD
Sbjct: 1563 FVVDAASGVLRASRRLDREERASYL--------------LTVRASDGTHATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALN--------VTRPLDRESRACYVLRARATDGGG--LAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISS-GDPE--GRFAV-GNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPA--FTSPR---SALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALN------TVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSPYTVHARENTQGPPVLILQVVARDDDLGSSGQVTYAAAGGN----------------------DGGAFSVSPDGHVHLLRS-LDREAQPQHVLIITATD 2133          

HSP 8 Score: 165.236 bits (417), Expect = 2.580e-41
Identity = 161/605 (26.61%), Postives = 273/605 (45.12%), Query Frame = 3
Query:  822 DREKIDKYEFIVNAFDGGNP-SFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNN---AKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEF-SLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESIN 2621
            DRE+I  Y   + A D G P + + +  ++V V D ND++P F  + Y  +++E   + + V  + A+DADS +N K+ Y I S     +   FS++ ++G +    ++D E  +++ L + A D G   + +  ++ + + D+ND       EP  FT     A   EN  PG  V   S  D D  ENG V  + +P    ++  + R++   ++  K++TLKS DRE+  +    +   D G+P   ++  V+V V D+ND  P F    Y   + E+   GT + T+ ATD D G N  + Y +   DA  F +N + G V     LDRE          A D G+ +  S A +T+ V D  D  P   +  Y +V+  + A   LV  +V+ +   LN+           T LI   D+                  FS+   G  I   + +DRE    Y++ + A   G   +++  ++   V DVN+  P F   S   S  + +P     +    + A D+D GKN E++Y     N   + F + P+ G++ ++  +    +   Y L V   D G+  L  +  + + +  +N
Sbjct:  299 DRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLGW---FSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVND-------EPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLD---SLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVG-SVSASTLDLNANV---------TYLIVSGDQ---------------RGSFSIEWSGGRIFTANAIDREEQAFYQLRVVANSGGVAGEASVSVL---VHDVNNHAPVFDRASYEVSIAEDEP---VNSRFFSVRATDKDSGKNGEVKYEIGEGNG-GEKFGIFPD-GQLYVRYELDRETR-EEYSLTVSAMDTGVEPLSSSVTVNVTVLDVN 856          

HSP 9 Score: 157.918 bits (398), Expect = 4.075e-39
Identity = 201/784 (25.64%), Postives = 329/784 (41.96%), Query Frame = 3
Query:  372 FNCEKSSVYFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDD-----FSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISP--EITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIP---LTV---MYKISTLKSFDREQKSKV-TAHIVCFDEGNP---RQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKI-FSINKLDGKVFLETDLDRESVE---SLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLY-----VLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEY--PIQKLFR---DVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESINGDS 2630
            ++ EK  V FE++   G I   R  DR+ L         ++    +   ++ + D            + + V+D+NDN P ++++      SE +          A D D G NG   Y+I+   E  +F +       T++ S            LDRE+   Y  +V+A D G      S  V V V DENDN P F +++  +   E+ +    +I L A D D+  +G + Y I +         F+I+ ++G + +   LD+ET     L V A D G   R S   +++++RD NDN P   F P      A I EN   G  V   + +D D++ NG++           +S+ R   P    T+     +I T    DRE    +    +   D+  P   R++   +V+V V D ND AP F   + I         G+ + T+ A+D DE  NA + Y++ G DA I F +++  G +   T+LDRES     +L      A +  P+     N T+I   +  N P LP+    Y     +L+  T  +P   + +      L+ E +  LV  T    + R      P+   +R   D+T      +FS L      +R++G    +               PP S+   + I+V DVND  P F  P      ++V+  T  G  I  + A D D+G+N+ + YS  S ++    F+++  SG +   + +    +   Y+L V   D         ARL + +   N +S
Sbjct:  899 YSFEKPQVNFELDSETGRIASLRVFDREALI--------RQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGKFTVDASTGQITLLGS------------LDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNT---HATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPA--FLPGDVF--ASIMENIPIGTRVITVTARDPDADVNGEL----------HYSIARQFPPGAHFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTPTAILVDGLRAAAGSVVGTLQASDPDEAENAAVRYAVTGGDAAILFRLDRRTGIIETSTELDRESGHGAFTLEVVAVEAKAAAPRTQRAEN-TIIANSMTFNHP-LPRFPQDYESPINLLQGQTIPMPSSYLFLR---HHLDWEPEGQLVFFTLLLGVTRGHGVINPLDAPWRVSFDLTARCMFIVFSSLLSS---LRDNGAGSFI--------------RPPMSSFNQVEISVEDVNDNPPVFAVP---EMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSE--GAFVVDAASGVLRASRRLDREER-ASYLLTVRASDG---THATDARLSVAVRDANDNS 1614          

HSP 10 Score: 124.405 bits (311), Expect = 7.949e-29
Identity = 101/367 (27.52%), Postives = 160/367 (43.60%), Query Frame = 3
Query: 1545 PRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLY-VLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKS----FSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNG---IPRLEDTARLRIIIESIN 2621
            P  ++   V + VED+ND  P F+       V E+   G  +FT++ATD D+G NAL++YS+       F ++   G +     LDRE   S   T RA+D       + A ++V V+D NDN P   +  Y + V E+   D                  T+  +     T L    D  P  ++   +  S    +++  F L P    +     LDRE    Y +   ATD G    + +  +Y+NVLD ND  P        +   +V      GT++ +I A D+DEG N+ELE+S  S +      + N   G++S+ + +    +   Y L+V V D       RL    R+ +I+  +N
Sbjct: 1494 PPMSSFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSEGAFVVDAASGVLRASRRLDREERASYLLTVRASDG---THATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPD---------------GKTTRAVI----GTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGGLAATAR--LYVNVLDANDNAPSV---QNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVGN--DGQLSVARALDRERQ-SFYNLVVRVSDRARHPPARLSSAVRVSLILTDVN 1830          

HSP 11 Score: 92.0485 bits (227), Expect = 6.545e-19
Identity = 87/367 (23.71%), Postives = 135/367 (36.78%), Query Frame = 3
Query: 1569 VSVGVEDINDEAPHFSEKSYI-FHVNEDVKPGTYLFTINATDKDEGINAL--LSYSIFG--KDAKIFSINKLDGKVFLE----TDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSL-FSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKP--KFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDE-GKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQE--SHKVCCYVLIVVVKDNGIPRLED-TARLRIIIESIN 2621
            V V V D+ND AP F E   +     ED   G  +    A D+D G N +   +Y I    ++ ++     +  + FL       LDRE+  S     +A D G P++     + V V+D NDN P   K  Y   +                                         ++ P+    RD+       L     P   ++     LD E   +Y + + A D GNPP S +    I +LDVND  P  +F++   +  +  V      GT  A +   D D    N EL  S    N+     L  P    + + +   +    ++  Y L ++  DNG P     TA L + +  +N
Sbjct:    9 VRVVVGDVNDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAVDRDVGPNGVNHHAYKIVSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASV----------------------------------------AEDSPVGAALRDLLHRGRGPLAVPFDPKTGMVSTRQPLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVN 335          
BLAST of Protocadherin-1 vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 263.462 bits (672), Expect = 6.793e-72
Identity = 215/694 (30.98%), Postives = 325/694 (46.83%), Query Frame = 3
Query:  558 LVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVT-CHLEPIANEEFSLE-RMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESINGDS 2630
            + I ++DINDNSP + Q   V + SE S  G       A D D  +NG   Y++S     F     INT+T + + K QL        D EK  +Y   V A DGG PS +    V V V D NDN P F K++Y  +V ENL +   V  + A DADS  NGKI Y I S  +      F+++  +G I  R  LD ET  + SL + A+D   +R  +  TV I+I D NDN P  +  PSRF     I+E+   G  V   +  D+D   NG VT   +       F L+ R  I       +S   + DRE     T  +   D G+P+Q+ + S+ V V D+ND AP F +  +   + ED    + +  +   DKDEG N  ++ S+ G+ +  F+I+   G V  +T LD E+  +   T  A D G P + +TA + + + ++NDN P F+  +    + E+   +  +V++N TD+D                              L  D+ +  + S F +     LI     LDRE T  Y +V+ AT+ G+  +S      I VLDVND  P F   S + S  +  P    G T+A++ A D DEG+N+++ Y     + +   F +NP +G ++ ++ +    +   Y L V   D+G P     A + + I  +N +S
Sbjct:  569 VTIALQDINDNSPIF-QGPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNTDVFS----INTSTGLITLKTQL--------DYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNE---NMAFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQP-TFTGPSRF----NISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNSFQLDPRSGI-------LSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGSDNFTIDST-GFVLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSDG---------------------------TPLTFDIVEGNAGSSFKIDQSSGLISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPI---GQTVAKVTATDRDEGENAKVTYELSVGDTSK--FEVNPATGLVTTKRPLDREDQ-ASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNS 1200          

HSP 2 Score: 241.891 bits (616), Expect = 5.100e-65
Identity = 213/760 (28.03%), Postives = 349/760 (45.92%), Query Frame = 3
Query:  357 YKFQFFNCEKSSVYFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKS-FDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIF-GKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKF---IFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESIN 2621
            Y F   N   +   F ++ + GV+T+ R +D +           + +    L +T +     +    L+I V DINDN P +S +   ++  E +  G   S T   D D  TNG   + I       +  + I+ +T + S        + K  D E   +Y+  V A D G P    + +V + + D ND+SPVF  + Y   + E+    + V+ + A D DS   G++EY+   L        F+I++NSG I V  ELD ET  + SL VEA D G+  R S+  V I ++D+NDNSP I+  P  F    +++E+ +PG  +   +  D D + NG V   L     + FS+            + TLK+  D E+K++    +   D G P +++   V V V+D+ND  P F++  Y   V E++  G  +  + ATD D G N  +SYSI  G +   F++++  G++     LDRE++ S   T  A D    + ++   + + + D NDN P         + E+      + Q+  TD D G N      ++S                        +  NS F L P   ++   S LDRE    Y +V++A+D G+P +S    I+++VLDVND  P+F   +F SG     +++      +T+ Q+   D+DEG N  +  S   + + +D F +  +S    L +T  +      Y L V  +D G P    TA+++I I ++N
Sbjct:  308 YSFTSGNTNHA---FTLDAVTGVVTVSRSLDFEQ----------RSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGTQVSAT---DRDSSTNGALVFGIIKG--NDDGVFTIDGSTGIIS--------IAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYR---LISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSP-IFQGPYVF----RVSESSSPGHQIGQVAATDADDSSNGDVRYALSD-NTDVFSIN-------TSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPSRFNISEDSPTGTRVGQLTATDRDIGPNGAVTYAIIS-----------------------GNQGNS-FQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLF-SG-----EIREDASVHSTVLQVKVEDKDEGSNGAITLSL--SGEGSDNFTI--DSTGFVLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVN 991          

HSP 3 Score: 232.261 bits (591), Expect = 5.063e-62
Identity = 190/687 (27.66%), Postives = 315/687 (45.85%), Query Frame = 3
Query:  555 VLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSY-IINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAK-IFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIII 2609
            V +I V D+NDN+PF++ +   T   E   +G       A+D D G N               LSY +++ +T  ++   Q  +  K   DRE    Y+  + A DGG+PS +G   V + + D NDN PVF  A Y  SV+E++     ++ + A D D+  N  + Y   S T       F++++ +G + V   LD+E  ++ +L +   D G+     T  ++IN+ D+NDN P   F PS +   +++ EN   G  V   S  D+DS+ NG +   +  I   +  +  ++    +   IS  KS D E K++    +   D G P +  +  V++ +ED+ND +P FS  +Y   + E    G+ + T+ ATD D G    L Y +   + K  F+I+   G + + ++LDRE+  S      A D G   + S+  +T+ ++DINDN P         V E+ +    + QV  TDAD+  N + +  L   T                           +FS+     LI  ++ LD E  T+Y + + A D G P +S+  ++ + V DVND  P+F   + S  T  V     +G  +  + A D D G N ++ YS  S N+ N  F M+  +G+I+ +  + +   +  Y L +   D  + R      + I I
Sbjct:  153 VPLITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINA-------------RLSYSLVSGDTSYFTVDSQGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRY---SFTSGNTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPP--VFSPSAY--QSRVKENTPAGTQV---SATDRDSSTNGALVFGI--IKGNDDGVFTIDGSTGI---ISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNT--------------------------DVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQF---AKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNE-NMAFAMDRFTGEITTRVPL-DRETIASYSLTINADDGSLVRFMAATTVNISI 780          

HSP 4 Score: 226.868 bits (577), Expect = 2.673e-60
Identity = 206/746 (27.61%), Postives = 330/746 (44.24%), Query Frame = 3
Query:  399 FEINPLNGVITIE-RRIDRDNLCHLVPTCCPK-KNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPI-ANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIF-GKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESIN 2621
            F I+   G IT   R+ DR++      T   +   N+C+   T           V+VI+VKD NDN+P +  N  V    E +      ++  A D D GTN    YS+     +F          MM  N +  ++     LD E  D Y   ++AFDG + +F      ++ V D NDN+P F  +VY   V E++   + V QL A+D D  +N ++ Y + S         F+++S  G I  +   D ET  +  + + A D G+  R    TV I I D+NDN P   F  +++T  A + E+ A G  +   +  DKD+  N  +         N  F+L+ +   +TV       +S D EQ+S     +   D G+P  T +  + + V DIND  P FS  +Y   V E+   GT    ++ATD+D   N  L + I  G D  +F+I+   G + +    D E+      T +A D G P +  TA +T+ ++D+ND+ P F P +    + E+      +V V  TD D G     +  L+S                              F++  +   I   S LDRE T  Y + +EA D G+  +S+   + I + D+ND  P F  P       +V   +  G  I Q+ A D D+  N ++ Y+   N    D+F +N  +G I+L+  + +  K   Y++ V  KD G P       ++++++ +N
Sbjct:   12 FTIDSSTGSITTTGRKFDRESESRYRLTVLAQDAANRCHKGRT-----------VVVIDVKDENDNAPEFPLNSYVFNIRENTPAA-QVAIVTATDRDSGTNAAITYSLFSGENKF----------MM--NSKTGEIRTVTPLDHETKDSYTMRISAFDGKHTTF----VPLITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVS----GDTSYFTVDSQ-GVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRP--VFSSAQYT--ASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLDAVTGVVTVS------RSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGTQ---VSATDRDSSTNGALVFGIIKGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNV------------------------KGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGP----YVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDN---TDVFSINTSTGLITLKTQL-DYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVN 679          

HSP 5 Score: 216.083 bits (549), Expect = 7.416e-57
Identity = 212/807 (26.27%), Postives = 362/807 (44.86%), Query Frame = 3
Query:  225 NHKHFTIDIYEELPRKTKVIDLGAQATKWFPTDVNKLQDFGKPIYKFQFFNCEKSSVYFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDF----SHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIF-GKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESINGD 2627
            N   +   ++E LP       +G    K   TD ++ ++  K  Y+    +  K    FE+NP  G++T +R +DR++              Q +  L + + D      S +  + + + D+NDNSP +SQ++     +E +  G +    +A D D G NG   YSI             N       +    ++ +   +DRE +  Y   ++A D G P +  +  V + V DENDNSP+F        ++E +   + V  + A D D   N ++ Y   S+ + + +  F+I + +G + V+ E++ ET  T +L + A+D G+    S   + + + D+NDN P   F    +  + +  EN A  +  +V +V   DS+           I+  +    ++N    V   I T    D E+KS+    +   D    + T   +V++ V ++ND  P F++++Y   V E+    T +  ++A+D+D      LSYSI  GKD+  FSI++  G +     LDRE V       R  D+G P   +   +T+ + D NDN P F   S    +LEN        ++  TDADEG N+  ++T               Y + +          N  F +     +I     LDRE  + Y++ I+A D G PP+++   I + V+D+ND +P     S   S  + +P+    T + +I+A D D G N+EL +S  SN   + +F ++  +G IS +  +    +   Y L + V D G P L   A   +II+ I+ D
Sbjct: 1100 NPGSYAKSLHENLP-------IGQTVAKVTATDRDEGEN-AKVTYELSVGDTSK----FEVNPATGLVTTKRPLDRED--------------QASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISG----------NHGNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFY---SIVRGDTSA-FAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPP--VFNSQSYIGSVR--ENSA--QSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKINSTSGV---IMTTTPLDFEEKSQYGLEVTATDS---KYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDS--FGSLSYSIVGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNA--RIT---------------YNLSR----------NDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKE---THVMRILASDADTGLNAELTFSLLSNEHKS-VFTLDNTTGDISTKVPLDREQQ-AVYTLRIGVADKGNPSLSSVA--DVIIDVIDED 1818          

HSP 6 Score: 208.764 bits (530), Expect = 1.192e-54
Identity = 207/677 (30.58%), Postives = 305/677 (45.05%), Query Frame = 3
Query:  399 FEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDD----FSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINT-NTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIAN-EEFSL-ERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFL-PKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVK-PRTVSGTTIAQIIAIDED 2402
            F I+   G IT+   +DR+ L               + +LTI + D     +     + I V D NDNSP ++ NE      EG  IG   ++  A D D G+N   +YSI    T    ++ IN  N ++   KE         ++RE +  Y   + A D G+P      ++ V V D NDN PVF    YI SV EN   +T V+ + A D+D   N  + Y I S       K F I S SG I     LD+E  +   L V A D    +  +   V I + +LND +P   F    +T  A + EN      V   S  D+DS   G ++  +    + ++FS+ +R  I       IST    DRE  S     +   D GNP  +    V++ + D ND +P F   SY   + E+  P ++ F + ATD DEG NA ++Y++   DA  F I    G + L   LDRE+  +     +A D G P Q S+  I V V DIND+ P +   S+   V EN   +  ++++  +DAD GLN+E   +L+S          +E+               S+F+L      I  +  LDRE    Y + I   D+GNP  S+   + I+V+D +D  P+F  P+  N T+    PR   G +I Q+ A D D
Sbjct: 1251 FRIDSTTGRITVVGVVDREALA--------------SYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTS---AFAINAMNGVLTVKKE---------INRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGND---EKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDS---KYTAKTNVTIRVINLNDITPA--FTQQNYT--ASVRENSPTSTSVVKVSASDRDSF--GSLSYSIVGGKDSDKFSIDQRSGI-------ISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRNDA--FMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLLS----------NEH--------------KSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRF-QPTEYNVTISESLPR---GASIVQVTARDID 1852          

HSP 7 Score: 204.527 bits (519), Expect = 2.458e-53
Identity = 172/597 (28.81%), Postives = 279/597 (46.73%), Query Frame = 3
Query:  822 DREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYL-YVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIII 2609
            DRE    Y  +V A + G+   +      + V D NDN+PVF    Y  S++ENL     V ++ A D D   N K+ Y++S     +    F +   +G +  +  LD E   + SL V A D G   + +   + + I DLNDNSP+  F  S++T    +TEN A G  +      D D+  NG+VT  +  I+    +  R++   +   +I+ +   DRE  +     I   D G P   ++  V++ V D ND +P F+     + ++E V  G+ +  + ATD+DEG NA + YSI   D   F+IN ++G + ++ +++RE+V +   T RA+D G P   S   +TV+V D+NDN P      Y+  V EN      ++ V   D+D G N+  + +++S          DE    K F+    S S  + +  P          LD E  ++Y + + ATD     K+    + I V+++ND  P F   +  N T  V+  + + T++ ++ A D D      L YS     + +D F ++  SG IS    + +   V  Y + V V D G P L +   + I I
Sbjct: 1058 DRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSK----FEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQ--FSQSKYT--LTVTENTANGSNILRVLASDPDAGANGRVTYSI--ISGNHGNAFRID---STTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISG--------NDE----KRFK--INSTSGVIMTTTP----------LDFEEKSQYGLEVTATDSKYTAKTN---VTIRVINLNDITPAF---TQQNYTASVRENSPTSTSVVKVSASDRD--SFGSLSYSIV-GGKDSDKFSIDQRSGIISTADVL-DRELVSLYAIQVRVTDAGNPPLSNLTWVTIKI 1607          

HSP 8 Score: 193.356 bits (490), Expect = 7.853e-50
Identity = 176/608 (28.95%), Postives = 266/608 (43.75%), Query Frame = 3
Query:  822 DREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLK---AIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIF-GKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESINGDS 2630
            DRE   +Y   V A D  N    G   V++ V DENDN+P F    Y+     N++ NTP  Q+    A D DS  N  I Y + S         F + S +G I     LD+ET  + ++ + A D     + +T   +I + D+NDN+P  +F  S +     + E+ A G +V   +  D D   N +++  L       F+++   +       I T  +FDRE K+     +   D G+P ++   +V + + D+ND  P FS   Y   V+EDV  G  + T+ A+DKD G NA L YS   G     F+++ + G V +   LD E   S        D G P    T+++ + V DINDN P F P +    V EN  A     QV+ TD D   N                          L   + K   + +F++     +I      D E  T+Y++ ++A DRG P K     + I + DVND  P F   S SN + ++   TV G+T+  + A D D G    LEY   S N     F ++  SG I +   + +      Y L V  +D G      + R+ I ++ IN +S
Sbjct:   29 DRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVF----NIRENTPAAQVAIVTATDRDSGTNAAITYSLFS-----GENKFMMNSKTGEIRTVTPLDHETKDSYTMRISAFDG----KHTTFVPLITVDDVNDNAP--FFALSVY--KTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTSYFTVDSQGV-------IRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAG---TQVSATDRDSSTNG------------------------ALVFGIIKGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVF---SPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGN-VKGAFNIDANSGSIRVSSEL-DRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNS 580          

HSP 9 Score: 179.874 bits (455), Expect = 1.350e-45
Identity = 156/524 (29.77%), Postives = 237/524 (45.23%), Query Frame = 3
Query: 1095 LFSIESNSGYIHVRW-ELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLYVLENHTA-DVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESINGDS-ILSKENKMK 2657
            +F+I+S++G I     + D E+ +   L V A D  N        V+I+++D NDN+PE       F     I EN  P   VA+ +  D+DS  N  +T  L       FS E   +  +   +I T+   D E K   T  I  FD    + TT   + + V+D+ND AP F+   Y   V EDV  G+ +  + A D D GINA LSYS+   D   F+++   G +  +   DRE+  S     RA D G P +   A + + + D+NDN P    + Y   ++   A    +V V  +D D G N++ + +                         T   +N  F+L     ++     LD E  + Y + +  TDRG+PP +    + INV D+ND  P F  PS   S  +VK  T +GT   Q+ A D D   N  L +     N  + +F ++  +G IS+ ++    +K   Y L V  +D G+P   DTA++ I IE +N  S + S  N  K
Sbjct:   11 MFTIDSSTGSITTTGRKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVF----NIREN-TPAAQVAIVTATDRDSGTNAAITYSL-------FSGENKFMMNSKTGEIRTVTPLDHETKDSYTMRISAFDG---KHTTFVPL-ITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTSYFTVDS-QGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSF------------------------TSGNTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVF-SPSAYQS--RVKENTPAGT---QVSATDRDSSTNGALVFGIIKGND-DGVFTIDGSTGIISIAKSPDYENK-TRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSK 485          
BLAST of Protocadherin-1 vs. Ensembl Nematostella
Match: EDO35412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK9])

HSP 1 Score: 244.202 bits (622), Expect = 7.744e-66
Identity = 216/751 (28.76%), Postives = 336/751 (44.74%), Query Frame = 3
Query:  381 EKSSVYFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISP--EITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPE--IYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEE-FSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGK-DAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLYVL-ENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKV-CCYVLIVVVKDNGIPRLEDTARLRIII 2609
            E S   F  N   GVI+   RIDR+    +               L +++ +  +  I + ++V DINDN P +       +  E  ++  +  +  A D D G NG   Y+I+       F L       T        L ++ KK LDRE  D Y+  + A D G P+  G   + + + DEND++PVF +  Y+ S+ EN +    ++++ A D DS  NG I+Y I      +   +F ++S++G I  +  LD+E   + +  V A+D G   +    TV IN+ D NDNSP+  I + P    + A  +EN      +A   V DKDSN N +    +    +E  F +E +       Y I   K  DRE        +   D+G P ++T G V + V D+ND +P F+  +Y  +++E  + G+Y+  +NATD DEG N  +SYSI G  D   F ++   G V     LDRE V S+  T  A D G   +  +  +TV + D NDN P   KS Y   + E  +    ++QV+ TD D G N      + S  A                        N LF L     ++  +S LDRE  + Y   + A D G+P   +   + + + D+ND  P F       S ++ +P       + Q+ A D DEG N+ + Y     N  N  F ++  +G IS   ++   H+V   + LI+  KD G      TA + + +
Sbjct:   36 EGSPKQFGFNSNTGVISTTARIDRETTTQI--------------SLQLRTLNPSNQPISVQVQVDDINDNEPRFPTLYYTLRIRESMDVNTTNPINTATDPDAGNNGTVDYTIASGDNTATFSLG------TTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAI-DWDAIQSNSIFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCFKVEFLG-----FYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQV----------------------NGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMENEPP----GKLLQVTATDADEGTNAVISYDIIGGNN-NGNFSIDSSTGVISTLASLD--HEVEEFFSLIISAKDGGNKYAAKTAVVNVTV 731          

HSP 2 Score: 213.772 bits (543), Expect = 2.879e-56
Identity = 200/713 (28.05%), Postives = 324/713 (45.44%), Query Frame = 3
Query:  501 QCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVN-------ENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGY-IHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKI---FSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRI 2603
            Q N+  T +         ++ I + D ND++P ++QN  +   +E ++ G S     A D D G+NG   Y+I  +  +    + ++++T +   K+ L        D E  + Y F V A DGG PS N    V + V D NDNSP   K  Y+   N       EN   NT +  +   D DS  N + E +I   T  +    F +E    Y I ++  LD E     +L +   D G   R +   V+I++ D+NDNSP   F  + +T  A I+E    G  V   +  D D  +NG V+  +      +    +++    +   ++T K  DREQ S VT  I   D G+  +T S +V+V + D ND  P F + SY   ++E    G  +  ++ATD D G N  ++Y I   DA++   F +N   G ++ ++ LDRE+     FT  A D G P+ +S+  + + + DINDN P F P   +  ++EN      L+QV  TDADEG N+                         +  D+    +N  FS+     +I   + LD EV   + ++I A D GN   +   ++ + VL+  D  P F++   + +  +  P+   GT + ++ A  +D  KN  + Y+  S + TN LFL++   G I +   +    K   Y+L V+ +   +  L   A + I
Sbjct:  173 QLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSIFDLDSSTGVIRTKQNL--------DFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQL-KITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKI---TNGDDEGCFKVEFLGFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPA--FTSNAYT--ANISELAQNGSYVLQLNATDPDEGDNGTVSYSIT--GGNDLGWFQVDFQSGL---VTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMENEPPG-KLLQVTATDADEGTNA------------------------VISYDIIGGNNNGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPK---GTLVGRVYATTKD--KNGSISYAIVSGDPTN-LFLVDSTGGIIKINGDMDREEK-AQYLLAVIARVGTVKPLSAQATVNI 832          

HSP 3 Score: 209.149 bits (531), Expect = 9.733e-55
Identity = 214/740 (28.92%), Postives = 337/740 (45.54%), Query Frame = 3
Query:  426 ITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISP--EITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIA---NEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKD-AKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLST-ANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESIN 2621
            I +++ +DR+    LVP           L++T K     S +  ++I+V D+NDNSP ++ N      SE ++ G       A D D G NG   YSI+   ++  F++ +            +   +   K LDRE++      + A D G+    GS  V V + D NDN P F K+ Y  +++E       V+Q+ A D DS  NG+I Y+ISS +  +   LF + + +G +  + +LD ET +  S  V A D G+ +  S+  V + I D+NDN+P  Y  P  +   A I ENE PGKL+ V +  D D   N  ++  +  I    N  FS++      +    ISTL S D E +   +  I   D GN     +  V+V V +  D  P F  + Y F V E+V  GT +  + AT KD+  N  +SY+I   D   +F ++   G + +  D+DRE  ++ +     A  G  K LS  A + + V D NDN P F   S+ + +         +      D D G N   +  L S  A  L+       + KL R +T            DG              T+Y + + A+D G+PP+ +   I+I  L +N   PKF   S     +  +P +        ++A+D+D GKN +L YS    N+   LF + P  GK+ +++++ ++ K   Y LIV   D G+P    +  + I I+  N
Sbjct:  377 IQLQKPLDRE----LVPFY------NLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVDF------------QSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISS-SDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFY--PVEYF--ASIMENEPPGKLLQV-TATDADEGTNAVISYDI--IGGNNNGNFSID------SSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTKDK--NGSISYAIVSGDPTNLFLVDSTGGIIKINGDMDREE-KAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSN-AEGLLWINSTSGVIKLARKLT------------DGD------------ETQYTVQVLASDSGSPPQHSTMTIHI-TLSINH-PPKFTLSSYVTHVLASQPLSYQ---FFYVVAVDQDSGKNGQLFYSIPQGNE-EGLFGIFP-GGKLYIRKSLLQALK-GSYDLIVRATDGGVPSFSASVPVTIYIQDSN 1044          

HSP 4 Score: 193.356 bits (490), Expect = 6.770e-50
Identity = 187/648 (28.86%), Postives = 287/648 (44.29%), Query Frame = 3
Query:  669 VALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYE-----TYTTISLIVEANDMGN---LRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHL-EPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIF-GKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLP-KSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTT--IAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIP 2573
            VA+D D G NG  +YSI P+  E  L + I     +Y  K  L+ +            Y+ IV A DGG PSF+ S+ V + + D ND+  +F    +  +V EN    T V  L A   D      I Y   SL   E    F+++  SG I  R  LD E     T + +  I++A  M N   ++R     VI+ + DLNDN+P      SR      ++E   PG  V      D D  +N K    L      ++F +      L +       K+ DRE  S     +   D  N    ++  + + V D ND+ P F E  Y  ++ ED   G+ +  +NA+DKD G N L+ YSI  G  A +F +    G++ +   LD E+ +    T  A D G     ST N+TV V D+NDN P  P + + L V EN     P+ +   +D D G N+    ++ S+T +        + +     ++T   +  L   +P G    R+S         +++V+ ATD+G+P  ST+  I + V D ND  P F+ P          P   +G++  +  I A D D   N ++ YS  S N  N  F ++P +G++ +   I ++  +  Y L +   D G P
Sbjct:  969 VAVDQDSGKNGQLFYSI-PQGNEEGL-FGIFPGGKLYIRKSLLQALK---------GSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVY---SLISSE--SHFAVDVRSGQITTRVRLDREELIKNTGSNV-YIMQAEAMYNDTTIKR-DKAIVIVTVTDLNDNAPVF----SRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFINSSTGELHLS------KTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPS------KTFSVNSATCEITTIAAIDL-ETMPAG----RDS---------FQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSP----------PAAAAGSSLNVMTITAEDPDRNSNGKVTYSIISGN--NGYFNLHPSTGQLQMIHQIPDNPTI--YQLTIQASDGGQP 1554          

HSP 5 Score: 186.422 bits (472), Expect = 1.201e-47
Identity = 188/707 (26.59%), Postives = 299/707 (42.29%), Query Frame = 3
Query:  396 YFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFI-----FPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQ 2501
            +F+++  +G++T  + +DR+ +  +  T   + +               +    + + + D NDN P + ++      SEG+ IG +     A D D G NG   Y IS    +    + +NT T +   K QL        DRE    Y F V A D G+P    S+KV + ++D NDN+PVF    Y  S+ EN +    ++Q+ A DAD   N  I Y I           FSI+S++G I     LD+E     SLI+ A D GN     T  V + + +  DN P   +E   FT    + EN   G LV       KD  +NG ++  +  ++ +  +L  ++    ++ KI+     DRE+K++    ++         +   +V++ V D ND AP FS  S I  ++     G  ++   A D D G N L+ Y +      +  IN   G + L   L             A+DSG P Q ST  I + +  IN    F   S   +VL +         V   D D G N +                        LF  + +     LF + P GKL IR+S L + +   Y++++ ATD G P  S    + I + D ND +  F+     F    NS+    P T+ GT +A  +    D  +  ++ YS  S+      F ++  SG+I+ +
Sbjct:  472 WFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSA----------PKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQL--------DRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMEN-EPPGKLLQVTATDADEGTNAVISYDI---IGGNNNGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFT----VYENVPKGTLVGRVYATTKD--KNGSISYAI--VSGDPTNLFLVDSTGGII-KIN--GDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNAEGLLWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQHSTMTIHITLS-INHPPKFTLSSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQ------------------------LFYSIPQGNEEGLFGIFPGGKLYIRKS-LLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSS----PGTLVGTLVAHAL----DHSRTKDIVYSLISSESH---FAVDVRSGQITTR 1108          

HSP 6 Score: 167.933 bits (424), Expect = 6.202e-42
Identity = 203/747 (27.18%), Postives = 316/747 (42.30%), Query Frame = 3
Query:  399 FEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNA---KITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANE-EFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCF--DEGNPRQTT----SGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIF-GKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIY-LYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPD-----GKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQ-ESHKVC--CYVLIVVVKDNGIPRL 2579
            F ++   G+I I   +DR+     +     +         T+K     S    + IEV D NDN+P +S + ++        +G       A+D D G NG+  Y ++            N   +++ N     + L +KL      +Y   V A D G+P  + ++ +   +T   ++ P F  + Y+  V  +   +     + A+D DS  NG++ Y I    +     +F      G +++R  L      +  LIV A D G     ++  V I I+D ND+        S F NN     + EN +PG LV        D +    +   L  I++E  F+++  +       +I+T    DRE+  K T   V     E     TT       V V V D+ND AP FS   Y   V+E   PG+ +F I A D DEG NA   YS+  G     F IN   G++ L   LDRE+  S +   +A D+      STA I + V D ND  P  P+S Y + + E+      ++ +N +D D G N              LIK                S SN   + + D     G+LI+ +S LD E T  YE+ I A D G  P S+   + +NVLDVND  P  +FP+    T+ V+    +G  + +  A D D G N+ + +S  S   +   F +N  + +I+    I  E+       + L+V+  D G P+L
Sbjct:  787 FLVDSTGGIIKINGDMDREEKAQYLLAVIARVG-------TVKP---LSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTS-----------NAEGLLWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQHSTMTI--HITLSINHPPKFTLSSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQGNEEGLFGIFP----GGKLYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHR-------SLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSL--ISSESHFAVDVRS------GQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFINSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNG-------------LIKY---------------SISNGNLAAMFDVESATGRLIVAKS-LDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAP--LFPT-QPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSK-TFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKL 1458          

HSP 7 Score: 166.777 bits (421), Expect = 1.250e-41
Identity = 169/589 (28.69%), Postives = 265/589 (44.99%), Query Frame = 3
Query:  903 VIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTL-------KSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKD-AKIFSINKLDGKVFLETDLDRESV----ESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFL--PKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPD-GKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLE-DTARLRIIIESIN 2621
            VIV VTD NDN+PVF +AVY I+V+E     +PV ++KA+DAD   N K  Y + S T  +  K F I S++G +H+   LD ET ++ +L+V+A D  N    ST  + I + D ND  P   F  S +T N  ITE+   G LV   +  DKD  +NG +          ++S+   N  L  M+ + +        KS D E        I   D G    +++ +V+V V D+ND AP F  +     V E+V  G  +    A+D+D G NA +++S++ +  +K FS+N    ++     +D E++    +S      A D G PK  +  +ITV V D NDN P    P +          A   L  + +T  D   NS  KVT               Y I         S +N  F+L P  G+L +     D    T Y++ I+A+D G P + T+ ++ +         P F   S ++    V    V+GT++  ++A       N  +EY   S++     F +   +G +   + I        + L+V   D   P     +A + I ++ +N
Sbjct: 1145 VIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMD--KFF-INSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRP--VFPESDYTVN--ITEDALIGSLVINLNASDKDIGQNGLI----------KYSISNGN--LAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPPA--------AAAGSSLNVMTITAEDPDRNSNGKVT---------------YSI--------ISGNNGYFNLHPSTGQLQMIHQIPDNP--TIYQLTIQASDGGQPSRQTQTVVSVFKEGPIGGGPTF---SSADYQGSVTENKVAGTSVVTVLAAYPQSSLNGNIEYYLTSDSSKGG-FEVVKSTGVVKTTRGIDREGMGASFNLVVYAVDKQGPSARTSSATVTITVQDVN 1677          

HSP 8 Score: 157.918 bits (398), Expect = 6.712e-39
Identity = 167/661 (25.26%), Postives = 282/661 (42.66%), Query Frame = 3
Query:  372 FNCEKSSVYFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNL----------DLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHL-EPIANEEFSLERMNIPLTVMYKISTLKSFDREQ----KSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYL--FTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDL-DRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYL-YVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDRE-VTTKYEIVIEATDRGNP-PKSTKGIIYINVLDVN 2291
            ++   S  +F ++  +G IT   R+DR+ L          KN   N+          D TIK D       ++++ V D+NDN+P +S+       SE S  G       A+D D G N   +YS+    T  +  +I ++   ++ +K          LDRE    Y  +V A D  N +   + K+ + V D ND  PVF ++ Y +++ E+    + VI L A D D   NG I+Y IS       A +F +ES +G + V   LD+ET     L + A D G +   ST  V +N+ D+NDN+P    +P   T    + EN   G  V   +  D+D+  N  +   +     ++ FS+       +   +I+T+ + D E     +      ++  D+G+P+ +T  S++V V D ND +P F               G+ L   TI A D D   N  ++YSI   +   F+++   G++ +   + D  ++  L  T +A+D G P + +   ++V  +      P    + Y   V EN  A   +V V        LN   +  L S++                        S   F ++    ++    G+DRE +   + +V+ A D+  P  +++   + I V DVN
Sbjct: 1087 YSLISSESHFAVDVRSGQITTRVRLDREELI---------KNTGSNVYIMQAEAMYNDTTIKRDK-----AIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSG-TGMDKFFINSSTGELHLSK---------TLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSIS---NGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLT----VRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSVN------SATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPPA-------AAAGSSLNVMTITAEDPDRNSNGKVTYSIISGNNGYFNLHPSTGQLQMIHQIPDNPTIYQL--TIQASDGGQPSRQTQTVVSVFKEGPIGGGPTFSSADYQGSVTENKVAGTSVVTVLAAYPQSSLNGNIEYYLTSDS------------------------SKGGFEVVKSTGVVKTTRGIDREGMGASFNLVVYAVDKQGPSARTSSATVTITVQDVN 1677          

HSP 9 Score: 95.1301 bits (235), Expect = 1.276e-19
Identity = 97/344 (28.20%), Postives = 142/344 (41.28%), Query Frame = 3
Query: 1614 SEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAAD-SGYPKQLSTANITVIVKDINDNFPFLPKSIY-LYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGK--LIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNN-QTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESINGDS 2630
            +  SY FHV E+  PGTY+  ++     EG              K F  N   G +     +DRE+   +    R  + S  P      ++ V V DINDN P  P   Y L + E+   +        TD D G N     T+ S                    D T +FS    +  P G    +I +  LDRE T  Y++ I ATDRG P      +I I +LD ND  P F   S   S   +   T  G +I ++ A D D G N +++Y+   +  Q+N +F ++  +G I  +Q +    K   Y   V+  D G+P   D A + I +   N +S
Sbjct:    8 AGSSYTFHVQEEQPPGTYVGKVDGASAFEG------------SPKQFGFNSNTGVISTTARIDRETTTQISLQLRTLNPSNQP-----ISVQVQVDDINDNEPRFPTLYYTLRIRESMDVNTTNPINTATDPDAGNNGTVDYTIAS-------------------GDNTATFSLGT-TACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGS---IAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSIFDLDSSTGVIRTKQNLDFEVK-NSYTFNVIASDGGVPSKNDLATVTINVLDTNDNS 310          
BLAST of Protocadherin-1 vs. Ensembl Nematostella
Match: EDO48237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKF4])

HSP 1 Score: 241.891 bits (616), Expect = 6.652e-65
Identity = 223/763 (29.23%), Postives = 341/763 (44.69%), Query Frame = 3
Query:  387 SSVYFEINPLNGVITIERRIDRDNL-CHLVPTCCPKKNNQCNLDLTIKSDD----DFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSI---SPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTV---MYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDA--KIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISL-----QQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESI 2618
            S+ YF I+ + GVIT +R +DR+ L  H                  +K++D         + L I V D+NDN P + +N       E   IGD      A D D G+NG   Y I     + + F +  +    T+M            KKLDREK+  Y   V A D GNP  + ++ V + + D ND +P F K VY  ++ E++  N  V  ++A D D   NG++ ++I S     +   FSI   +G + V+ +LDYE     +L+V A D G     +  TV I + D+NDN+P+  F  S F     I EN A G+        DKD   NG++T          FS  + ++P ++      IS  +  DRE+  K T  I   D+G P +  +  +++ + DIND  P FS++ Y   + E+ + GT +  + A D D G   ++ YSI       + F IN   G + L   L+  +     F+  A+D       STA + V V D N + P F  +S    V E+ +    ++ V  TD D G N++     +S +  TL+                       FS+     +I     LDRE    Y   + ATD G P    K  +YI++ DVND  P F+ PS      KV+     G  + ++ A D D GKN+++ YSF SN      F ++   G I       ++TI E      Y L VV  D G P  + + ++++I+E +
Sbjct:   67 SATYFSIDQITGVITTKRGLDREFLDRHF---------------FRVKAEDGGEPSLEGYMDLTINVLDVNDNGPIFERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDGDNSAFSIGEVSGAVTVM------------KKLDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMNF---FSINRINGEVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQ--FVSSHF--QTMIPENYAVGQEFYRVQAYDKDHGTNGEIT----------FSFMQNDLPFSINENTGGISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPTNVV-YSIVSSSGHDRCFRINP-QGLITLSCTLNYNTKHVYVFSVSASDGMLS---STALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAK-----ISYSIATLVPE---------------------FSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPS---YEAKVREDIRPGGRVIEVSASDADIGKNAQIIYSFASNGDGQGTFTIDSTQGIIRTLKPLDRETIPE------YELTVVATDQGTPPGQASVKVKVILEDV 745          

HSP 2 Score: 237.269 bits (604), Expect = 1.830e-63
Identity = 206/704 (29.26%), Postives = 326/704 (46.31%), Query Frame = 3
Query:  585 DNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYI-INTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEE---FSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESIN-GDSILSK---ENKMKDNVE 2669
            +N P +S+ +     SE +E+G   +   A D D G+NG+  YS+SP       +Y  I+  T + + K          LDRE +D++ F V A DGG PS  G + + + V D NDN P+FE+ +Y   + E+      V+ ++A DADS  NG+++Y I  L        FSI   SG + V  +LD E   T +L V+A D GN  R +T TV I + D+ND +P+     S+   +A I E+    +LV      D D   NG+V    E ++  +   FS+ R+N  + V  K+      D E        +   D+G P      +V + + D+ND AP F    +   + E+   G   + + A DKD G N  +++S    D   FSIN+  G + ++ +LDRE V    F  +A D G P +  TA IT+ + DINDN P F  +  +  + EN      ++QV   D D G                        P   ++  V+ S  +  F + P G LI     L+      Y   + A+D      S+  ++Y+NV D N   P+F   S S    +VK     GT++  ++A D D G N+++ YS  +       F ++  +G I    ++ +  KV  Y   V   D+GIP+L+  + + I I  +N  D +  K   E K+++++ 
Sbjct:   15 NNPPQFSRLQEDASVSEDAEVGTVVATVSASDPDSGSNGMIRYSMSPSQNLMSATYFSIDQITGVITTKR--------GLDREFLDRHFFRVKAEDGGEPSLEGYMDLTINVLDVNDNGPIFERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCI--LNSDGDNSAFSIGEVSGAVTVMKKLDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQF----SKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEV--FFEIVSGNDMNFFSINRINGEVRVKQKL------DYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSFMQNDLP-FSINENTGGISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSG------------------------PTNVVYSIVSSSGHDRCFRINPQG-LITLSCTLNYNTKHVYVFSVSASDG---MLSSTALVYVNVTDSNTHAPEFKRRSYS---AEVKEDASLGTSVLTVLATDRDTGSNAKISYSIAT---LVPEFSVDETTGVIKTAGSL-DREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIR 660          

HSP 3 Score: 191.815 bits (486), Expect = 2.775e-49
Identity = 188/719 (26.15%), Postives = 313/719 (43.53%), Query Frame = 3
Query:  396 YFEINPLNGVITIERRIDRD--NLCHLVPTCCPKKN----NQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIF--GKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIY-LYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHK 2525
            +F IN +NG + +++++D +   + +L+ T   K      NQ  +D                I + D+NDN+P +  +   T   E   +G       A D D GTNG     I+    + +L + IN NT   S KE+L        DREK+ K+ F + A D G P   G+ ++ + + D NDN P F +  Y  S+ EN +  T V+Q+KAID DS   G      S ++   + + F I    G I +   L+Y T       V A+D G L   ST  V +N+ D N ++PE      R + +A++ E+ + G  V      D+D+  N K++  +  +   EFS++           I T  S DRE+       +   D G P+      V + + D+ND  P F + SY   V ED++PG  +  ++A+D D G NA + YS    G     F+I+   G +     LDRE++     T  A D G P   ++  + VI++D+ D+ P   K +Y + V E+     P++ V                          K +D  P   +   + +  S  +F + P+   I     LD E  ++Y + + AT     P  T+  + + + D+ND  P        +  + V+   V      +I A D D   + +L +     N   +   +N  SG++S+ + + ++ K
Sbjct:  281 FFSINRINGEVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVD----------------IALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNG----EITFSFMQNDLPFSINENTGGISIKEEL--------DREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDS---GPTNVVYSIVSSSGHDRCFRINPQ-GLITLSCTLNYNTKHVYVFSVSASD-GML--SSTALVYVNVTDSNTHAPEF----KRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSIATLV-PEFSVDETT------GVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVSASDADIGKNAQIIYSFASNGDGQGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATDQGTPPGQASVKVKVILEDVKDSPPLFEKPLYEVTVPEDTPPRSPVITVKA------------------------KSQDLSPETGMMYSIVRGNSPQVFDINPNTGAIQTLMKLDYETQSEYRLTVRATLS---PFFTETTVMVYLKDINDNTPVL---EAFHMNINVQEGKVPPEARYKIPAYDPD--VSDKLTFKVMEGN-AKEWVTLNATSGELSVNKKLIQASK 920          
BLAST of Protocadherin-1 vs. Ensembl Nematostella
Match: EDO40470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S751])

HSP 1 Score: 234.958 bits (598), Expect = 1.177e-62
Identity = 200/682 (29.33%), Postives = 334/682 (48.97%), Query Frame = 3
Query:  558 LVIEVKDINDNSPFW---SQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSI-SPEITE-FELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVI-INIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAK-----IFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIY-LYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNG 2567
            +++ V+D+NDNSP +   +  +LV   ++     D +   +A+D+DFG+N    Y+I S  +   F+L    +T+  +Y+  + +       +DRE++D Y   ++A DGGNP+ +G +++ + V D NDN P F    Y  ++ EN+   T ++Q+ A D D   N +I+Y I + + P+   +F I   +G I     LDYE   +  ++V+A D G+  + S+  ++ I + D+NDN+P I+   +    + ++TEN   G  VA  SV D DS +NG+V   LE   +  FS+ + ++ L     I+  +S DRE         VC D+G+P +TT  S  + V D+ND AP F   +Y   V E+    T +  +NA D+D G N+ L Y+I            F+I+   G +   TDLDRE +  +  T    D G P      ++ V + D NDN P+  +S Y   + EN  +  P+VQ+   D D G NS    ++++                           N+ F L P   L+     LD EV + Y   + ATD G   +S    +++++ D+ND +P F     S+ +V+    T  G +I Q+ AID D  K +   +  +  N  +++F ++  SG I+L + +    +   Y+L V   D G
Sbjct:   44 VLVYVQDLNDNSPSFVRGTSAKLVVFENDK----DFRQKLIAVDSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDGDLYA--DLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQ--AIFGIHPTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYT-LGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEG-GDGYFSM-KFDV-LNDESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSILTP--------------------------NTPFFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGGG--RSCNATVHVSLTDLNDNQPVF---DPSSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQGN-ADEVFSVD-GSGLITLAKLLDRETQ-DNYLLTVKAVDGG 679          

HSP 2 Score: 232.646 bits (592), Expect = 5.877e-62
Identity = 200/691 (28.94%), Postives = 326/691 (47.18%), Query Frame = 3
Query:  564 IEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSIS--PEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPI-ANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIF-GKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESIN 2621
            I V D+ND +P + ++   T+  E + +    ++  A+D DFG+N    Y+I+   E   +   + I+ ++ M +    L        DRE+I +    V   D G+P  + +  VIV +TD NDN P F ++ Y  S+ EN  S +PV+QL A D D   N  I Y I +   P     F ++   G +     LD+E  ++ +  V A D G   R    TV +++ DLNDN P   F+PS ++   +  EN   G+ +      D+DS +       +E   A+E FS++   +       I+  K  DRE +      +   D G         V++ V D+NDE P FS+  Y F + E  +  + +  ++A  +D+G NA + YSI  G    I  IN   G ++L++++D E + SL+ T +A D G P     AN+T+ V DINDN P F   SI + + E+         V+V DAD G+      +L+S   T             LF   + + + SL  L+  G                Y + ++A D G+PP+S+  ++ + V+DVND  P F      + T  V   T   + I +++A D D G+N  + Y+F S   T+   L N   GKI ++  + +   +  Y L V+  D+G PR   +A +++I++ +N
Sbjct:  377 INVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDL--------DREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSILTPNTP-----FFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGGG--RSCNATVHVSLTDLNDNQP--VFDPSSYS--VEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNADEVFSVDGSGL-------ITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGNTDNIVLINST-GTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQFNSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSNPGT-------------LFNLDSNTGALSLTKLIDYGN-----------SARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVF---GNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFGLRN--GGKIFIKSKL-DREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVN 1010          

HSP 3 Score: 213.001 bits (541), Expect = 8.692e-56
Identity = 208/791 (26.30%), Postives = 348/791 (43.99%), Query Frame = 3
Query:  225 NHKHFTIDIYEELPRKTKVIDLGAQATKWFPTDVNKLQDFGKPIYKFQFFNCEKSSVYFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSI----SPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNP-SFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGK-DAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIY-LYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDED-EGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQE--SHKVCCYVLIVVVKDNG 2567
            N   +   ++E  P  + V+ L AQ             D G+       ++    +  F ++P  G++T  R +D +                 + + T+             + + D+NDN P +  +    ++ E + IG S     A+D D     I+ + I    + E+   + S +I    ++               DRE  D Y   V A DGG   S N +I V + V D ND  P+F KA Y  ++ E+ Q+ + +  + AI  D   N ++ Y IS   K     +  I S +G ++++ E+D+E   ++ L V+A D G         V I + D+NDNSP+  F  S      ++ E+   G      SV D DS   G+V+  L       F+L+     L+    ++ L  +    +S  T  +   D G+P ++++  + + V D+ND +P F   SY  HV E   P + +  + ATD D G N  +SY+   K D   F +    GK+F+++ LDRE +E  +    A D G P++ S+A++ VIV D+NDN P   ++ Y  +V EN      L  V+ +D+DEG N        ++ A  ++ ++                          GK+   +  LDRE    Y   I ATD G+ P+  K  + + V DVNDC PKF   S +  +V V      G+++  +IA D+D +G NS++ Y   +  +    F +N  +G ++L   +    +H+   ++L VV  D G
Sbjct:  499 NQSSYNASLFENSPSGSPVVQLLAQD-----------PDIGE--NSLILYSILTPNTPFFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGGGRSCNATVH------------VSLTDLNDNQPVFDPSSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNADEVFSVDGSGLITLAKLL---------------DRETQDNYLLTVKAVDGGGQDSVNKAI-VNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSIS---KGNTDNIVLINS-TGTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQ--FNSSSIL--VRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSNPGTLFNLDSNTGALS----LTKLIDYGNSARS-YTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFGLRN-GGKIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTYRFDTQVAQFIVDKQT-------------------------GKITTSQV-LDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKF---SKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGPKA---FSLNQVTGVLTLVSPLDREVTHR---HILHVVASDKG 1199          

HSP 4 Score: 206.453 bits (524), Expect = 8.478e-54
Identity = 206/778 (26.48%), Postives = 327/778 (42.03%), Query Frame = 3
Query:  336 QDFGK-PIYKFQFFNCEKSSVY---FEINPLNGVITIERRIDRDNLCHLVPTC------CPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIP-LTVMYKISTL---KSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLD-RESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIY-LYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESIN 2621
            QDFG      +   N  +S  Y   F I+P +G+IT    +DR+ +  +V T        P  ++ C++                ++ + D NDN P+++Q+       E S  G      +A D D G N +  YSI            +  NT  + +  +  +   + LD E    Y F V A DGG  S N ++ V  ++TD NDN PVF+ + Y +   EN +    + QLKAID DS       + I      E   +FS++  SG I +   LD ET     L V+A D G     +   V I + D+ND  P   F  + +  N  I E+     ++       +D   N +V           +S+ + N   + ++    TL      D E+   +   +   D+G P      +V++ V DIND +P F+  S +  + ED   G   +T++  D D G+   +S+S+      +F+++   G + L   +D   S  S     +A D G P + STA + + V D+ND  P      Y  +VLE    D  +++V  TD D G N        S+  T                        S F L   GK+ I+ S LDRE   +Y + + A D G P +S+   + + V DVND  P F     ++    VK      T +  + A D DEG N  + Y F +       F+++ ++GKI+  Q +    K   YV  +V  D G     D  ++ +I+  +N
Sbjct:  416 QDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSV----------------IVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSI------------LTPNTPFFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGGGRSCNATVHV--SLTDLNDNQPVFDPSSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNADE---VFSVDG-SGLITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPP--IFSKAEY--NFTIQEHSQALSVIGHVHAISRDKGTNAEVV----------YSISKGNTDNIVLINSTGTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQFNSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSNPGTLFNLDSNTGALSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDT------------------------SKFGLRNGGKIFIK-SKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHF---QQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTYRFDTQVAQ---FIVDKQTGKITTSQVLDREAK-ASYVFSIVATDGGSSPRVDKTQVTVIVRDVN 1113          

HSP 5 Score: 182.956 bits (463), Expect = 1.699e-46
Identity = 210/755 (27.81%), Postives = 332/755 (43.97%), Query Frame = 3
Query:  399 FEINPLNGVITIERRIDRD----NLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVI-VAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMG---NLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSI-FGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKI----SLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESIN 2621
            F +N + GV+T+   +DR+    ++ H+V     K  NQ               I  + I V D+NDN P +          E   IG   +  +A+D+D G NG   Y I             NT+     N+    +   + LD E  ++Y   V+A D G      S +++ + V D NDN P F+K   I  + EN+  NT V  +KA D DS +N +I Y I S +   +   F I S +G I     +D E  +  SL V A D       R  +T T+ I I+DLNDN+P+     SR  N   + E+E     V   +  D D+ + G V   +      +FSL+      T + K+  + S D E   + T HI   D G+P  T+    +V V D+ND  P F+   +I  V+E+   GT +  + A D+D G NA L+YSI  G +   FSI+K  G +   + LDRE  ++   T  A    YP ++S+ ++ + V D NDN P F+   + L V EN  A + +  + V D D G N+                        K+   +    ++  F++      +   + LDRE    Y++ ++A D   P  +    I I + D ND  P F     S++  ++ P    GT+I  + A D+D G N  + Y+   +N T  ++ ++  +G +      + +I++ +   C     + KD G         +RI IE  N
Sbjct: 1166 FSLNQVTGVLTLVSPLDREVTHRHILHVV--ASDKGGNQS-----------LETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNG----------NTDGTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQSPRAH---FKINSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFV---SR--NLTYVMEDEPFNFQVTSITALDPDTGQGGNVEYRIVSPDTGKFSLDLK----TGVLKL--IGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMDKFSIDKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISPVVTLKVPENSPARL-IYTLTVQDLDYGNNT------------------------KVLYSIMSGNTDGAFTIGRSTGELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTP---PGTSILNLTASDKDSGSNGNIVYTL--SNDTYGVYSIDSRTGIVYSAARFETSIKQEYNFFC-----IAKDQGQDPKMAIVPVRIKIEDKN 1848          

HSP 6 Score: 176.022 bits (445), Expect = 2.182e-44
Identity = 193/737 (26.19%), Postives = 319/737 (43.28%), Query Frame = 3
Query:  399 FEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLT--VALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKL----------------------------FSIESNSGYIHVRWELDYETYTT-ISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFE-PSRFTNNAKITENEAPGKLVAVFSVQDKDSN-ENGKVTCHLEPIANEEFSL-ERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSI-FGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPF--LPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTT--KYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKI 2492
            F ++P  GVI++      D L +        KN + +L  T +     +  ++L I V D NDNSP +  + ++ Q +E +     + +    A D D GTNG   YSI          +  N   +   +    ++   K LDRE    ++ ++   D G P  + + +V V VTD NDN P+F+  +  +++ E+ ++   V  + A D D E   ++ Y + S + P  A L                            + I++++G I  R  +D     + I + V+A D G   + +   V I I      + E  FE PS F    K+ EN   G  V    V D  +    G+++ ++E   +  F + +R  +       IS  K  D E K +    +   D+  P +     V + V D+NDE P F +  Y+   +E +  GT +  ++A DKD G N  + ++I  G D   F+I++  G +  +  LD E++++ H + RA D G P   +  ++T+ V D+NDN P   +P    + VLEN   +  L ++N TD D G N+    T++  T             Q LF  +   FS  L + +            D E T   +Y + I+ATD GNPP S+   I +NV D ++  P F   +  +    V      G  + Q+ A D D G    + + F   N T++   MN  +G I
Sbjct: 2008 FYVDPFTGVISVASA---DALDY-----ESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSI----------WTGNEAGVFTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDP-LSEVNIREDTRTGAVVTSVVATDTDKE--SRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIII------TREPKFELPSYF---GKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIE--NSNYFRIGQRSGV-------ISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTG------------QGLF--LIDKFSGWLTTNIT----------FDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSF---NRMDYKFDVPGNAKIGDFVGQVTATDRDSGDQGRVFFVFY--NPTSNALKMNATTGII 2676          

HSP 7 Score: 173.711 bits (439), Expect = 1.086e-43
Identity = 199/788 (25.25%), Postives = 336/788 (42.64%), Query Frame = 3
Query:  189 AFQLPENSFESSNHKHFTID-------IYEELPRKTKVI-------DLGAQATKWFPTDVNKLQDFGKPIYKFQFFNCEKSSVYFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSP-FWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNG-ISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCH-LEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIY-LYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISL 2498
            ++QL     E +N    T D       IYE +P  T V        D G  +  W+  D                   +    +F+IN   G+I     IDR+ +     +   +  +Q          D   +   L I ++D+NDN+P F S+N  +T   E        +   ALD D G  G + Y  +SP+  +F L        ++ S            LD E + +Y   ++A D G+P         V V D NDN P F + ++I +V+EN  + T V+++ A D DS  N ++ Y I S  + +    FSI+ +SG I     LD E   T  L V A  +    R S+ +V IN+ D NDN P+ +  P       K+ EN +P +L+   +VQD D   N KV    +    +  F++ R         ++ST    DRE K+     +   D   P  T   ++++ +ED ND  P F +  Y   ++E   PGT +  + A+DKD G N  + Y++      ++SI+   G V+     +    +  +F   A D G   +++   + + ++D N++ P   K+ Y +++  N +A   +  V  TDAD   ++  KVT                     +R      S SLF +  +   +   +G       ++ + I A D G+PP    GI+ I + ++ D  P+F+  + + + V +   +  G+ I  + A       ++++ YS  S N+    F ++P +G IS+
Sbjct: 1312 SYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTID------------------SQSPRAHFKINSETGLIQTTHPIDREEISEY--SLKVRATDQA-----FTEQDRLYNTATLKIIIQDLNDNAPKFVSRN--LTYVMEDEPFNFQVTSITALDPDTGQGGNVEYRIVSPDTGKFSLDLKTGVLKLIGS------------LDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMDK---FSIDKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPK-FISP---VVTLKVPEN-SPARLIYTLTVQDLDYGNNTKVLYSIMSGNTDGAFTIGRS------TGELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSNDTYGVYSIDSRTGIVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVT---------------------YRLDDSKNSTSLFVVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFL--NQTPARVSIPENSKVGSYITTVRA---RASSDAQVTYSIISGNK-GRAFYVDPFTGVISV 2019          

HSP 8 Score: 166.777 bits (421), Expect = 1.679e-41
Identity = 181/717 (25.24%), Postives = 307/717 (42.82%), Query Frame = 3
Query:  564 IEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNE--NGKVTCHLEPIANEE--FSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHF-SEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIF-GKDAKIFSINKLDGKVFLETD--LDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVP--LVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKF--------------------IFPSGSNS----TVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIII 2609
            I V D NDN P +    +  +  E S      +LTV  D D+G N    YSI    T+   +   +T  +  + K          LDRE    Y+  V A D   P +     + + + D+NDN PVF++++Y  +++E     T ++ L A D DS  NG I Y +S+ T      ++SI+S +G ++     +       +    A D G   + +   V I I D N+++P+    P        I  N +   LV + +  D D+++  NGKVT  L+   N    F +E      +    + T   F    + +   +I+  D G+P     G V + + +I D+ P F ++      + E+ K G+Y+ T+ A    +   A ++YSI  G   + F ++   G + + +   LD ES ++      A   G+        + + V D NDN P F P ++   + E+  A  P  +V+V  TD D G N +   ++ +     +      + I     ++T +            KL      LDRE T  +++VI  TD G PPKST   + + V D+ND  P F                    +  + ++     T  +K  +  G  I ++ A D+D G N++++YSF   N     + ++ ++G IS ++TI    +     + V   D G+P       +RIII
Sbjct: 1634 INVMDRNDNPPKFISPVVTLKVPENSPARLIYTLTVQ-DLDYGNNTKVLYSIMSGNTDGAFTIGRSTGELSTTTK----------LDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSNDTY----GVYSIDSRTGIVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYE----VHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSLFVVE------SNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVSIPENSKVGSYITTVRARASSD---AQVTYSIISGNKGRAFYVDPFTGVISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGV------FTIDSTTGEITTA------------KL------LDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIII 2298          

HSP 9 Score: 151.369 bits (381), Expect = 9.490e-37
Identity = 195/701 (27.82%), Postives = 291/701 (41.51%), Query Frame = 3
Query:  558 LVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDF-GTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFD-GGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVI-INIRDLNDNSPEIYFEPSRFTNNAKIT---ENEAPGKLVAVFSVQDKDSNENGKVTCHLE---PIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEG---NPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYL-YVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESIN 2621
            + + V+D+ND SP +S+N+     +E   +G S    +A D+D  G N    Y I      F L+ +    T++              LDRE   ++   V A D GGN S      + + V D NDN PVF       +V E L   + V  + A+D+D   NGK+ Y+I           F I   +G I     LD+E      L V A DMG  ++ ++  ++ I + D NDN P        F  N  IT   EN      V      D DS  N ++   ++   P A+ + + E           I T    DRE+ S+ +  +   D+      R   + ++ + ++D+ND AP F  ++ + +V ED      + +I A D D G    + Y I   D   FS++   G + L   LD E V        A D G P   S     V+V D+NDN P   + +++  V EN      +V+V   D D G N+E   ++ S          D++ I K                     LI+  S LDRE    Y + + AT    P + +   + INV+D ND  PKFI P     T+KV P       I  +   D D G N+++ YS  S N T+  F +   +G++S    +    K   Y L V  KD   P     A + I IE  N
Sbjct: 1105 VTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGPKAFSLNQVTGVLTLV------------SPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKI---VNGNTDGTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPT-------FDKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQSPRAHFKINSETG--------LIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRN-LTYVMEDEPFNFQVTSITALDPDTGQGGNVEYRIVSPDTGKFSLDLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGV------EMDKFSIDK------------------HSGLIVTNSILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISPV---VTLKV-PENSPARLIYTLTVQDLDYGNNTKVLYSIMSGN-TDGAFTIGRSTGELSTTTKLDRETK-ASYQLSVQAKDITPPYYTAFANITIFIEDQN 1744          

HSP 10 Score: 105.916 bits (263), Expect = 6.100e-23
Identity = 98/357 (27.45%), Postives = 159/357 (44.54%), Query Frame = 3
Query:  345 GKPIYKFQFFNCEKSSVYFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHI----IVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFE-KAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTT--ISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRF--TNNAKITENEAPGKLVAVFSVQDKDSNENGKV 1388
            G P+ +  + N E S+ YF I   +GVI++ + +D +     +              L + + DD +      + + I V D+ND  P + Q+  + Q+SEG  +G       A D D G NG  +++I  +  + + S+ I+  T +   +          LD E I  +   V A D G+P  +  + V + V D NDN PVF       + V ENL  N+ + ++ A D DS  N ++ + +   T      LF I+  SG++      DYE       SL ++A D GN    S  T+I+N+ D ++  P       +F    NAKI      G  V   +  D+DS + G+V
Sbjct: 2334 GLPLGRISY-NIENSN-YFRIGQRSGVISVNKPLDYETKRRFL--------------LVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAI--QSGDDKGSFAIDRKTGVIRTQRA--------LDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTG---QGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSFNRMDYKFDVPGNAKI------GDFVGQVTATDRDSGDQGRV 2655          

HSP 11 Score: 73.559 bits (179), Expect = 4.494e-13
Identity = 87/290 (30.00%), Postives = 139/290 (47.93%), Query Frame = 3
Query: 1773 GKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPK--SIYLYVLENHTADVPLVQ-VNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRES--GLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVS-GTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIP-RLEDTARLRIIIESIN 2621
            G +  +T LDRE V + + T     S  PK  +   + V V+D+NDN P   +  S  L V EN   D    Q +   D+D G NS    T+VS              +  +F+ ++K  ++    L  D  L++  S  G+DRE    Y + I A+D GNP       + I V D ND KP+F   S S +     P  +  GT+I Q+ A D+D G N+E++YS ++++    +F ++P +G I     +    K   Y+++V  +D G   +L  +A +RI +  +N
Sbjct:   12 GVITTKTVLDREKVSAYNLTI-VEFSTPPKSYT---VLVYVQDLNDNSPSFVRGTSAKLVVFEN---DKDFRQKLIAVDSDFGSNSTQSYTIVSGN------------VGNVFKLISKRDTDG--DLYAD--LVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTI----PENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQAIFGIHPTTGVIVNNVRLDYEAK-RSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVN 273          
BLAST of Protocadherin-1 vs. Ensembl Nematostella
Match: EDO46418 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ21])

HSP 1 Score: 225.328 bits (573), Expect = 7.687e-60
Identity = 209/709 (29.48%), Postives = 327/709 (46.12%), Query Frame = 3
Query:  564 IEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEY--AKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVT-CHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIF-GKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIY-LYVLENHTADVPLVQVNVTDADEGLN-------SETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFS-------------LLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKF---IFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIP-RLEDTARLRI 2603
            I + D ND+ P +   +      E  E+G S     A D D G+N    YSI P+   F     I+  T   ++K  L    K +    ++  +  + N  D GN S      V + V D  ++ PVF + VY+++V E++   + +IQL A    ++ N  I Y I     P       F I  + G +     LD++  +  SL + A +  +    +   + I + D+NDN PE  F   R+     ++EN   G  V   S +D+DS ENG+VT   ++   +++F L+  N  L     ++T + FDRE + + T  +   D G+P++TT   V + + D ND  P F EK Y   V E    G  L  ++A D+D G+NA +SY I  G     F +N+  G + L   LDRE+V+    T  A D  Y  +   A + V V DINDN P   KS Y + V EN  A   +V++  +D D G +       S   + +V +      +  DE  I  +  ++    S    S             ++ D  +I     LDRE  + Y+IV+ ATD G+PP+  K  + + V D ND  P+F   +F        K+      G+T+A + A D DEG N++L+YS +   +    F ++  +G+I L  T+    K   Y L V V+D+G+P    DTA L +
Sbjct: 1139 IRIGDKNDHDPVFQNKQYEATIKEDFEVGRSVLHVSATDADAGSNAKLTYSIQPQNDYFA----IDRATGTVTSKMSLLSEAKSEGQSSRVISFNVVAN--DNGNVSRKTVTLVRITVLDLGNDPPVFSQGVYVVTVREDIAIGSSLIQLSA---STKTNKLIYYSIVPGNVPSSNNPPRFQIRISKGIVWNSHRLDHKETSNFSLTIRA-ETTDPPMSAFANLKIFLEDVNDNPPE--FVMPRY--QGHVSENAPIGSSVLQVSARDRDSGENGRVTYSFVQDKDSDKFGLDE-NTGL-----VTTREEFDREAQGRYTLALKARDNGSPQKTTDTIVEIIITDENDNPPIFEEKVYNISVLESAASGMELLKVSAVDRDFGVNARVSYYISEGNINGAFEVNREFGTIRLAGTLDRENVDHYKLTLTAKDGKYSGE---ATVNVYVLDINDNNPKFEKSHYRVNVSENRPAGTLVVKLRASDPDLGESGKFLYDISGQGLMIVGDVNDNKPRFPDEPYIGHVMENLKAGASVMTMSAVDIDDPDVGNNAVMTDTGVIRTRRMLDREKRSSYDIVVAATDGGDPPQEGKVKVKVIVDDANDQHPQFTKRVF------AAKISESAALGSTVATVSATDRDEGVNAKLKYSLEYEAKEERPFRIDETTGEIILALTLDYETK-RNYRLKVKVRDSGVPLSFSDTASLTV 1817          

HSP 2 Score: 182.57 bits (462), Expect = 1.677e-46
Identity = 160/547 (29.25%), Postives = 246/547 (44.97%), Query Frame = 3
Query:  504 CNLDLTIKS---DDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHL--------------EPIANEE----FSLERMNIPLTVMYK---------------------ISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSI--FGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLS-TANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDAD 2006
             N  LTI++   D   S    L I ++D+NDN P +         SE + IG S     A D D G NG   YS   +    +    ++ NT + + +E+         DRE   +Y   + A D G+P       V + +TDENDN P+FE+ VY ISV E+  S   ++++ A+D D  +N ++ Y IS   +      F +    G I +   LD E      L + A D    +     TV + + D+NDN+P+  FE S +  N  ++EN   G LV      D D  E+GK    +              +P   +E      +E +    +VM                       I T +  DRE++S     +   D G+P Q     V V V+D ND+ P F+++ +   ++E    G+ + T++ATD+DEG+NA L YS+    K+ + F I++  G++ L   LD E+  +     +  DSG P   S TA++TV V D ND  P F P S    V E+      L+++ VTD D
Sbjct: 1331 SNFSLTIRAETTDPPMSAFANLKIFLEDVNDNPPEFVMPRYQGHVSENAPIGSSVLQVSARDRDSGENGRVTYSFVQDKDSDKFG--LDENTGLVTTREEF--------DREAQGRYTLALKARDNGSPQKTTDTIVEIIITDENDNPPIFEEKVYNISVLESAASGMELLKVSAVDRDFGVNARVSYYIS---EGNINGAFEVNREFGTIRLAGTLDRENVDHYKLTLTAKDG---KYSGEATVNVYVLDINDNNPK--FEKSHYRVN--VSENRPAGTLVVKLRASDPDLGESGKFLYDISGQGLMIVGDVNDNKPRFPDEPYIGHVMENLKAGASVMTMSAVDIDDPDVGNNAVMTDTGVIRTRRMLDREKRSSYDIVVAATDGGDPPQEGKVKVKVIVDDANDQHPQFTKRVFAAKISESAALGSTVATVSATDRDEGVNAKLKYSLEYEAKEERPFRIDETTGEIILALTLDYETKRNYRLKVKVRDSGVPLSFSDTASLTVEVLDANDRAPRFEPLSYSAVVREDVDIGERLLRLEVTDPD 1857          

HSP 3 Score: 167.548 bits (423), Expect = 8.132e-42
Identity = 193/780 (24.74%), Postives = 342/780 (43.85%), Query Frame = 3
Query:  345 GKPIYKFQFFNCEKSSVYFEINPLNGVITIERRIDRDNL-CHLVPTCCPKKNNQCNLDLT-IKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHV----RWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAK----ITENEAPGKLVAVFSVQDKDSNENGKVTCHLE--PIANEEFSL-ERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFD------EGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKV------FLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIII 2609
             KPI   ++         F ++P +G + +   +D + +  H        +N + N D   I S+ D        I ++D+NDN P + +        E + +G +     A D D G NG  +Y +  +       + ++  T   + K  L        D E    + F+V A D GNP+ NG+ +VIV +T+ NDN+P F +++Y + V E+  S+  V  ++A D D   N  + Y I+S    +    F I + +G I +    + EL    YT   + + A+D  ++   S   VI+ I+D+N++ P        FT+ A     + E++ P   V      D+D+  NG+V   +E  P A   F++ ++  I       ++TL+SFDRE+K      I+  D       G  R      V + + D ND  P F  K Y   + ED + G  +  ++ATD D G NA L+YSI  ++   F+I++  G V        E   + +S   + F   A D+G   + +   + + V D+ ++ P   + +Y+  +    A                      +L+  +A+T   +   Y I  +  +V  S +   F +     ++     LD + T+ + + I A +  +PP S    + I + DVND  P+F+ P       +  P    G+++ Q+ A D D G+N  + YSF   ++ +D F ++  +G ++ ++      +   Y L +  +DNG P+      + III
Sbjct:  758 AKPIRNARYSIVSPLETKFRVDPYSGDVRVRSGLDYETVKTHRF--TAEARNTRDNTDYANIDSEADVK------IVLRDLNDNPPEFFELSYRDTLPESAPVGTTVLSVTARDLDSGVNGQFHYFVESQF------FSVDPYTGWITTKRPL--------DFETNPTHSFLVVAQDSGNPARNGTARVIVELTNVNDNAPRFSQSLYNVFVAEDAGSDQLVATVQATDKD---NDPVTYSIAS---GDNTTNFVINNKTGVIKLVSNRKPELIGPYYT---MNISASDGLHV---SQAMVIVAIQDVNNHKPV-------FTDCASYHPVVMEDDPPNTFVMQVHADDQDTGANGEVIYSIEKPPGALSYFAIDDKTGI-------VTTLQSFDREEKPVYQIRIIGRDGGLGSSRGAERLMGVCQVDIRIGDKNDHDPVFQNKQYEATIKEDFEVGRSVLHVSATDADAGSNAKLTYSIQPQN-DYFAIDRATGTVTSKMSLLSEAKSEGQSSRVISFNVVANDNGNVSRKTVTLVRITVLDLGNDPPVFSQGVYVVTVREDIA-------------------IGSSLIQLSASTKTNKLIYYSI--VPGNVPSSNNPPRFQIRISKGIVWNSHRLDHKETSNFSLTIRA-ETTDPPMSAFANLKIFLEDVNDNPPEFVMPRYQGHVSENAP---IGSSVLQVSARDRDSGENGRVTYSF-VQDKDSDKFGLDENTGLVTTREEFDREAQ-GRYTLALKARDNGSPQKTTDTIVEIII 1461          

HSP 4 Score: 153.295 bits (386), Expect = 2.114e-37
Identity = 174/681 (25.55%), Postives = 293/681 (43.02%), Query Frame = 3
Query:  558 LVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEA------NDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKIST-LKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIF----GKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEAT-DRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKD 2561
            +++ V D N+N P + Q+       EGS IG       A D D G+N    Y  S +I  F +     T T+ Y               R K  KY F V AFD G PS +    V V++   +D+ PVF K+ Y   + EN      +++++A+       G++ Y    L   +    F+++  +G + ++  LDYE   +  L + A       +M  L   +  TV+I + D+NDN+P   F   R      I +    G  V   +  D+DS  +  V   LE   +  F++     P T + K +  L+ F+R+  + V   +   D   P    + ++ +G  D+ND  P F++  Y   V E+++ G  +    A D D+G NA ++YSI      +   +FSI+   G +   + LDRE +     T +A D+G P+    A I +IV D+ND+ P F   S ++ +  N   D  + Q    D D G N   + +++         ++  + I  +                 DG L      LD ++TT   I I+ T D G P +S+   I I  + V    P+F+      +  + +P+   G  +  I A   D      + YS  S N+  + F ++P  G ++  + + ++ K   Y +IV+  D
Sbjct:    1 VIVRVLDGNNNDPIFQQSSYWVALPEGSPIGTELLRVTAEDLDSGSNADVKYQSSNDI--FAVDETTGTITLQYQ------------ASRNK--KYSFTVTAFDQGKPSRSSVATVYVSIHSFSDSPPVFRKSTYEKRIPENFALKRGIVRVEALANGGGAGGELRYY---LVGGDPQSQFNVDRLTGELSLKKPLDYEKVASYRLRIRAVQKTWRPNMPEL--PAEATVLITVTDINDNAPR--FAIPREPLVTSIHQFRPAGTTVTKVTAYDQDSGSHALVKYGLENADSFPFTI----TPQTGVIKTTAELRHFERDFYAFV---VTATDSTPPFHKVTANIQLG--DVNDNPPLFAQPVYKVFVRENLQGGHVIGQFAARDPDKGANARVTYSIINFEDSRSDNLFSIHPFTGVLTALSTLDREDLSRHILTIQAKDTGVPRMSGLAQIVIIVDDVNDHAPRFSSGSFHVEIPLNTPPDSRVFQARALDPDGGHNGLVRYSIIQG------NKQGYFSINHI-----------------DGSLF-----LDEKLTTLEPIDIKVTRDMGQPERSSTADIRI-FIHVQAGPPQFLSSPFVGNVTENEPK---GAFVVHISAASLD-----PVMYSIVSGNEAGN-FRLHPGVGWLTTVRPL-DNEKQSRYKIIVMAMD 610          

HSP 5 Score: 116.701 bits (291), Expect = 2.788e-26
Identity = 194/786 (24.68%), Postives = 314/786 (39.95%), Query Frame = 3
Query:  336 QDFGK-PIYKFQFFNCEKSSVYFEINPLNGVI--TIE-RRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKD--------SNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSE-KSYIFHVN--EDVKPGTYLFTINATDKDEGINALLSYSIFGKDA-KIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLP-DGKLIIRESGLDREVTTKYEIVIEA------TDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQ-ESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESIN 2621
            QD G   + K+   N +  S  F I P  GVI  T E R  +RD    +V                  S   F H +   I++ D+NDN P ++Q        E  + G       A D D G N    YS    I  FE S    ++ +   +     L     LDRE + ++   + A D G P  +G  ++++ V D ND++P F    + + +  N   ++ V Q +A+D D   NG + Y I    K  Y   FSI    G + +  +L   T   I + V   DMG   R ST  + I I  +    P+    P  F  N  +TENE  G  V   S    D         NE G    H                    +  ++T++  D E++S+    ++  D  N  + +   V V V ++ND  P F   ++ I   N  +DV  G+ +  I+A D D   + +LSY I  + A + FS+N  +  V   T + R+      F    +D+G P  ++ A   V++        + P+                        D+   S  +   +     TL+  K   PI+     +        F + P  G + +R SGLD E    +    EA      TD  N    ++  + I + D+ND  P+F   S  ++  +  P    GTT+  + A D D G N +  Y  +S       F ++P +G I+ ++ +  E++    +  +VV +D+G P    TAR+ + + ++N
Sbjct:  252 QDSGSHALVKYGLENAD--SFPFTITPQTGVIKTTAELRHFERDFYAFVVTAT--------------DSTPPF-HKVTANIQLGDVNDNPPLFAQPVYKVFVRENLQGGHVIGQFAARDPDKGANARVTYS----IINFEDS---RSDNLFSIHPFTGVLTALSTLDREDLSRHILTIQAKDTGVPRMSGLAQIVIIVDDVNDHAPRFSSGSFHVEIPLNTPPDSRVFQARALDPDGGHNGLVRYSIIQGNKQGY---FSINHIDGSLFLDEKL--TTLEPIDIKV-TRDMGQPERSSTADIRIFIH-VQAGPPQFLSSP--FVGN--VTENEPKGAFVVHISAASLDPVMYSIVSGNEAGNFRLH------------------PGVGWLTTVRPLDNEKQSRYKIIVMAMDLKN--RVSKVEVIVNVLNVNDNKPKFVNIRNGIIEGNVLKDVAVGSRVMVIDAVDADR--SDILSYRIEDEKARRYFSVN--NEGVVTSTRVLRDLDSPYLFKVSVSDNGKPPMVAQAMARVVL------LKYQPQQ-----------------------DQQRTSIQESAALGTRVFTLLTAK---PIRNARYSIVSPLETK-FRVDPYSGDVRVR-SGLDYETVKTHRFTAEARNTRDNTDYAN--IDSEADVKIVLRDLNDNPPEFFELSYRDTLPESAP---VGTTVLSVTARDLDSGVNGQFHYFVESQ-----FFSVDPYTGWITTKRPLDFETNPTHSF--LVVAQDSGNPARNGTARVIVELTNVN 932          

HSP 6 Score: 111.694 bits (278), Expect = 9.473e-25
Identity = 113/458 (24.67%), Postives = 196/458 (42.79%), Query Frame = 3
Query:  558 LVIEVKDINDNSPFWS--QNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDRE-KIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCH-LEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP 1919
            ++I V DINDN+P ++  +  LVT   +    G + +   A D D G++ +  Y +             N ++  ++   Q  ++      R  + D Y F+V A D   P F+  +   + + D NDN P+F + VY + V ENLQ    + Q  A D D   N ++ Y I +        LFSI   +G +     LD E  +   L ++A D G  R      ++I + D+ND++P   F    F  + +I  N  P   V      D D   NG V    ++      FS+  ++  L +  K++TL+  D +         V  D G P ++++  + + +  +    P F    ++ +V E+   G ++  I+A   D  + +++S    G +A  F ++   G +     LD E          A D     ++S   + V V ++NDN P
Sbjct:  209 VLITVTDINDNAPRFAIPREPLVTSIHQFRPAGTTVTKVTAYDQDSGSHALVKYGLE------------NADSFPFTITPQTGVIKTTAELRHFERDFYAFVVTATDS-TPPFH-KVTANIQLGDVNDNPPLFAQPVYKVFVRENLQGGHVIGQFAARDPDKGANARVTYSIINFEDSRSDNLFSIHPFTGVLTALSTLDREDLSRHILTIQAKDTGVPRMSGLAQIVIIVDDVNDHAPR--FSSGSF--HVEIPLNTPPDSRVFQARALDPDGGHNGLVRYSIIQGNKQGYFSINHIDGSLFLDEKLTTLEPIDIK---------VTRDMGQPERSSTADIRIFIH-VQAGPPQFLSSPFVGNVTENEPKGAFVVHISAASLDPVMYSIVS----GNEAGNFRLHPGVGWLTTVRPLDNEKQSRYKIIVMAMD--LKNRVSKVEVIVNVLNVNDNKP 632          

HSP 7 Score: 109.768 bits (273), Expect = 4.280e-24
Identity = 116/475 (24.42%), Postives = 209/475 (44.00%), Query Frame = 3
Query: 1227 VIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKI-FSINKLDGKVFLETDLDRESVESLHFTTRAADSGY----PKQLSTANITVIVKDINDNFP--FLPKS-IYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKS--NNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESIN 2621
            VI+ + D N+N P   F+ S +     + E    G  +   + +D DS  N  V       +N+ F+++     +T+ Y+ S      R +K   T  +  FD+G P +++  +V V +   +D  P F + +Y   + E+      +  + A     G    L Y + G D +  F++++L G++ L+  LD E V S     RA    +    P+  + A + + V DINDN P   +P+  +   + +   A   + +V   D D G ++  K  L         +  D +P                F++ P   +I   + L       Y  V+ ATD  + P   K    I + DVND  P F  P      V V+     G  I Q  A D D+G N+ + YS  +  ++++++LF ++P +G ++   T+ +   +  ++L +  KD G+PR+   A++ II++ +N
Sbjct:    1 VIVRVLDGNNNDP--IFQQSSYW--VALPEGSPIGTELLRVTAEDLDSGSNADVKYQS---SNDIFAVDETTGTITLQYQAS------RNKKYSFT--VTAFDQGKPSRSSVATVYVSIHSFSDSPPVFRKSTYEKRIPENFALKRGIVRVEALANGGGAGGELRYYLVGGDPQSQFNVDRLTGELSLKKPLDYEKVASYRLRIRAVQKTWRPNMPELPAEATVLITVTDINDNAPRFAIPREPLVTSIHQFRPAGTTVTKVTAYDQDSGSHALVKYGL---------ENADSFP----------------FTITPQTGVIKTTAELRHFERDFYAFVVTATD--STPPFHKVTANIQLGDVNDNPPLFAQPV---YKVFVRENLQGGHVIGQFAARDPDKGANARVTYSIINFEDSRSDNLFSIHPFTGVLTALSTL-DREDLSRHILTIQAKDTGVPRMSGLAQIVIIVDDVN 429          

HSP 8 Score: 101.293 bits (251), Expect = 1.720e-21
Identity = 102/364 (28.02%), Postives = 153/364 (42.03%), Query Frame = 3
Query:  399 FEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSIS--------------------PEITEFELSYIINTNTMMYSN--------------KEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMG-NLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSN-ENG 1382
            FE+N   G I +   +DR+N+ H              L LT K D  +S    + + V DINDN+P + ++      SE    G       A D D G +G   Y IS                    P I     +     + M  S                +   +  ++ LDREK   Y+ +V A DGG+P   G +KV V V D ND  P F K V+   ++E+    + V  + A D D  +N K++Y +    K E  + F I+  +G I +   LDYET     L V+  D G  L    T ++ + + D ND +P   FEP  ++  A + E+   G+ +    V D DS+ +NG
Sbjct: 1519 FEVNREFGTIRLAGTLDRENVDHY------------KLTLTAK-DGKYSGEATVNVYVLDINDNNPKFEKSHYRVNVSENRPAGTLVVKLRASDPDLGESGKFLYDISGQGLMIVGDVNDNKPRFPDEPYIGHVMENLKAGASVMTMSAVDIDDPDVGNNAVMTDTGVIRTRRMLDREKRSSYDIVVAATDGGDPPQEGKVKVKVIVDDANDQHPQFTKRVFAAKISESAALGSTVATVSATDRDEGVNAKLKYSLEYEAKEE--RPFRIDETTGEIILALTLDYETKRNYRLKVKVRDSGVPLSFSDTASLTVEVLDANDRAPR--FEPLSYS--AVVREDVDIGERLLRLEVTDPDSDSQNG 1863          
BLAST of Protocadherin-1 vs. Ensembl Medaka
Match: pcdh7b (protocadherin 7 [Source:NCBI gene;Acc:101166584])

HSP 1 Score: 297.745 bits (761), Expect = 4.646e-84
Identity = 243/805 (30.19%), Postives = 373/805 (46.34%), Query Frame = 3
Query:  372 FNCEKSSVYFEINPLNGVITI-ERRIDRDNL--CHLVPTCCPKKNNQCNLDL---TIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITE---------------------------FELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEP-SRF---TNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVM--------YKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIII-ESINGDSILSKE 2645
            F  E  S +F+I+ + G +T  E+RIDR+ L  C ++        N+C +D     I     +  +    + + DINDN+P +    L     E   IG    L  A D DFG NGI  Y +  +  E                           FEL     T+      ++Q +L++K  LDRE+ D YE  +   DGG+P  +    + V +TD NDN+P FEK+VY   + EN    +P++QLKA DAD  +NG+IEY   + T+    +L  ++ ++G++ V   +D E  + +   V A D G   +    TV++NI+D NDN P I      R       A + E+      +A+  V D+D  ENG VTC +  + +  F L+    P + M        Y + T    D E   +    IV  D G+P  T++ S+ V V D ND  P FS+        E+  PG  + T+ ATD D G NA +SYS+      IFSI+   G + + T+LDRE  E   F   A D G      +A + V+V D NDN P F+      YV EN   + P+  V V DAD+G N+E  +                +  ++      ++ + ++FS L            DRE  T Y   ++A D G+PP+S    + + V+D ND  P   FP  S+ T+ + P +   T +  +IA D D G N++L YS    N    LF ++  +G ISL   +++ H    + L+V V DNG P    T  + + + E+++  +I+  +
Sbjct:   62 FTLESGSEFFKIDNITGELTTNEKRIDREKLQQCQMI-----FDENECFIDFEVSVIGPAQSWVDLFEGKVIILDINDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIERYELIQDNGENSRRSGSSGDSYSGKRRFDEGASRSSVFELQVADTTD-----GEKQPQLIIKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVMITDVNDNNPRFEKSVYEADLPENSSPGSPILQLKAADADVGVNGQIEYVFGAATE-SVRRLLRLDESTGWLSVLHRIDREEVSQLRFTVMARDRGQPPKMDKATVVLNIKDENDNVPAIEIRKIGRIFLKDGVANVAEDVVVDTPIALVQVSDRDQGENGIVTCTV--VGDVPFQLK----PASEMEGEQNKKKYFLHTSAPLDYETTQEYNVVIVAVDSGSPSLTSNNSLLVKVGDTNDNPPIFSKNVVQVSFPENNAPGERVTTVTATDADSGKNAEISYSLDSSVNGIFSIDSDSGDIRVNTNLDREQKERYEFKVIAKDKGINTLQGSATVVVLVDDKNDNEPKFMQDVFTFYVKENLDPNSPVGMVTVIDADKGQNAEMGL----------------FIEEEEEIFSIENETGTIFSTL----------SFDREQKTTYTFRVKAVDGGDPPRSATATVSLFVMDENDNAPTVTFPINSSYTL-LPPSSTVRTVVRTVIATDTDTGINADLNYSIIGGNPFR-LFEIDGATGVISLMAKLEQKH-YGLHRLVVQVTDNGQPSQSTTTLVHVYVNETLSNSTIVETQ 820          
BLAST of Protocadherin-1 vs. Ensembl Medaka
Match: pcdh7b (protocadherin 7 [Source:NCBI gene;Acc:101166584])

HSP 1 Score: 297.745 bits (761), Expect = 1.511e-83
Identity = 243/805 (30.19%), Postives = 373/805 (46.34%), Query Frame = 3
Query:  372 FNCEKSSVYFEINPLNGVITI-ERRIDRDNL--CHLVPTCCPKKNNQCNLDL---TIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITE---------------------------FELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEP-SRF---TNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVM--------YKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIII-ESINGDSILSKE 2645
            F  E  S +F+I+ + G +T  E+RIDR+ L  C ++        N+C +D     I     +  +    + + DINDN+P +    L     E   IG    L  A D DFG NGI  Y +  +  E                           FEL     T+      ++Q +L++K  LDRE+ D YE  +   DGG+P  +    + V +TD NDN+P FEK+VY   + EN    +P++QLKA DAD  +NG+IEY   + T+    +L  ++ ++G++ V   +D E  + +   V A D G   +    TV++NI+D NDN P I      R       A + E+      +A+  V D+D  ENG VTC +  + +  F L+    P + M        Y + T    D E   +    IV  D G+P  T++ S+ V V D ND  P FS+        E+  PG  + T+ ATD D G NA +SYS+      IFSI+   G + + T+LDRE  E   F   A D G      +A + V+V D NDN P F+      YV EN   + P+  V V DAD+G N+E  +                +  ++      ++ + ++FS L            DRE  T Y   ++A D G+PP+S    + + V+D ND  P   FP  S+ T+ + P +   T +  +IA D D G N++L YS    N    LF ++  +G ISL   +++ H    + L+V V DNG P    T  + + + E+++  +I+  +
Sbjct:   62 FTLESGSEFFKIDNITGELTTNEKRIDREKLQQCQMI-----FDENECFIDFEVSVIGPAQSWVDLFEGKVIILDINDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIERYELIQDNGENSRRSGSSGDSYSGKRRFDEGASRSSVFELQVADTTD-----GEKQPQLIIKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVMITDVNDNNPRFEKSVYEADLPENSSPGSPILQLKAADADVGVNGQIEYVFGAATE-SVRRLLRLDESTGWLSVLHRIDREEVSQLRFTVMARDRGQPPKMDKATVVLNIKDENDNVPAIEIRKIGRIFLKDGVANVAEDVVVDTPIALVQVSDRDQGENGIVTCTV--VGDVPFQLK----PASEMEGEQNKKKYFLHTSAPLDYETTQEYNVVIVAVDSGSPSLTSNNSLLVKVGDTNDNPPIFSKNVVQVSFPENNAPGERVTTVTATDADSGKNAEISYSLDSSVNGIFSIDSDSGDIRVNTNLDREQKERYEFKVIAKDKGINTLQGSATVVVLVDDKNDNEPKFMQDVFTFYVKENLDPNSPVGMVTVIDADKGQNAEMGL----------------FIEEEEEIFSIENETGTIFSTL----------SFDREQKTTYTFRVKAVDGGDPPRSATATVSLFVMDENDNAPTVTFPINSSYTL-LPPSSTVRTVVRTVIATDTDTGINADLNYSIIGGNPFR-LFEIDGATGVISLMAKLEQKH-YGLHRLVVQVTDNGQPSQSTTTLVHVYVNETLSNSTIVETQ 820          
BLAST of Protocadherin-1 vs. Ensembl Medaka
Match: pcdh7b (protocadherin 7 [Source:NCBI gene;Acc:101166584])

HSP 1 Score: 297.745 bits (761), Expect = 2.295e-83
Identity = 243/805 (30.19%), Postives = 373/805 (46.34%), Query Frame = 3
Query:  372 FNCEKSSVYFEINPLNGVITI-ERRIDRDNL--CHLVPTCCPKKNNQCNLDL---TIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITE---------------------------FELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEP-SRF---TNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVM--------YKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIII-ESINGDSILSKE 2645
            F  E  S +F+I+ + G +T  E+RIDR+ L  C ++        N+C +D     I     +  +    + + DINDN+P +    L     E   IG    L  A D DFG NGI  Y +  +  E                           FEL     T+      ++Q +L++K  LDRE+ D YE  +   DGG+P  +    + V +TD NDN+P FEK+VY   + EN    +P++QLKA DAD  +NG+IEY   + T+    +L  ++ ++G++ V   +D E  + +   V A D G   +    TV++NI+D NDN P I      R       A + E+      +A+  V D+D  ENG VTC +  + +  F L+    P + M        Y + T    D E   +    IV  D G+P  T++ S+ V V D ND  P FS+        E+  PG  + T+ ATD D G NA +SYS+      IFSI+   G + + T+LDRE  E   F   A D G      +A + V+V D NDN P F+      YV EN   + P+  V V DAD+G N+E  +                +  ++      ++ + ++FS L            DRE  T Y   ++A D G+PP+S    + + V+D ND  P   FP  S+ T+ + P +   T +  +IA D D G N++L YS    N    LF ++  +G ISL   +++ H    + L+V V DNG P    T  + + + E+++  +I+  +
Sbjct:   62 FTLESGSEFFKIDNITGELTTNEKRIDREKLQQCQMI-----FDENECFIDFEVSVIGPAQSWVDLFEGKVIILDINDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIERYELIQDNGENSRRSGSSGDSYSGKRRFDEGASRSSVFELQVADTTD-----GEKQPQLIIKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVMITDVNDNNPRFEKSVYEADLPENSSPGSPILQLKAADADVGVNGQIEYVFGAATE-SVRRLLRLDESTGWLSVLHRIDREEVSQLRFTVMARDRGQPPKMDKATVVLNIKDENDNVPAIEIRKIGRIFLKDGVANVAEDVVVDTPIALVQVSDRDQGENGIVTCTV--VGDVPFQLK----PASEMEGEQNKKKYFLHTSAPLDYETTQEYNVVIVAVDSGSPSLTSNNSLLVKVGDTNDNPPIFSKNVVQVSFPENNAPGERVTTVTATDADSGKNAEISYSLDSSVNGIFSIDSDSGDIRVNTNLDREQKERYEFKVIAKDKGINTLQGSATVVVLVDDKNDNEPKFMQDVFTFYVKENLDPNSPVGMVTVIDADKGQNAEMGL----------------FIEEEEEIFSIENETGTIFSTL----------SFDREQKTTYTFRVKAVDGGDPPRSATATVSLFVMDENDNAPTVTFPINSSYTL-LPPSSTVRTVVRTVIATDTDTGINADLNYSIIGGNPFR-LFEIDGATGVISLMAKLEQKH-YGLHRLVVQVTDNGQPSQSTTTLVHVYVNETLSNSTIVETQ 820          
BLAST of Protocadherin-1 vs. Ensembl Medaka
Match: pcdh7b (protocadherin 7 [Source:NCBI gene;Acc:101166584])

HSP 1 Score: 297.745 bits (761), Expect = 2.435e-83
Identity = 243/805 (30.19%), Postives = 373/805 (46.34%), Query Frame = 3
Query:  372 FNCEKSSVYFEINPLNGVITI-ERRIDRDNL--CHLVPTCCPKKNNQCNLDL---TIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITE---------------------------FELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEP-SRF---TNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVM--------YKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIII-ESINGDSILSKE 2645
            F  E  S +F+I+ + G +T  E+RIDR+ L  C ++        N+C +D     I     +  +    + + DINDN+P +    L     E   IG    L  A D DFG NGI  Y +  +  E                           FEL     T+      ++Q +L++K  LDRE+ D YE  +   DGG+P  +    + V +TD NDN+P FEK+VY   + EN    +P++QLKA DAD  +NG+IEY   + T+    +L  ++ ++G++ V   +D E  + +   V A D G   +    TV++NI+D NDN P I      R       A + E+      +A+  V D+D  ENG VTC +  + +  F L+    P + M        Y + T    D E   +    IV  D G+P  T++ S+ V V D ND  P FS+        E+  PG  + T+ ATD D G NA +SYS+      IFSI+   G + + T+LDRE  E   F   A D G      +A + V+V D NDN P F+      YV EN   + P+  V V DAD+G N+E  +                +  ++      ++ + ++FS L            DRE  T Y   ++A D G+PP+S    + + V+D ND  P   FP  S+ T+ + P +   T +  +IA D D G N++L YS    N    LF ++  +G ISL   +++ H    + L+V V DNG P    T  + + + E+++  +I+  +
Sbjct:   66 FTLESGSEFFKIDNITGELTTNEKRIDREKLQQCQMI-----FDENECFIDFEVSVIGPAQSWVDLFEGKVIILDINDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIERYELIQDNGENSRRSGSSGDSYSGKRRFDEGASRSSVFELQVADTTD-----GEKQPQLIIKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVMITDVNDNNPRFEKSVYEADLPENSSPGSPILQLKAADADVGVNGQIEYVFGAATE-SVRRLLRLDESTGWLSVLHRIDREEVSQLRFTVMARDRGQPPKMDKATVVLNIKDENDNVPAIEIRKIGRIFLKDGVANVAEDVVVDTPIALVQVSDRDQGENGIVTCTV--VGDVPFQLK----PASEMEGEQNKKKYFLHTSAPLDYETTQEYNVVIVAVDSGSPSLTSNNSLLVKVGDTNDNPPIFSKNVVQVSFPENNAPGERVTTVTATDADSGKNAEISYSLDSSVNGIFSIDSDSGDIRVNTNLDREQKERYEFKVIAKDKGINTLQGSATVVVLVDDKNDNEPKFMQDVFTFYVKENLDPNSPVGMVTVIDADKGQNAEMGL----------------FIEEEEEIFSIENETGTIFSTL----------SFDREQKTTYTFRVKAVDGGDPPRSATATVSLFVMDENDNAPTVTFPINSSYTL-LPPSSTVRTVVRTVIATDTDTGINADLNYSIIGGNPFR-LFEIDGATGVISLMAKLEQKH-YGLHRLVVQVTDNGQPSQSTTTLVHVYVNETLSNSTIVETQ 824          
BLAST of Protocadherin-1 vs. Ensembl Medaka
Match: pcdh1b (protocadherin-1 [Source:NCBI gene;Acc:101174755])

HSP 1 Score: 294.278 bits (752), Expect = 3.972e-83
Identity = 246/780 (31.54%), Postives = 360/780 (46.15%), Query Frame = 3
Query:  339 DFGKPIYKFQFFNCEKSSVYFEINPLNGVI-TIERRIDRDNLCHLVPTCCPK--KNNQCNLDLTIKSDDDFSHI------IVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNN----AKITENEAPGKLVAVFSVQDKDSNENGKVTC--------HLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIF-GKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIII 2609
            D G P      +  E  S Y  ++   G I T E  IDR+ L       C    ++++C L+  +   D    I      I  +IEV DINDN+P +S   L     E +  G   S+ VA+D D G+NG++ Y++S      + + +         +++  ++++   LDREK D Y+  +   DGG P    S  + + VTD+NDN+P FEK  Y   + EN      V+Q++A DAD+  NG I+Y +   +     +L  I+ ++G I+V+  +D E    +   V A D G   + S   V I+I+D NDN+P I         +    A I+E+   G  VA+  V D+D  EN  VTC         L P +      +R        Y + T    D E+       IV  D GNP  +++ S+ V V DIND  P FS      +  ED +PG  +  + ATD D G+NA L YSI     A +F IN   G++ +   LDRE VE   F   AAD G P +  TA + + V+D NDN P F+       V EN     P+  V V+DAD+G NS+  VTL  E                          N  F +      I+     DRE  + Y   ++A D G+PP+S+   + INVLD ND  P    P+ S+ T  +KP +   T +  + A D D G N+EL Y+    N  + LF ++  SG+I L Q     HK   + L+V V D G P    TA + + +
Sbjct:   61 DLGLP-DSGHLYKLEVGSPYLRVDSKTGEIYTTEIPIDRETLSD-----CRNLFEDDKCFLEFEVSITDMVKGIGLGPRLIEGIIEVLDINDNTPQFSSPILTLSIPENTHTGTLFSIPVAVDRDSGSNGVAEYALS---AGPDANQLFGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQASD-TVQRLLRIDRSTGIIYVKGLVDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESANDRKR-------KYFLQTTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVYSIIESSAASLFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPLNPVGVVTVSDADKGENSQ--VTLFVEP------------------------DNGKFIIQNGTGTILSSISFDREKESTYTFRLKAVDAGDPPRSSYVGVTINVLDENDNAPYVTKPANSSYT-HLKPSSPPDTPVEVVKAEDIDAGVNAELYYTITGGN-PHGLFQISHNSGEIKLAQGFTGKHK-GLHRLVVRVSDKGKPPRHTTALVHVYV 794          
BLAST of Protocadherin-1 vs. Planmine SMEST
Match: SMESG000074162.1 (SMESG000074162.1)

HSP 1 Score: 2091.23 bits (5417), Expect = 0.000e+0
Identity = 1069/1077 (99.26%), Postives = 1075/1077 (99.81%), Query Frame = 3
Query:  108 MNYEEHENFALKFQRMQIIKIFVGFCFAFQLPENSFESSNHKHFTIDIYEELPRKTKVIDLGAQATKWFPTDVNKLQDFGKPIYKFQFFNCEKSSVYFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESINGDSILSKENKMKDNVEYSNEESDNFDFRXXXXXXXXXXXXXXXXXXXXMMSLATALLVCRKFKQDRNYSQRERFQLKQNFRIWKSNVKKSFINKRQQELNQVEPVSGQSLIQKNMNNEDRLQINSVNKSNHSYFLNPLTLEYNPNSSTIENKDLPINLQKYSTRQFGEFQNEILIPGVSTYFDYNHSSGETDNKKQNLEVMTXXXXXXXXXXXXXXXKNCAFPAQFQTFTPHFLSGCNV 3338
            MNYEEHENFALKFQRMQIIKIFVGFCFAFQLPENSFESSNHKHFTIDIYEELPRKTKVIDLGAQATKWFPTDVNKLQDFGKPIYKFQFFNCEKSSVYFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQLKLVLKKKLDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSI+KLDGKVFLETDLDRESVESLHFT RAADSGYPKQLSTAN+TVIVKDINDN+PFLPKSIYLYV ENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDRE+TTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESINGDSILSKENKMKDNVEYSNEESDNFDFRINNNVVIIIVLICAAALFIIMMSLAT+LLVCRKFKQDRNYSQRERFQLKQNFRIWKSNVKKSFINKRQQELNQVEPVSGQSLIQKNMNNEDRLQ+NSVNKSNHSYFLNPLTLEYNPNSSTIENKDLPINLQKYSTRQFGEFQNEILIPGVSTYFDYNHSSGETDNKKQNLEVMTSKSPLSLSFIDSSSSKNCAFPAQFQTFTPHFLSGCNV
Sbjct:    1 MNYEEHENFALKFQRMQIIKIFVGFCFAFQLPENSFESSNHKHFTIDIYEELPRKTKVIDLGAQATKWFPTDVNKLQDFGKPIYKFQFFNCEKSSVYFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQLKLVLKKKLDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSISKLDGKVFLETDLDRESVESLHFTIRAADSGYPKQLSTANVTVIVKDINDNYPFLPKSIYLYVFENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDRELTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESINGDSILSKENKMKDNVEYSNEESDNFDFRINNNVVIIIVLICAAALFIIMMSLATSLLVCRKFKQDRNYSQRERFQLKQNFRIWKSNVKKSFINKRQQELNQVEPVSGQSLIQKNMNNEDRLQVNSVNKSNHSYFLNPLTLEYNPNSSTIENKDLPINLQKYSTRQFGEFQNEILIPGVSTYFDYNHSSGETDNKKQNLEVMTSKSPLSLSFIDSSSSKNCAFPAQFQTFTPHFLSGCNV 1077          
BLAST of Protocadherin-1 vs. Planmine SMEST
Match: SMESG000076665.1 (SMESG000076665.1)

HSP 1 Score: 308.531 bits (789), Expect = 2.122e-87
Identity = 235/759 (30.96%), Postives = 371/759 (48.88%), Query Frame = 3
Query:  420 GVITIERRIDRDNLCHLVPTCC----------------PKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAP---GKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSINKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLP-----KSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNN---QTND-LFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIE 2612
            G I +++ IDR++LC  +  CC                P  N++ +   + K     + I  + I++ DINDNSP +SQ     + SE  +IG    L +A+D D     I  Y +  E  E  L  +I   +   S   Q+ L L + +DRE +  Y   + A D G PS +G +K+ + + D NDN P+FE + YI++V E+  S   ++ LKA D DS  NG + Y  SS    E  K F I+S++G++ +   LDYE     +  V A D G     S  TV +++ D NDN P+IY E    T++ K T  E P    K  ++  V D DS   G V C L+   +++F L   N      +KI+ ++S D E+++     IVC D G P+ T+S    + + DIND +P F   SY   V E+ + G  +  + ATD+D  +N  ++YSI       FSI+ + G +  +   DRE   S   +  A D G P Q  +AN+ + + D NDN P+        S    + EN  ++  +  ++  D DEG+N +   T +S             P++K             F++ PD  +I     LDRE    +E  +   D+G   +     + ++V+D ND +P+F+ P+  +++VK+     +GT +A+I AID+DEG NS L+Y   S N   QT D +F M+ ++G I LQ+ +     +  Y+L ++V D G P  +  A   I I+
Sbjct:  101 GDIRVKKPIDRESLCGDIGKCCDSEPFCFFELKVLVRVPSINSKISYSSSEKISSTMT-IETIRIKIIDINDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRL--ENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSSDVTSEVRKKFHIDSSTGWLSISETLDYEKVKYYTFNVIARDSGTDAAFSKATVKVSVVDCNDNPPKIYLE--YVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLK--GSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHEEEIIIRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLS-------------PVEK-------------FTIHPDQGIIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKDEGPNSHLDYQIISGNSRDQTQDKIFFMDQKNGDIFLQRALTR-QDMGVYILKMMVSDQGNPPRKSYANYVIKID 825          
BLAST of Protocadherin-1 vs. Planmine SMEST
Match: SMESG000059376.1 (SMESG000059376.1)

HSP 1 Score: 283.878 bits (725), Expect = 9.484e-80
Identity = 234/758 (30.87%), Postives = 371/758 (48.94%), Query Frame = 3
Query:  396 YFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTI-----KSDDDFSHIIV--LVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKD---AKIFSINKLDGKVFLETDLDRES----VESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLY-VLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATD-RGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTV-KVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESI 2618
            Y  ++  NG +  +R+IDRD+LC  +  CC K +  C++ +++     +     S  I+   +I ++D ND+ P +         SE   +  +  L +A+D D     +  Y     I++ +LS I +  T     K  + L LK +LDRE  D+Y   + A DGG+P+  G + V + V D NDN PVFE   Y + V E+   +  + Q++A D D   N +I Y++ S        +F ++  SG +++   LDYE      LI+ A +       +T T+ +N+ ++ND  P I+ +      +A I+E E     V + +V+DKD    GKV C L+   +E F L R N P    YKI T +  DRE  SK +  IVC D+G P  +    + V + D ND  P  +  S IFHV+E+  PGT +  I+ATDKD+G+N  L+YSI       +   +I+   G +     +DRE+    +  L  +   +DSG PKQ S  +I +++ D NDN P   +S + + V EN      L Q+ V+D DE  +    ++ +         RK  + I         S  N  +       L+  ES LDRE    YE+VI ATD  G    +    + + VLD+ND  P FIFP   N T+ KV  R   G  +    A D+D       +  F  N+ +N+LF ++P +G+I + + +  S  +  + +I+ V+D+G P L    +++I I+ I
Sbjct:   61 YLHLDSNNGKLFAKRKIDRDSLCSEIELCC-KSDIICSVSVSVAMTAAQPSSKLSDPIIGKFLIVIEDRNDHKPNFEYPIFNLSISESCPVSTTFQLPLAIDKDSDKYSVKSYKF---ISKSDLS-IFSLETQFIDRKMSVYLRLKNRLDREDTDQYSLTIAAVDGGDPALTGVLVVHILVLDVNDNPPVFENTRYNVRVKESQMISDSIAQVRATDRDIGENAEIFYKLDS-------GMFRVDELSGSVYMISPLDYEKDQEYKLIITARNRIPGVNTATATLTVNVININDEKPVIFVDYFNNWQHASISEYETAPAFVCIVTVKDKDIGIAGKVQCQLDN-HHELFDL-RQNSP--GQYKIHTRQQLDRETNSKYSLSIVCKDQGTPSLSADTIIPVVILDKNDNKPEINSPS-IFHVSENKPPGTIVTKIDATDKDDGLNGKLTYSITDAQNLVSSYLTIDSQTGIIRTLQKIDREATNPPLTKLDLSVTVSDSGTPKQSSIKSIQILIDDENDNAPQFGQSTFRFSVTENEAPIYRLGQIEVSDPDETGSVRLGISFIKSN-----NRKSPFSI--------TSEKNRFW-------LMTTES-LDREELDFYELVIIATDGAGYKSHTASATVNVTVLDINDNPPIFIFPRSGNETIPKVPYRQQPGYLVLTASANDKDNLPRGNGKLYFSINSNSNNLFNIDPHNGEIRIHRQMGIS-DIGDHFIIIKVEDDGTPVLSSERQIQIKIQDI 779          
BLAST of Protocadherin-1 vs. Planmine SMEST
Match: SMESG000059376.1 (SMESG000059376.1)

HSP 1 Score: 283.878 bits (725), Expect = 1.019e-79
Identity = 234/758 (30.87%), Postives = 371/758 (48.94%), Query Frame = 3
Query:  396 YFEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTI-----KSDDDFSHIIV--LVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSISPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKD---AKIFSINKLDGKVFLETDLDRES----VESLHFTTRAADSGYPKQLSTANITVIVKDINDNFPFLPKSIYLY-VLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKYEIVIEATD-RGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTV-KVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESI 2618
            Y  ++  NG +  +R+IDRD+LC  +  CC K +  C++ +++     +     S  I+   +I ++D ND+ P +         SE   +  +  L +A+D D     +  Y     I++ +LS I +  T     K  + L LK +LDRE  D+Y   + A DGG+P+  G + V + V D NDN PVFE   Y + V E+   +  + Q++A D D   N +I Y++ S        +F ++  SG +++   LDYE      LI+ A +       +T T+ +N+ ++ND  P I+ +      +A I+E E     V + +V+DKD    GKV C L+   +E F L R N P    YKI T +  DRE  SK +  IVC D+G P  +    + V + D ND  P  +  S IFHV+E+  PGT +  I+ATDKD+G+N  L+YSI       +   +I+   G +     +DRE+    +  L  +   +DSG PKQ S  +I +++ D NDN P   +S + + V EN      L Q+ V+D DE  +    ++ +         RK  + I         S  N  +       L+  ES LDRE    YE+VI ATD  G    +    + + VLD+ND  P FIFP   N T+ KV  R   G  +    A D+D       +  F  N+ +N+LF ++P +G+I + + +  S  +  + +I+ V+D+G P L    +++I I+ I
Sbjct:   66 YLHLDSNNGKLFAKRKIDRDSLCSEIELCC-KSDIICSVSVSVAMTAAQPSSKLSDPIIGKFLIVIEDRNDHKPNFEYPIFNLSISESCPVSTTFQLPLAIDKDSDKYSVKSYKF---ISKSDLS-IFSLETQFIDRKMSVYLRLKNRLDREDTDQYSLTIAAVDGGDPALTGVLVVHILVLDVNDNPPVFENTRYNVRVKESQMISDSIAQVRATDRDIGENAEIFYKLDS-------GMFRVDELSGSVYMISPLDYEKDQEYKLIITARNRIPGVNTATATLTVNVININDEKPVIFVDYFNNWQHASISEYETAPAFVCIVTVKDKDIGIAGKVQCQLDN-HHELFDL-RQNSP--GQYKIHTRQQLDRETNSKYSLSIVCKDQGTPSLSADTIIPVVILDKNDNKPEINSPS-IFHVSENKPPGTIVTKIDATDKDDGLNGKLTYSITDAQNLVSSYLTIDSQTGIIRTLQKIDREATNPPLTKLDLSVTVSDSGTPKQSSIKSIQILIDDENDNAPQFGQSTFRFSVTENEAPIYRLGQIEVSDPDETGSVRLGISFIKSN-----NRKSPFSI--------TSEKNRFW-------LMTTES-LDREELDFYELVIIATDGAGYKSHTASATVNVTVLDINDNPPIFIFPRSGNETIPKVPYRQQPGYLVLTASANDKDNLPRGNGKLYFSINSNSNNLFNIDPHNGEIRIHRQMGIS-DIGDHFIIIKVEDDGTPVLSSERQIQIKIQDI 784          
BLAST of Protocadherin-1 vs. Planmine SMEST
Match: SMESG000033799.1 (SMESG000033799.1)

HSP 1 Score: 274.633 bits (701), Expect = 1.977e-76
Identity = 236/758 (31.13%), Postives = 369/758 (48.68%), Query Frame = 3
Query:  399 FEINPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYYSI-SPEITEFELSYIINTNTMMYSNKEQXXXXXXXXXDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAV-YIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYT---TISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEP-SRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHL-EPIANEEFSLERM---NIPLTVM-YKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSI-NKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDINDNFP-FLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESG--LDREVTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESINGD 2627
            F+INP N ++ I   IDR++L            N  +  +      DF  I  L I+++DINDNSP + +     +  E  + G  + L VA D+D+G N    YSI   +   F+L  + N   +  + K           DRE+ D+YE +  A D G P   G IK+ + + D ND++P F+    Y+I V E+    + +  +K  D D E    I   I+S + PE  + F + + SG   +   LDYE+     TI +I   N + NL   +T TV  N+ D+NDN P+I  +  S  ++N K+ EN+     VA+ +V D DS  NG V C+L EP   + F L      N P +   Y+I TL+ FDRE  S     + C D+G P  ++  ++++ +ED ND  P FS+  +   + E++ PG+ +FT+ ATD D G NA + Y I  K   I SI N   G V      DRE   S+ F   A D   P   S+  +T+ ++D ND  P FL  + +  + E ++  V   +V   D D   NS+                        +    T    N L+ L  DG  I  E G  LDREV + Y++ +EA D G P +S+  I+ I + D+ND  PKF  P  S    K+    V GT I +++A D+DE +N ++ Y   +N      F+++ +SG++ + +T+ +  ++    L+++ KDNG P    TA L+++ ++ + D
Sbjct:   86 FKINPHNQIVVI-NSIDRESL------------NPVDCIVNKTKPKDF-QIFQLPIDIEDINDNSPIFDKLSYNIEIDENIQSGHIQQLPVARDSDYGINSEIIYSIEGKDKGFFKLLQMKNNKPIFKTMK---------LFDREERDRYELVFIATDKGIPKKTGEIKIYIKIRDLNDHAPEFDMPKDYVIGVKEDAIEGSKICDIKVTDKDDET--LITVLINSNSDPEVKRHFQVSAISGLTLIS-RLDYESSMRKFTIPIIAVDNGIPNLTTSTTITV--NVLDINDNFPQIVIDTLSDSSSNFKLMENKPKESFVAMVTVTDADSEMNGIVDCNLIEPNNKQNFELISRYFNNFPNSKRNYRIVTLREFDRETISHYRVTVQCKDQGLPPLSSQQTITIWIEDENDNPPSFSKFFFQDRIKENIMPGSPIFTLIATDPDIGKNAKIIYQIPEKYQNIISIPNPSTGIVTNLVSFDREMNTSITFKAFALDEFNPLLNSSVEVTLEIEDENDCIPMFLSSAYHFKIKEGYSGWVG--KVEAYDNDSNSNSD------------------------IIFSFTGFLHNHLWILKSDGN-IFSEKGIQLDREVQSTYQLTVEAKDNGVPSRSSSVIVQIQLEDINDNSPKFSQPLDSGYMKKITETLVPGTLITKVMATDDDENENGKVTYLLANNK----YFIIDEKSGEVFINRTL-DRLELVPRRLLIMAKDNGTPSFTTTATLQLLFQNEDED 783          
The following BLAST results are available for this feature:
BLAST of Protocadherin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH12.283e-8330.31protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655][more]
PCDH12.363e-8230.31protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655][more]
PCDH107.750e-7931.75protocadherin 10 [Source:HGNC Symbol;Acc:HGNC:1340... [more]
PCDH91.274e-7831.12protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH104.500e-7831.50protocadherin 10 [Source:HGNC Symbol;Acc:HGNC:1340... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmi-16.910e-5024.44FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
fmi-11.902e-4929.16FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
cdh-11.205e-3624.45CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4... [more]
hmr-12.984e-3626.25Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
hmr-12.984e-3626.25Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ft2.443e-6927.40gene:FBgn0001075 transcript:FBtr0077478[more]
ds5.511e-6529.68gene:FBgn0284247 transcript:FBtr0078045[more]
ds5.511e-6529.68gene:FBgn0284247 transcript:FBtr0343249[more]
stan1.231e-6427.70gene:FBgn0024836 transcript:FBtr0339463[more]
stan1.280e-6427.70gene:FBgn0024836 transcript:FBtr0330601[more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a1.083e-8329.99protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1a7.617e-8329.99protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
CT030123.17.885e-8230.07protocadherin 1b [Source:NCBI gene;Acc:572016][more]
pcdh10a9.054e-8231.75protocadherin 10a [Source:ZFIN;Acc:ZDB-GENE-020731... [more]
CT030123.19.206e-8230.07protocadherin 1b [Source:NCBI gene;Acc:572016][more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000038930.13.413e-8234.48pep primary_assembly:Xenopus_tropicalis_v9.1:3:190... [more]
pcdh105.554e-8131.65protocadherin 10 [Source:NCBI gene;Acc:779938][more]
pcdh106.485e-8131.65protocadherin 10 [Source:NCBI gene;Acc:779938][more]
ENSXETT00000038928.15.634e-8032.36protocadherin gamma-C5-like [Source:NCBI gene;Acc:... [more]
pcdh176.333e-7930.54protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdh11.433e-8430.46protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh11.433e-8430.46protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh108.370e-7931.75protocadherin 10 [Source:MGI Symbol;Acc:MGI:133804... [more]
Pcdh12.969e-7831.06protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdhgb83.679e-7831.53protocadherin gamma subfamily B, 8 [Source:MGI Sym... [more]
back to top
BLAST of Protocadherin-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q08174|PCDH1_HUMAN1.097e-8230.31Protocadherin-1 OS=Homo sapiens OX=9606 GN=PCDH1 P... [more]
sp|Q9P2E7|PCD10_HUMAN2.161e-7731.50Protocadherin-10 OS=Homo sapiens OX=9606 GN=PCDH10... [more]
sp|Q9HC56|PCDH9_HUMAN6.183e-7731.12Protocadherin-9 OS=Homo sapiens OX=9606 GN=PCDH9 P... [more]
sp|Q6X862|PC11X_GORGO1.433e-7530.93Protocadherin-11 X-linked OS=Gorilla gorilla goril... [more]
sp|Q71M42|PC11X_PANTR2.387e-7530.79Protocadherin-11 X-linked OS=Pan troglodytes OX=95... [more]
back to top
BLAST of Protocadherin-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2CQZ42.364e-2140.61Protocadherin-9 isoform 2 OS=Schistosoma japonicum... [more]
A0A4Z2CQW33.907e-17240.94Protocadherin-9 isoform 1 OS=Schistosoma japonicum... [more]
A0A1S8XA965.106e-17236.65Cadherin domain protein OS=Opisthorchis viverrini ... [more]
A0A419QA205.488e-17136.14Protocadherin-1 OS=Clonorchis sinensis OX=79923 GN... [more]
H2KQF76.362e-16936.30Protocadherin-1 OS=Clonorchis sinensis OX=79923 GN... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh7a1.433e-8630.31protocadherin 7a [Source:ZFIN;Acc:ZDB-GENE-120206-... [more]
pcdh1a4.278e-8329.93protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh7b2.887e-8230.14protocadherin 7 [Source:NCBI gene;Acc:103034658][more]
pcdh1a4.410e-8229.75protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh111.918e-8132.02protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh116.954e-7731.71protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
ENSPMAT00000010725.12.950e-7228.55pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 ... [more]
si:ch211-199f5.11.793e-6328.10protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660][more]
ENSPMAT00000006996.11.523e-6129.53pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 g... [more]
ENSPMAT00000008517.14.072e-5826.97pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 ... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO461896.793e-7230.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354127.744e-6628.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482376.652e-6529.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404701.177e-6229.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO464187.687e-6029.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh7b4.646e-8430.19protocadherin 7 [Source:NCBI gene;Acc:101166584][more]
pcdh7b1.511e-8330.19protocadherin 7 [Source:NCBI gene;Acc:101166584][more]
pcdh7b2.295e-8330.19protocadherin 7 [Source:NCBI gene;Acc:101166584][more]
pcdh7b2.435e-8330.19protocadherin 7 [Source:NCBI gene;Acc:101166584][more]
pcdh1b3.972e-8331.54protocadherin-1 [Source:NCBI gene;Acc:101174755][more]
back to top
BLAST of Protocadherin-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074162.10.000e+099.26SMESG000074162.1[more]
SMESG000076665.12.122e-8730.96SMESG000076665.1[more]
SMESG000059376.19.484e-8030.87SMESG000059376.1[more]
SMESG000059376.11.019e-7930.87SMESG000059376.1[more]
SMESG000033799.11.977e-7631.13SMESG000033799.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016728 ID=SMED30016728|Name=Protocadherin-1|organism=Schmidtea mediterranea sexual|type=transcript|length=3487bp
TCTTCCGATCTGGAAGACATTTCTCTTTAAAATATGCGTGCACTTAGAAG
GAAACAATTAAGCTTTAATCTATCAATAGTGGTGAGAATTAATTAATTTT
TAGCCAAATGAATTATGAAGAACACGAAAATTTCGCTTTAAAATTTCAGA
GAATGCAAATTATCAAAATATTTGTGGGATTTTGTTTTGCTTTTCAACTT
CCGGAAAACAGCTTTGAAAGTTCAAATCACAAACATTTTACAATTGATAT
ATATGAAGAACTGCCAAGAAAAACTAAAGTGATTGATTTAGGAGCACAGG
CAACGAAATGGTTTCCTACAGATGTCAATAAACTCCAAGATTTTGGAAAA
CCGATTTATAAATTTCAGTTTTTCAATTGCGAAAAATCAAGTGTATATTT
TGAGATAAATCCTTTGAATGGTGTCATAACAATTGAAAGACGAATTGACC
GAGACAACTTGTGTCATTTGGTTCCAACTTGTTGTCCAAAGAAAAATAAT
CAGTGCAATTTAGATCTAACAATAAAATCGGATGACGATTTTTCTCATAT
AATTGTTTTAGTAATTGAGGTTAAAGATATTAATGACAACTCTCCATTTT
GGAGTCAAAATGAACTTGTTACTCAGTTTTCAGAAGGTAGTGAAATAGGA
GACTCAAAATCTCTAACTGTAGCTCTTGATAATGATTTCGGTACAAATGG
AATATCGTACTATTCTATTTCTCCAGAAATCACAGAGTTTGAATTGTCTT
ATATTATTAACACAAACACAATGATGTACAGTAATAAAGAACAACTTAAA
CTTGTATTAAAAAAGAAATTAGACAGAGAAAAGATTGATAAATATGAGTT
TATTGTGAACGCATTCGACGGAGGAAATCCGAGCTTTAATGGAAGTATTA
AAGTCATAGTGGCGGTTACTGACGAAAATGACAATTCACCCGTTTTTGAA
AAAGCTGTTTACATAATTTCGGTGAATGAAAATTTACAGTCAAACACTCC
AGTCATTCAGTTGAAAGCCATAGATGCTGATAGTGAAATGAATGGGAAAA
TAGAATATCAAATAAGCTCTTTAACCAAACCAGAATACGCCAAGTTATTT
TCAATAGAATCGAATTCTGGATATATTCATGTTAGATGGGAACTCGATTA
TGAAACATATACCACAATTTCTCTAATAGTTGAAGCCAACGACATGGGCA
ACTTAAGAAGAGGAAGTACGTGTACAGTAATAATTAATATTAGAGACTTA
AATGACAATTCTCCTGAAATTTATTTTGAACCGTCAAGATTCACAAACAA
TGCCAAAATAACTGAAAATGAAGCTCCCGGAAAACTTGTAGCTGTATTTA
GTGTTCAGGATAAAGACAGTAATGAAAACGGAAAAGTAACTTGCCATTTA
GAACCGATTGCTAATGAAGAATTTTCATTAGAACGGATGAATATCCCATT
AACTGTGATGTACAAAATTTCCACTTTAAAATCTTTTGACCGAGAACAAA
AGTCAAAAGTTACTGCTCACATTGTTTGTTTTGATGAGGGAAATCCTCGA
CAAACGACAAGCGGTAGTGTTTCAGTTGGAGTAGAAGATATTAATGACGA
AGCTCCACATTTCAGCGAAAAGTCTTACATATTTCATGTAAATGAAGATG
TAAAGCCAGGCACTTATTTATTTACAATTAATGCTACTGACAAAGATGAA
GGTATAAATGCTTTACTTTCATATTCAATATTTGGAAAAGATGCAAAAAT
ATTTTCAATAAATAAATTAGATGGAAAAGTGTTTTTAGAAACTGATCTCG
ATAGAGAAAGTGTTGAAAGCTTGCATTTTACAACCAGAGCAGCAGATTCA
GGTTATCCTAAACAACTTAGTACAGCAAACATAACCGTGATTGTCAAAGA
TATTAATGATAATTTTCCTTTTCTCCCAAAATCTATTTACCTTTATGTTT
TAGAAAATCATACTGCAGATGTTCCATTAGTTCAAGTTAATGTTACAGAT
GCGGATGAAGGGCTGAATTCTGAAACCAAAGTTACTTTAGTATCTGAAAC
TGCTACGACACTTATCAAAAGGAAAGATGAATATCCTATTCAAAAACTTT
TTAGAGATGTTACAAAATCCTTTTCAAATAGCTTGTTTTCTTTACTTCCA
GACGGAAAACTTATAATTCGTGAATCAGGACTCGACAGAGAAGTAACAAC
TAAATATGAGATCGTTATAGAAGCAACAGACAGAGGAAATCCTCCAAAAT
CCACAAAAGGGATAATTTATATCAATGTATTAGATGTAAATGACTGTAAG
CCAAAATTCATATTCCCATCCGGTTCAAACAGTACCGTAAAAGTTAAACC
AAGAACTGTCTCTGGTACAACAATCGCACAAATAATAGCTATTGATGAAG
ACGAAGGCAAAAACTCGGAATTAGAATATTCATTCAAATCAAACAATCAA
ACAAATGACCTTTTCCTAATGAATCCGGAGTCCGGAAAAATATCCTTACA
ACAAACAATTCAGGAATCCCACAAGGTTTGCTGCTATGTCCTAATCGTTG
TTGTAAAAGATAACGGAATTCCTCGACTAGAAGATACAGCTCGCCTGCGA
ATTATTATTGAGTCAATAAATGGTGATTCTATACTAAGTAAAGAAAATAA
AATGAAAGATAATGTGGAATATTCAAATGAAGAAAGCGACAACTTTGATT
TTAGAATTAATAATAATGTTGTAATTATTATTGTTTTAATATGTGCTGCA
GCACTTTTCATAATAATGATGTCACTGGCTACCGCTTTACTAGTATGTCG
GAAATTTAAGCAAGATCGAAATTACTCACAAAGAGAAAGATTTCAACTTA
AACAAAATTTTAGAATTTGGAAAAGTAATGTGAAAAAATCATTTATTAAC
AAACGTCAGCAAGAATTAAACCAAGTTGAACCGGTATCAGGCCAGTCTTT
GATACAGAAAAATATGAATAATGAAGATCGACTGCAAATAAATTCTGTCA
ATAAATCAAATCATAGCTATTTTCTAAATCCATTGACACTTGAATACAAC
CCAAATTCTTCAACTATTGAAAATAAAGATTTACCCATAAATCTACAAAA
ATATTCTACAAGACAATTTGGAGAATTTCAAAATGAAATCTTAATTCCTG
GAGTAAGCACTTATTTCGACTATAATCACTCTTCAGGTGAAACAGACAAT
AAAAAACAGAATTTAGAAGTCATGACTTCTAAAAGTCCACTTTCACTGTC
ATTTATTGACTCAAGTTCCAGTAAAAATTGTGCTTTTCCGGCTCAATTTC
AAACATTTACTCCGCATTTCCTATCTGGATGCAATGTCTAAGCTAATGAT
AAGAAACAGAAACGAGGAATTCATTTCTTATAAACTTGGAAATATAAAGT
GATGAATATTTAAAGCTATGAATGACAATTTAAATTTATATAGTTGTATT
GTCTTGTTTTGAAATACAGTAGTTAATTAAAAAAAAA
back to top

protein sequence of SMED30016728-orf-1

>SMED30016728-orf-1 ID=SMED30016728-orf-1|Name=SMED30016728-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1078bp
MNYEEHENFALKFQRMQIIKIFVGFCFAFQLPENSFESSNHKHFTIDIYE
ELPRKTKVIDLGAQATKWFPTDVNKLQDFGKPIYKFQFFNCEKSSVYFEI
NPLNGVITIERRIDRDNLCHLVPTCCPKKNNQCNLDLTIKSDDDFSHIIV
LVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGIS
YYSISPEITEFELSYIINTNTMMYSNKEQLKLVLKKKLDREKIDKYEFIV
NAFDGGNPSFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVI
QLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYET
YTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAK
ITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTV
MYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAP
HFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFS
INKLDGKVFLETDLDRESVESLHFTTRAADSGYPKQLSTANITVIVKDIN
DNFPFLPKSIYLYVLENHTADVPLVQVNVTDADEGLNSETKVTLVSETAT
TLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDREVTTKY
EIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIFPSGSNSTVKVKPRT
VSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQT
IQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESINGDSILSKENKMK
DNVEYSNEESDNFDFRINNNVVIIIVLICAAALFIIMMSLATALLVCRKF
KQDRNYSQRERFQLKQNFRIWKSNVKKSFINKRQQELNQVEPVSGQSLIQ
KNMNNEDRLQINSVNKSNHSYFLNPLTLEYNPNSSTIENKDLPINLQKYS
TRQFGEFQNEILIPGVSTYFDYNHSSGETDNKKQNLEVMTSKSPLSLSFI
DSSSSKNCAFPAQFQTFTPHFLSGCNV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR002126Cadherin-like_dom
IPR020894Cadherin_CS
IPR015919Cadherin-like_sf
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002126Cadherin-likePRINTSPR00205CADHERINcoord: 353..365
score: 33.21
coord: 96..115
score: 32.66
coord: 280..309
score: 35.66
coord: 367..386
score: 37.76
coord: 554..580
score: 27.5
coord: 588..605
score: 43.55
coord: 500..513
score: 38.71
IPR002126Cadherin-likeSMARTSM00112CA_2coord: 524..604
e-value: 6.3E-23
score: 92.2
coord: 70..163
e-value: 0.67
score: 5.6
coord: 414..500
e-value: 1.1E-11
score: 54.9
coord: 187..278
e-value: 1.6E-11
score: 54.3
coord: 627..732
e-value: 6.0E-17
score: 72.3
coord: 302..386
e-value: 1.6E-22
score: 90.8
coord: 759..842
e-value: 3.8E-8
score: 43.1
IPR002126Cadherin-likePFAMPF00028Cadherincoord: 507..596
e-value: 1.7E-17
score: 63.6
coord: 172..271
e-value: 5.4E-8
score: 33.2
coord: 745..834
e-value: 9.9E-12
score: 45.2
coord: 285..378
e-value: 5.4E-19
score: 68.4
coord: 615..725
e-value: 2.9E-9
score: 37.2
coord: 398..492
e-value: 5.6E-10
score: 39.5
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 44..158
e-value: 2.5E-9
score: 39.2
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 387..497
e-value: 5.9E-22
score: 80.2
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 498..604
e-value: 1.3E-30
score: 108.2
coord: 159..275
e-value: 5.4E-20
score: 73.9
coord: 605..732
e-value: 8.2E-18
score: 66.9
coord: 276..386
e-value: 2.7E-31
score: 110.4
coord: 733..841
e-value: 1.5E-18
score: 69.3
NoneNo IPR availablePANTHERPTHR24028FAMILY NOT NAMEDcoord: 563..972
coord: 48..645
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 166..280
score: 20.196
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 281..388
score: 25.326
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 40..165
score: 12.501
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 393..502
score: 18.398
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 606..734
score: 20.547
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 503..606
score: 25.457
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 738..847
score: 16.25
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 506..602
e-value: 7.70553E-30
score: 112.022
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 398..497
e-value: 8.96752E-18
score: 77.3537
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 743..838
e-value: 9.29428E-19
score: 80.4353
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 175..276
e-value: 6.06215E-12
score: 60.7901
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 97..161
e-value: 1.52956E-4
score: 39.9894
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 284..384
e-value: 5.12414E-30
score: 112.407
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 609..729
e-value: 6.89581E-18
score: 77.7389
NoneNo IPR availableTMHMMTMhelixcoord: 873..895
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 594..604
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 268..278
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 381..494
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 158..272
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 594..737
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 268..401
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 490..613
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 722..843