Protein kinase domain-containing protein

Overview
NameProtein kinase domain-containing protein
Smed IDSMED30016722
Length (bp)4549
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase domain-containing protein (SMED30016722) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30016722) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase domain-containing protein (SMED30016722) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30016722) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016722

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30016722SMESG000004938.1 Contig1959GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
cephalic gangliaSMED30016722SMESG000004938.1 dd_Smed_v4_4849_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30016722SMESG000004938.1 dd_Smed_v4_4849_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30016722SMESG000004938.1 dd_Smed_v4_4849_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30016722SMESG000004938.1 dd_Smed_v4_4849_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016722SMESG000004938.1 Contig38582uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016722SMESG000004938.1 Contig38582newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016722SMESG000004938.1 Contig15391newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016722SMESG000004938.1 Contig15391uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016722SMESG000004938.1 Contig44284newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016722SMESG000004938.1 Contig44284uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016722SMESG000062279.1 SMESG000051837.1 SMESG000037491.1 SMESG000004938.1 Contig49798uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016722SMESG000062279.1 SMESG000051837.1 SMESG000037491.1 SMESG000004938.1 Contig49798newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parenchymal cellSMED30016722SMESG000004938.1 dd_Smed_v6_4849_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K5 (mitogen-activated protein kinase kinase kinase 5 [Source:HGNC Symbol;Acc:HGNC:6857])

HSP 1 Score: 711.835 bits (1836), Expect = 0.000e+0
Identity = 470/1392 (33.76%), Postives = 728/1392 (52.30%), Query Frame = 1
Query:   79 CNDAQLYDYRKSAYDELEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKK--------TAGNSVTIILYNVNEKGRVGVLETQCMIA----MMTDNEDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRSREVLNFWLEFFENTIHDCEEEVKQTQEENPNNIWSAKRRKSSVTPKVILTSSTRTETTIHDAAVNDEVNQIGDTEDCQNLDRRVMYPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKSEVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLK-KNGAL--TEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELI-KGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKARNQKNDITIPDKFDHRLMSNIERSSTLTKVIKENKQGCFSAPPMDVSNSVPQNIRPISNRKRGQLLSIDLLLVIHMKTNKRFRSDESISDGNSFYSPDPPXXXXXXXXXXXXLETPSVGAFYMLRKETEARSELHKILKSVRNNVVSYWRELILEDDLKP-LTYNHSCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANILFKAGIFRLFDADPQTPAESHYLKPFCQTNENTKFSDRRPLSRSTGITGADSNPHENDFHVSAMIVDDLTTNDIWQ-PPFMNFDFKN-------ELVKLQNENNKLLQDLCETTSEYNRHLKHCISEKKNHIDYLRATLGEKLITXXXXXXXXXXXXXXEN--LKNWLNEIGXXXXXXXXXXNEEYTFHEFLYFISKEDLYKLQLKGGVV 4173
             +  QL      A   L + C      +L  + F  LD+  T VLD FYNAD+ +++MS   +Q +L +HLGVRE+  M  NIIL     D+  ++++SLK+          GN  T + Y +    +V   ++  M      M  + E L   +C     L  +   LLK  +     + +E  LND+R+ R   T +EL  ++  + +R+D+ E+L+ +I++N++LSYR IQ YD IV L+E+L    T   + +  H+++HYAFALNRRN  G+R KAL ++    +     V  DM  LVGRIYKD+F+ S +TD ++ +   SW++K F+ +P    GINYA LL+  G+Q   S EL ++ + L+  +G KG + +L  YW+V  F   SVLA D+ + +QA+E +FKL+ P W LKS +  I +   F K     PV++ +E+++FW++F                                      L  +T+T+ T+                        V +PVL+ +   I QP++L +N   + K+I +W+  P ++ + + +W F+   ++G+S+SK  +   FLYV+  +DDF ++F +    ++F+ +V +     +E+         ES+ ++++YEYD+N  R+VLG+GT+G V+AGR+L+ Q++IAIKE+ E   +  QPLHEEI LH  L H+NIV YLGS SE G  KI MEQVPGGSL++LL+ K G L   E+T  +Y+ QILEGLKYLHDN+I+HRDIKGDNVL+N Y+G+LKISDFGTSKRL  I     TFTGT+QYMAPE+I KGP GYG  AD+WS GCT+IEM TGKPPF +LG P AA+FKVG F  HP+ P+ +S EA  F+ KCF PDP+KRA    LL   FL+ +       KK + Q     +    +  L S       L +    + +    +P  ++       + P S + R +  S     V  ++T      DE+  D ++  SP                E    G F MLRK++E R+ LH+IL   ++ +V    E + +   +P L + H   L+  + +    ++   D++ +   L +L+   D+     S+ Q++++  + A+   LR H  KPH + A D II  AV  A  IL            P+       L+P       +  +D+  L          SN  +      A+I D + T+ +      ++ D ++       +L +++ E N+LL++L     E    L   I EK   I +L+       I +  +    SS  + E+  L +WL   G     IS  + E+YT  + LY+++++DL  L+L+GG++
Sbjct:  100 ASQGQLVVAESEALQSLREACETVG-ATLETLHFGKLDFGETTVLDRFYNADIAVVEMSDAFRQPSLFYHLGVRESFSMANNIILY---CDTNSDSLQSLKEIICQKNTMCTGN-YTFVPYMITPHNKVYCCDSSFMKGLTELMQPNFELLLGPIC---LPLVDRFIQLLKVAQASSSQYFRESILNDIRKARNLYTGKELAAELARIRQRVDNIEVLTADIVINLLLSYRDIQDYDSIVKLVETLEKLPTFD-LASHHHVKFHYAFALNRRNLPGDRAKALDIMIPMVQS-EGQVASDMYCLVGRIYKDMFLDSNFTDTESRDHGASWFKKAFESEPTLQSGINYAVLLLAAGHQFESSFELRKVGVKLSSLLGKKGNLEKLQSYWEVGFFLGASVLANDHMRVIQASEKLFKLKTPAWYLKSIVETILIYKHFVKLTTEQPVAK-QELVDFWMDF--------------------------------------LVEATKTDVTV------------------------VRFPVLILEPTKIYQPSYLSINNEVEEKTISIWHVLPDDK-KGIHEWNFSASSVRGVSISKFEERCCFLYVLHNSDDFQIYFCTELHCKKFFEMVNTIT---EEKGRSTEEGDCESDLLEYDYEYDENGDRVVLGKGTYGIVYAGRDLSNQVRIAIKEIPERDSRYSQPLHEEIALHKHLKHKNIVQYLGSFSENGFIKIFMEQVPGGSLSALLRSKWGPLKDNEQTIGFYTKQILEGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTETFTGTLQYMAPEIIDKGPRGYGKAADIWSLGCTIIEMATGKPPFYELGEPQAAMFKVGMFKVHPEIPESMSAEAKAFILKCFEPDPDKRACANDLLVDEFLKVS------SKKKKTQPKLSALSAGSNEYLRSISLPVPVLVEDTSSSSEYGSVSPDTEL------KVDPFSFKTRAK--SCGERDVKGIRTLFLGIPDENFEDHSAPPSP----------------EEKDSGFF-MLRKDSERRATLHRILTEDQDKIVRNLMESLAQGAEEPKLKWEHITTLIASLRE----FVRSTDRKIIATTLSKLKLELDFDSHGISQVQVVLFGFQDAVNKVLRNHNIKPHWMFALDSIIRKAVQTAITILV-----------PE-------LRPHFSLASESDTADQEDLDVEDDHEEQPSN--QTVRRPQAVIEDAVATSGVSTLSSTVSHDSQSAHRSLNVQLGRMKIETNRLLEELVRKEKELQALLHRAIEEKDQEIKHLKLKSQPIEIPELPVFHLNSSGTNTEDSELTDWLRVNGADEDTISRFLAEDYTLLDVLYYVTRDDLKCLRLRGGML 1359          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K15 (mitogen-activated protein kinase kinase kinase 15 [Source:HGNC Symbol;Acc:HGNC:31689])

HSP 1 Score: 483.797 bits (1244), Expect = 2.820e-146
Identity = 313/876 (35.73%), Postives = 465/876 (53.08%), Query Frame = 1
Query: 1639 YPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKSEVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLK-KNGALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELI-KGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKARNQKNDITIPDKFDHRLMSNIERSSTLTKVIKENKQGCFSAPPMDVSNSVPQNIRPISN--------RKRGQLLSIDLLLVIHMKTNKRFRSDESISDGNSFYSPDPPXXXXXXXXXXXXLETPSVGAFYMLRKETEARSELHKILKSVRNNVVSYWRELILEDDLK-PLTYNHSCNLLELIMDLFL---NYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANILFKAGIFRLFDADPQTPAESHYLKPFCQTNENTKFSD--RRPLSRSTGITGADSNPHENDFHVSAMIVDDLTTNDIWQPPFMNFDFKNELVKLQNENNKLLQDLCETTSEYNRHLKHCISEKKNHIDYLRATLGEKLITXXXXXXXXXXXXXXENLKNWLNEIGXXXXXXXXXXNEEYTFHEFLYFISKEDLYKLQLKGGVVLKILAAIERKKKELE 4218
            +PVLV +   + QP+++ +N  ++ +++ LW+  P+E ++ + +W FT   IKGISLSK  +   FLYV   +DDF ++F +      F+++VK  + +     + +  +  + + +++EY++D N +R+VLG+GT+G V+AGR+L+ Q++IAIKE+ E   +  QPLHEEI LH  L HRNIV YLGS SE G  KI MEQVPGGSL++LL+ K G + E T  +Y+ QILEGLKYLH+N+I+HRDIKGDNVLVN Y+G++KISDFGTSKRL  +     TFTGT+QYMAPE+I +GP GYG PAD+WS GCT+IEM T KPPF++LG P AA+FKVG F  HP+ P+ LS EA  F+  CF PDP+KRAT   LL   FL+   K          +KN I        R +           V+    QG     PM  S+S   ++ P S+        R R     +  LL +          DES +  +   +  P              E    G F +LRK++E R+ L+KIL   +N V S  +E + +   +  L+  H   ++ ++ D      + ++     KLK DL       D+     S+  L+++  + A+   LR H+ +PH + A D II  AV  A  IL               P    + +P C+T    K  D        +TG  G ++ PH+   H+S                        +L +L+ E N+LL+ L E   EY   L+  + +K   + +L+  L    IT     +      +D+ L +WL   G  +  I  IV E YT  + L  I+KEDL  L+L+GG++ ++ +A+ + ++  E
Sbjct:  529 FPVLVIEPTKVYQPSYVSINNEAEERTVSLWHVSPTE-MKQMHEWNFTASSIKGISLSKFDERCCFLYVHDNSDDFQIYFSTEEQCSRFFSLVKEMITNTAGSTVELEGE-TDGDTLEYEYDHDANGERVVLGKGTYGIVYAGRDLSNQVRIAIKEIPERDSRYSQPLHEEIALHKYLKHRNIVQYLGSVSENGYIKIFMEQVPGGSLSALLRSKWGPMKEPTIKFYTKQILEGLKYLHENQIVHRDIKGDNVLVNTYSGVVKISDFGTSKRLAGVNPCTETFTGTLQYMAPEIIDQGPRGYGAPADIWSLGCTIIEMATSKPPFHELGEPQAAMFKVGMFKIHPEIPEALSAEARAFILSCFEPDPHKRATTAELLREGFLRQVNK---------GKKNRIAFKPSEGPRGV-----------VLALPTQG----EPMATSSSEHGSVSPDSDAQPDALFERTRAPRHHLGHLLSV---------PDESSALEDRGLASSP--------------EDRDQGLF-LLRKDSERRAILYKILWEEQNQVASNLQECVAQSSEELHLSVGHIKQIIGILRDFIRSPEHRVMATTISKLKVDL-------DFDSSSISQIHLVLFGFQDAVNKILRNHLIRPHWMFAMDNIIRRAVQAAVTILI--------------PELRAHFEPTCETEGVDKDMDEAEEGYPPATG-PGQEAQPHQQ--HLSL-----------------------QLGELRQETNRLLEHLVEKEREYQNLLRQTLEQKTQELYHLQLKLKSNCIT--ENPAGPYGQRTDKELIDWLRLQGADAKTIEKIVEEGYTLSDILNEITKEDLRYLRLRGGLLCRLWSAVSQYRRAQE 1305          

HSP 2 Score: 303.908 bits (777), Expect = 8.941e-84
Identity = 178/445 (40.00%), Postives = 260/445 (58.43%), Query Frame = 1
Query:  127 LEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMD-----STKETIESLKKTAGNSVTIILYNVNEKGRVGVLETQCMIA----MMTDNEDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRS--REVLNFWLE-FFENT 1425
            L + C  A+   L  + F  LD+  T VLD FY+AD+ ++DMS   +Q +L +HLGVRE+  M  N+IL YH  D     S K+ +      +  +   I Y V         E+         M  + +++   +C     L  +  +LLK++ V    + KE  LND+R+ RE+   EEL +++  +  R+D+ E+L+++II+N++LSYR IQ YD +V L+E+L    T   + +  +I++HYAFALNRRN  G+REKAL ++ +  +   D   PDM  L GRIYKDIF+ S   D  + + A  WY KGF+LQ + Y GIN A LL++ G Q   S EL +I + LN  +G KG++ ++ +YWDV  FF VS+LA D  KAVQAAE +FKL+PPVW L+S + N+ LI  F+K    T +  S  +E LNFWL+  FE T
Sbjct:   87 LLRACE-AEGAHLTSVPFGELDFGETAVLDAFYDADVAVVDMSDVSRQPSLFYHLGVRESFDMANNVIL-YHDTDADTALSLKDMVTQKNTASSGNYYFIPYIVTPCADYFCCESDAQRRASEYMQPNWDNILGPLC---MPLVDRFISLLKDIHVTSCVYYKETLLNDIRKAREKYQGEELAKELARIKLRMDNTEVLTSDIIINLLLSYRDIQDYDAMVKLVETLEMLPTCD-LADQHNIKFHYAFALNRRNSTGDREKALQIMLQVLQS-CDHPGPDMFCLCGRIYKDIFLDSDCKDDTSRDSAIEWYRKGFELQSSLYSGINLAVLLIVAGQQFETSLELRKIGVRLNSLLGRKGSLEKMNNYWDVGQFFSVSMLAHDVGKAVQAAERLFKLKPPVWYLRSLVQNLLLIRRFKK----TIIEHSPRQERLNFWLDIIFEAT 520          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K6 (mitogen-activated protein kinase kinase kinase 6 [Source:HGNC Symbol;Acc:HGNC:6858])

HSP 1 Score: 373.629 bits (958), Expect = 2.281e-107
Identity = 194/392 (49.49%), Postives = 254/392 (64.80%), Query Frame = 1
Query: 1645 VLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKSEVL----SGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLKKN-GAL--TEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELI-KGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKS 2796
            VLV +   +L PA L+V     + ++ L    P E     S WTF    I G+S SK  +   FLY +  A D  L FPS    + F  ++++ V     +   E    + +M+E     F+YEY +  +R+VLG+GT+G V+AGR+   +++IAIKE+ E   +  QPLHEEI LH RL H+NIV YLGS S+ G  KI ME+VPGGSL+SLL+   G L   E T S+Y+ QIL+GL YLHDN I+HRDIKGDNVL+N ++G+LKISDFGTSKRL  I     TFTGT+QYMAPE+I +GP GYG  AD+WS GCTVIEM TG+PPF++LG+P AA+F+VG +  HP  P  LS EA  FL + F PDP  RA+  +LL  PFLQ  ++S
Sbjct:  519 VLVLEMNKVLLPAKLEVRGTDPVSTVTLSLLEP-ETQDIPSSWTFPVASICGVSASKRDERCCFLYALPPAQDVQLCFPSVGHCQWFCGLIQAWVTNPDSTAPAEEAEGAGEMLE-----FDYEYTETGERLVLGKGTYGVVYAGRDRHTRVRIAIKEIPERDSRFSQPLHEEIALHRRLRHKNIVRYLGSASQGGYLKIFMEEVPGGSLSSLLRSVWGPLKDNESTISFYTRQILQGLGYLHDNHIVHRDIKGDNVLINTFSGLLKISDFGTSKRLAGITPCTETFTGTLQYMAPEIIDQGPRGYGKAADIWSLGCTVIEMATGRPPFHELGSPQAAMFQVGMYKVHPPMPSSLSAEAQAFLLRTFEPDPRLRASAQTLLGDPFLQPGKRS 904          

HSP 2 Score: 248.054 bits (632), Expect = 5.414e-66
Identity = 145/426 (34.04%), Postives = 222/426 (52.11%), Query Frame = 1
Query:  163 LVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKKTAGNSVTIILYNVNEKGRVGVLETQCMIAMMTDNEDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRSREVLNFWLEFFENTIHDCE 1440
            L  + F TL+   T  LD FYNAD+V+L++S  + Q +L +HLGVRE+  M  N++L      +    +++L+   G S T+I Y V   GRV   +   +  +            + L  L  +L  LL+        + +E    D+R+ RE  +  +L+Q++  + RRLD  ELLS +II+N++LSYR +Q Y  I+ L+E+L    T   +    ++ +HY FALNRRN+ G+R KALSV+    +    SV PD+  + GRIYKD+F +S + D     +A  WY K F ++P+ + GIN A LL+  G     S+EL  I + L   +  KG + ++  YWDV  +    +LA D  + V AAE ++KL  P+W L S +    L   FR      P        +FWL F    +  C+
Sbjct:   91 LRSLPFGTLELGDTAALDAFYNADVVVLEVSSSLVQPSLFYHLGVRESFSMTNNVLLCSQ---ADLPDLQALRDCVG-SYTLIPYVVTATGRVLCGDAGLLRGLADGLVQAGVGTEALLTPLVGRLARLLEATPTDSCGYFRETIRRDIRQARERFSGPQLRQELARLQRRLDSVELLSPDIIMNLLLSYRDVQDYSAIIELVETLQALPTC-DVAEQHNVCFHYTFALNRRNRPGDRAKALSVLLPLVQ-LEGSVAPDLYCMCGRIYKDMFFSSGFQDAGHREQAYHWYRKAFDVEPSLHSGINAAVLLIAAGQHFEDSKELRLIGMKLGCLLARKGCVEKMQYYWDVGFYLGAQILANDPTQVVLAAEQLYKLNAPIWYLVSVMETFLLYQHFRP--TPEPPGGPPRRAHFWLHFL---LQSCQ 505          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K6 (mitogen-activated protein kinase kinase kinase 6 [Source:HGNC Symbol;Acc:HGNC:6858])

HSP 1 Score: 373.629 bits (958), Expect = 2.884e-107
Identity = 194/392 (49.49%), Postives = 254/392 (64.80%), Query Frame = 1
Query: 1645 VLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKSEVL----SGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLKKN-GAL--TEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELI-KGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKS 2796
            VLV +   +L PA L+V     + ++ L    P E     S WTF    I G+S SK  +   FLY +  A D  L FPS    + F  ++++ V     +   E    + +M+E     F+YEY +  +R+VLG+GT+G V+AGR+   +++IAIKE+ E   +  QPLHEEI LH RL H+NIV YLGS S+ G  KI ME+VPGGSL+SLL+   G L   E T S+Y+ QIL+GL YLHDN I+HRDIKGDNVL+N ++G+LKISDFGTSKRL  I     TFTGT+QYMAPE+I +GP GYG  AD+WS GCTVIEM TG+PPF++LG+P AA+F+VG +  HP  P  LS EA  FL + F PDP  RA+  +LL  PFLQ  ++S
Sbjct:  527 VLVLEMNKVLLPAKLEVRGTDPVSTVTLSLLEP-ETQDIPSSWTFPVASICGVSASKRDERCCFLYALPPAQDVQLCFPSVGHCQWFCGLIQAWVTNPDSTAPAEEAEGAGEMLE-----FDYEYTETGERLVLGKGTYGVVYAGRDRHTRVRIAIKEIPERDSRFSQPLHEEIALHRRLRHKNIVRYLGSASQGGYLKIFMEEVPGGSLSSLLRSVWGPLKDNESTISFYTRQILQGLGYLHDNHIVHRDIKGDNVLINTFSGLLKISDFGTSKRLAGITPCTETFTGTLQYMAPEIIDQGPRGYGKAADIWSLGCTVIEMATGRPPFHELGSPQAAMFQVGMYKVHPPMPSSLSAEAQAFLLRTFEPDPRLRASAQTLLGDPFLQPGKRS 912          

HSP 2 Score: 247.284 bits (630), Expect = 9.850e-66
Identity = 144/430 (33.49%), Postives = 220/430 (51.16%), Query Frame = 1
Query:  163 LVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHG----MDSTKETIESLKKTAGNSVTIILYNVNEKGRVGVLETQCMIAMMTDNEDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRSREVLNFWLEFFENTIHDCE 1440
            L  + F TL+   T  LD FYNAD+V+L++S  + Q +L +HLGVRE+  M  N++L        + + +E +         S T+I Y V   GRV   +   +  +            + L  L  +L  LL+        + +E    D+R+ RE  +  +L+Q++  + RRLD  ELLS +II+N++LSYR +Q Y  I+ L+E+L    T   +    ++ +HY FALNRRN+ G+R KALSV+    +    SV PD+  + GRIYKD+F +S + D     +A  WY K F ++P+ + GIN A LL+  G     S+EL  I + L   +  KG + ++  YWDV  +    +LA D  + V AAE ++KL  P+W L S +    L   FR      P        +FWL F    +  C+
Sbjct:   91 LRSLPFGTLELGDTAALDAFYNADVVVLEVSSSLVQPSLFYHLGVRESFSMTNNVLLCSQADLPDLQALREDVFQKNSDCVGSYTLIPYVVTATGRVLCGDAGLLRGLADGLVQAGVGTEALLTPLVGRLARLLEATPTDSCGYFRETIRRDIRQARERFSGPQLRQELARLQRRLDSVELLSPDIIMNLLLSYRDVQDYSAIIELVETLQALPTC-DVAEQHNVCFHYTFALNRRNRPGDRAKALSVLLPLVQ-LEGSVAPDLYCMCGRIYKDMFFSSGFQDAGHREQAYHWYRKAFDVEPSLHSGINAAVLLIAAGQHFEDSKELRLIGMKLGCLLARKGCVEKMQYYWDVGFYLGAQILANDPTQVVLAAEQLYKLNAPIWYLVSVMETFLLYQHFRP--TPEPPGGPPRRAHFWLHFL---LQSCQ 513          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K15 (mitogen-activated protein kinase kinase kinase 15 [Source:HGNC Symbol;Acc:HGNC:31689])

HSP 1 Score: 240.736 bits (613), Expect = 7.339e-71
Identity = 127/276 (46.01%), Postives = 183/276 (66.30%), Query Frame = 1
Query:  604 DLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKP-EDNTPVSRSREVLNFWLE-FFENT 1425
            D+R+ RE+   EEL +++  +  R+D+ E+L+++II+N++LSYR IQ YD +V L+E+L    T   + +  +I++HYAFALNRRN  G+REKAL ++ +  +   D   PDM  L GRIYKDIF+ S   D  + + A  WY KGF+LQ + Y GIN A LL++ G Q   S EL +I + LN  +G KG++ ++ +YWDV  FF VS+LA D  KAVQAAE +FKL+PPVW L+S + N+ LI  F+K   +++P    +E LNFWL+  FE T
Sbjct:    2 DIRKAREKYQGEELAKELARIKLRMDNTEVLTSDIIINLLLSYRDIQDYDAMVKLVETLEMLPTCD-LADQHNIKFHYAFALNRRNSTGDREKALQIMLQVLQS-CDHPGPDMFCLCGRIYKDIFLDSDCKDDTSRDSAIEWYRKGFELQSSLYSGINLAVLLIVAGQQFETSLELRKIGVRLNSLLGRKGSLEKMNNYWDVGQFFSVSMLAHDVGKAVQAAERLFKLKPPVWYLRSLVQNLLLIRRFKKTIIEHSP---RQERLNFWLDIIFEAT 272          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: nsy-1 (Mitogen-activated protein kinase kinase kinase nsy-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21029])

HSP 1 Score: 379.407 bits (973), Expect = 1.105e-108
Identity = 271/846 (32.03%), Postives = 406/846 (47.99%), Query Frame = 1
Query: 1639 YPVLVSDSEGILQPAFLQVN------------INSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKS--EVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSR-----SEKGVFKIIMEQVPGGSLTSLLK-KNGALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELI-KGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSL----------------HKKKKARNQKNDITIPDKFDH-RLMSNIERSSTLTKVIKENKQGCFSAPPMDVSNSVPQNIRPISNRKRGQLLSIDLLLVIHMKTNKRFRSDESISDGNS----------FYSPDPPXXXXXXXXXXXXLETP----SVGA----------------------FYMLRKETEARSELHKILKSVRNNVVSYWRELILEDDLKPLTYNHSCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANILFKAGIFRLFDADPQTPAESHYLKPFCQT-NENTKFSDRRPLSRSTGITGADSNPHENDFHVSAMIVDDLTTNDIWQPPFMNFDFKNELVKLQNENNKLLQDLCETTSEYNRHLKHCISEKKNHIDY 3951
            YPVL+ +      P++L +N             NS  K I     H SE LR +  W F  + IK ++ SK     LFLYV   +DDF+L FP+ +  ++ Y+ +KS  +V  G  +  ++S+   ++E I+FEYE  ++++R+VLG+GT+GTV+A R++  Q +I +KE+     +EVQPL EEI LHS L H NIV YLG            F I ME VPGGSL+SLL+ K G + E   +YY  QILEGLKYLH+ +I+HRDIKGDNVLVN Y+G+ KISDFGT KRL  +     TFTGT+QYMAPE+I  G  GYG PAD+WSFGCT++EM TG+PPF ++  P AA+F+VG F  HP  P  ++ +  +F++ CF+P+   R +   LL  PF+     S                 H K+K    KN   +     H   M  +ERS    + +       FS     V +    N    +  ++   L ID     H + N+ F S   + DG S          F    P S       +   + +P    ++G+                      F+ML+K++E R  L + ++  ++ ++  W  L+++     L    +  +LE+++D   ++LL  D  K++  +  +R   DY      +  L +Y    +I+  LR+   KPH + A   +I +AV  A +IL    +  L  A    P+ S  +     + +E     + RP SR   +                                   + + EL  LQ EN  L++ L +   E N  LK  I+      D+
Sbjct:  519 YPVLILELNKEFTPSYLTLNNEEGTVILSHVLENSQQKKI-----HQSE-LRGIHRWHFARNNIKAVTESKRDDRQLFLYVHENSDDFNLLFPTKAHCKKAYDDMKSMADVADGNYQGRVLSNP--DNEKIRFEYELSNSNERVVLGKGTYGTVYAARDMDTQRQIVVKEIEVKYDEEVQPLMEEISLHSTLCHANIVQYLGCDLVGKDGSNDHFLIFMEHVPGGSLSSLLRSKWGPMNENAMNYYGKQILEGLKYLHELKIVHRDIKGDNVLVNTYSGVCKISDFGTCKRLAGLNPVTETFTGTLQYMAPEVIDHGQRGYGAPADIWSFGCTMVEMATGRPPFVEMQNPQAAMFRVGMFKTHPPIPTEITEKCRNFIKSCFLPEACDRPSAKDLLQDPFIYHNHHSTRSGSINKKPATKIELNHDKEKKEKSKNQREMLRSTSHIGGMGVVERSPPTPEPMSATLTAGFS----HVHSQTVSNALSTAREEKKLHLKID-----HAR-NRTFSSSSPVPDGQSSAGTNMSHPGFQLSQPSSPIVDDTNHPHLIVSPISLNTMGSPLSSAALLNRTISDESSNSSSRFFMLQKDSERRRSLGQFMQDYKDLIIDSWSTLLIKQSDTELVV--TVYMLEMLLDGMRDFLLKKDNTKMQKMIDDIRGLLDYDTAKIGQINLALYHFSDSIQPVLRRLDIKPHWMFALSNLITSAVQCAISIL-SPDLSLLLHAQDNLPSTSSIVAIRNSSLSEGEALIESRPPSREERVR----------------------------------EDRKELRTLQEENEILIERLLQVERELNAQLKSGITRANRFRDF 1309          

HSP 2 Score: 321.242 bits (822), Expect = 2.421e-89
Identity = 174/449 (38.75%), Postives = 268/449 (59.69%), Query Frame = 1
Query:  106 RKSAYDELEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKKTAGNSVTIILYNVNEKGRVGVLETQCMIAMMTDNED------LKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADS------VFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRSREVLNFWLEFF 1416
            R+ A  +++KV +  + V+L RI F  LD+  TE LD FYNAD+ ++D+++  QQ +L +H+GVRE++G   N+IL Y   D     +++LKKT  +   I+  +  +  ++   +         +N+D       ++ V +   +   +++ +LK V+V   AH +EKF++DLR+ RE    ++    +  M  RLD+P++L  + +  M+LSYR  Q Y  ++ L++ L       K+++T  I+Y YAFALNRRNK G+R+ AL+ +    E   ++      + PD+V L GRIYKD F+AS Y D+++LN A  WY + F++ P EY GIN  TLL   G     + E+ QI + LN  +G KGA+  L +YWDVAT+FEVSVLAE+Y KA +AA  M KL+PPVW LKST+ NIKLI+  R     +P+ + ++   FW EFF
Sbjct:   66 REMALKDVQKVADTLN-VNLTRIDFDKLDFGETETLDLFYNADVALVDVTVTHQQPSLCYHIGVRESMGQSYNMILTYWSPDPEYHIMDALKKTHAHLPMIVYIHHQDSNQLQSYDK-------NNNDDDSKPPFARTNVPAKTITFQHRMKQVLKSVQVEASAHSREKFMSDLRKAREITDGDQKNDYLDKMRTRLDNPDVLHPDTVSLMMLSYRDNQNYGGMIRLVDDLKRIPDCLKVVDTPVIRYQYAFALNRRNKDGDRDLALNTVLSLVEGTTENEEKNGPLSPDVVCLAGRIYKDKFIASNYEDRESLNSAIEWYRRAFEMSPLEYSGINLTTLLRASGEHFENNLEMQQIAVVLNSLLGRKGALQNLMEYWDVATYFEVSVLAENYQKACEAALMMVKLKPPVWYLKSTMENIKLIN--RCAATISPIEKEKQQFLFWSEFF 504          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: nsy-1 (Mitogen-activated protein kinase kinase kinase nsy-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21029])

HSP 1 Score: 379.022 bits (972), Expect = 1.668e-108
Identity = 271/849 (31.92%), Postives = 407/849 (47.94%), Query Frame = 1
Query: 1639 YPVLVSDSEGILQPAFLQVN------------INSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKS--EVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSR-----SEKGVFKIIMEQVPGGSLTSLLK-KNGALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELI-KGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSL-------------------HKKKKARNQKNDITIPDKFDH-RLMSNIERSSTLTKVIKENKQGCFSAPPMDVSNSVPQNIRPISNRKRGQLLSIDLLLVIHMKTNKRFRSDESISDGNS----------FYSPDPPXXXXXXXXXXXXLETP----SVGA----------------------FYMLRKETEARSELHKILKSVRNNVVSYWRELILEDDLKPLTYNHSCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANILFKAGIFRLFDADPQTPAESHYLKPFCQT-NENTKFSDRRPLSRSTGITGADSNPHENDFHVSAMIVDDLTTNDIWQPPFMNFDFKNELVKLQNENNKLLQDLCETTSEYNRHLKHCISEKKNHIDY 3951
            YPVL+ +      P++L +N             NS  K I     H SE LR +  W F  + IK ++ SK     LFLYV   +DDF+L FP+ +  ++ Y+ +KS  +V  G  +  ++S+   ++E I+FEYE  ++++R+VLG+GT+GTV+A R++  Q +I +KE+     +EVQPL EEI LHS L H NIV YLG            F I ME VPGGSL+SLL+ K G + E   +YY  QILEGLKYLH+ +I+HRDIKGDNVLVN Y+G+ KISDFGT KRL  +     TFTGT+QYMAPE+I  G  GYG PAD+WSFGCT++EM TG+PPF ++  P AA+F+VG F  HP  P  ++ +  +F++ CF+P+   R +   LL  PF+     S+                   H K+K    KN   +     H   M  +ERS    + +       FS     V +    N    +  ++   L ID     H + N+ F S   + DG S          F    P S       +   + +P    ++G+                      F+ML+K++E R  L + ++  ++ ++  W  L+++     L    +  +LE+++D   ++LL  D  K++  +  +R   DY      +  L +Y    +I+  LR+   KPH + A   +I +AV  A +IL    +  L  A    P+ S  +     + +E     + RP SR   +                                   + + EL  LQ EN  L++ L +   E N  LK  I+      D+
Sbjct:  533 YPVLILELNKEFTPSYLTLNNEEGTVILSHVLENSQQKKI-----HQSE-LRGIHRWHFARNNIKAVTESKRDDRQLFLYVHENSDDFNLLFPTKAHCKKAYDDMKSMADVADGNYQGRVLSNP--DNEKIRFEYELSNSNERVVLGKGTYGTVYAARDMDTQRQIVVKEIEVKYDEEVQPLMEEISLHSTLCHANIVQYLGCDLVGKDGSNDHFLIFMEHVPGGSLSSLLRSKWGPMNENAMNYYGKQILEGLKYLHELKIVHRDIKGDNVLVNTYSGVCKISDFGTCKRLAGLNPVTETFTGTLQYMAPEVIDHGQRGYGAPADIWSFGCTMVEMATGRPPFVEMQNPQAAMFRVGMFKTHPPIPTEITEKCRNFIKSCFLPEACDRPSAKDLLQDPFIYHNHHSISRTRSGSINKKPATKIELNHDKEKKEKSKNQREMLRSTSHIGGMGVVERSPPTPEPMSATLTAGFS----HVHSQTVSNALSTAREEKKLHLKID-----HAR-NRTFSSSSPVPDGQSSAGTNMSHPGFQLSQPSSPIVDDTNHPHLIVSPISLNTMGSPLSSAALLNRTISDESSNSSSRFFMLQKDSERRRSLGQFMQDYKDLIIDSWSTLLIKQSDTELVV--TVYMLEMLLDGMRDFLLKKDNTKMQKMIDDIRGLLDYDTAKIGQINLALYHFSDSIQPVLRRLDIKPHWMFALSNLITSAVQCAISIL-SPDLSLLLHAQDNLPSTSSIVAIRNSSLSEGEALIESRPPSREERVR----------------------------------EDRKELRTLQEENEILIERLLQVERELNAQLKSGITRANRFRDF 1326          

HSP 2 Score: 320.857 bits (821), Expect = 3.089e-89
Identity = 174/449 (38.75%), Postives = 268/449 (59.69%), Query Frame = 1
Query:  106 RKSAYDELEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKKTAGNSVTIILYNVNEKGRVGVLETQCMIAMMTDNED------LKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADS------VFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRSREVLNFWLEFF 1416
            R+ A  +++KV +  + V+L RI F  LD+  TE LD FYNAD+ ++D+++  QQ +L +H+GVRE++G   N+IL Y   D     +++LKKT  +   I+  +  +  ++   +         +N+D       ++ V +   +   +++ +LK V+V   AH +EKF++DLR+ RE    ++    +  M  RLD+P++L  + +  M+LSYR  Q Y  ++ L++ L       K+++T  I+Y YAFALNRRNK G+R+ AL+ +    E   ++      + PD+V L GRIYKD F+AS Y D+++LN A  WY + F++ P EY GIN  TLL   G     + E+ QI + LN  +G KGA+  L +YWDVAT+FEVSVLAE+Y KA +AA  M KL+PPVW LKST+ NIKLI+  R     +P+ + ++   FW EFF
Sbjct:   80 REMALKDVQKVADTLN-VNLTRIDFDKLDFGETETLDLFYNADVALVDVTVTHQQPSLCYHIGVRESMGQSYNMILTYWSPDPEYHIMDALKKTHAHLPMIVYIHHQDSNQLQSYDK-------NNNDDDSKPPFARTNVPAKTITFQHRMKQVLKSVQVEASAHSREKFMSDLRKAREITDGDQKNDYLDKMRTRLDNPDVLHPDTVSLMMLSYRDNQNYGGMIRLVDDLKRIPDCLKVVDTPVIRYQYAFALNRRNKDGDRDLALNTVLSLVEGTTENEEKNGPLSPDVVCLAGRIYKDKFIASNYEDRESLNSAIEWYRRAFEMSPLEYSGINLTTLLRASGEHFENNLEMQQIAVVLNSLLGRKGALQNLMEYWDVATYFEVSVLAENYQKACEAALMMVKLKPPVWYLKSTMENIKLIN--RCAATISPIEKEKQQFLFWSEFF 518          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 158.303 bits (399), Expect = 1.371e-39
Identity = 95/255 (37.25%), Postives = 145/255 (56.86%), Query Frame = 1
Query: 2032 LGRGTFGTVFAGRELTKQIKIAIKEVNESQIK-EVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLKKNGALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELIKGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARK 2793
            +GRG+FG V+ G +      +AIK ++  Q + E++ + +EI + S+   + +  Y GS  +     IIME + GGS   L K +G L E   +    +IL+GL+YLH  R +HRDIKG NVL++     +KI D+G +K L D + +A+TF GT  +MAPE++KG   Y   AD+WS G T IE+  G+PP +DL  P+  LF + +           S    +F+E C   DP  R + ++LL H F++ A+K
Sbjct:   40 IGRGSFGEVYKGIDNRTGRVVAIKIIDLEQAEDEIEDIQQEIQVLSQCDSQYVTKYFGSFLKGSKLWIIMEYLGGGSALDLTK-SGKLDESHIAVILREILKGLEYLHSERKIHRDIKGANVLLDRQTAAVKICDYGVAKPL-DTVLKANTFVGTPFFMAPEVVKGE--YSIEADIWSLGITAIELANGEPPHSDL-HPMRVLFLIPKNPPPVLQGSQWSKPFKEFVEMCLNKDPENRPSASTLLKHQFIKRAKK 289          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 157.532 bits (397), Expect = 1.980e-39
Identity = 95/255 (37.25%), Postives = 145/255 (56.86%), Query Frame = 1
Query: 2032 LGRGTFGTVFAGRELTKQIKIAIKEVNESQIK-EVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLKKNGALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELIKGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARK 2793
            +GRG+FG V+ G +      +AIK ++  Q + E++ + +EI + S+   + +  Y GS  +     IIME + GGS   L K +G L E   +    +IL+GL+YLH  R +HRDIKG NVL++     +KI D+G +K L D + +A+TF GT  +MAPE++KG   Y   AD+WS G T IE+  G+PP +DL  P+  LF + +           S    +F+E C   DP  R + ++LL H F++ A+K
Sbjct:   20 IGRGSFGEVYKGIDNRTGRVVAIKIIDLEQAEDEIEDIQQEIQVLSQCDSQYVTKYFGSFLKGSKLWIIMEYLGGGSALDLTK-SGKLDESHIAVILREILKGLEYLHSERKIHRDIKGANVLLDRQTAAVKICDYGVAKPL-DTVLKANTFVGTPFFMAPEVVKGE--YSIEADIWSLGITAIELANGEPPHSDL-HPMRVLFLIPKNPPPVLQGSQWSKPFKEFVEMCLNKDPENRPSASTLLKHQFIKRAKK 269          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 157.147 bits (396), Expect = 2.172e-39
Identity = 95/255 (37.25%), Postives = 145/255 (56.86%), Query Frame = 1
Query: 2032 LGRGTFGTVFAGRELTKQIKIAIKEVNESQIK-EVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLKKNGALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELIKGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARK 2793
            +GRG+FG V+ G +      +AIK ++  Q + E++ + +EI + S+   + +  Y GS  +     IIME + GGS   L K +G L E   +    +IL+GL+YLH  R +HRDIKG NVL++     +KI D+G +K L D + +A+TF GT  +MAPE++KG   Y   AD+WS G T IE+  G+PP +DL  P+  LF + +           S    +F+E C   DP  R + ++LL H F++ A+K
Sbjct:   25 IGRGSFGEVYKGIDNRTGRVVAIKIIDLEQAEDEIEDIQQEIQVLSQCDSQYVTKYFGSFLKGSKLWIIMEYLGGGSALDLTK-SGKLDESHIAVILREILKGLEYLHSERKIHRDIKGANVLLDRQTAAVKICDYGVAKPL-DTVLKANTFVGTPFFMAPEVVKGE--YSIEADIWSLGITAIELANGEPPHSDL-HPMRVLFLIPKNPPPVLQGSQWSKPFKEFVEMCLNKDPENRPSASTLLKHQFIKRAKK 274          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Ask1 (gene:FBgn0014006 transcript:FBtr0083819)

HSP 1 Score: 410.994 bits (1055), Expect = 2.515e-121
Identity = 246/668 (36.83%), Postives = 380/668 (56.89%), Query Frame = 1
Query: 1600 DTEDCQNLDRRVMYPVLVSDSEGILQPAFLQVNINSDIKSIRL---WYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKSEVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLK-KNGAL--TEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELI-KGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKARNQ-KNDITIP-DKFDHRLMSNIERSSTLTKVIKENKQGCFSAPPMDVSNSVPQNIRPISNRKRGQLLSIDLLLVIHMKTNKRFRSDESISDGNSFYSPDPPXXXXXXXXXXXXLETPSVGAFYMLRKETEARSELHKILKSVRNNVVSYWRELILEDDLKPLTYNHSCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANIL 3576
            +TE+ +N    + +P+L+ + + I  P+++ +N+++D KSI++      H     + + D+ F    IK +SL K      +LYV   +DDF ++FPS   R++FY+++  E+ + +   + +S+D     +I++EY+YD+ ++++VLG+GT+GTV+A R+   Q++IAIKEV E   ++VQPLHEEI LHS+L HRNIV YLGS SE G FKI MEQVPGGSL+ LL+ K G L   E T ++YS QILEGLKYLH+  I+HRDIKGDNVLVN Y+G++KISDFGTSKRL  I     TFTGT+QYMAPE+I +G  GYG  AD+WSFGCT +EM TGKPPF +LG+  AA+FKVG + +HP+ P+ LS  A +F+ +CF      R + + LL  PFLQ   + +        +    I++P D+F H+                       + PP+  + +      P  +      + ID L       + +F  +   S G   +   P     + +   S  ET     FY L+K+++ R+ L K+L    + +   W + + + D   +    S   LE+++    +Y+++ +++ L+  + +L+   +   +      L +YS + A+   LR H  KPH + A D ++  AV  A  I 
Sbjct:  284 NTEEVKN---SIRFPILILEPQKIYMPSYVTINMDADEKSIQIVNICLAHAKNACKKIHDFLFVASKIKSVSLYKRDDRCAYLYVHHNSDDFQIYFPSTERRQKFYDMIL-EMTADQVVFVNLSND---DANIEYEYDYDEQNRKMVLGKGTYGTVYAARDKQTQVRIAIKEVPEKNSQDVQPLHEEIKLHSQLRHRNIVRYLGSCSENGFFKIFMEQVPGGSLSDLLETKWGPLKDNESTMAFYSKQILEGLKYLHEQDIVHRDIKGDNVLVNTYSGVVKISDFGTSKRLARINPMTETFTGTLQYMAPEVIDQGVRGYGPAADIWSFGCTNVEMATGKPPFIELGSAHAAMFKVGFYKKHPNIPEELSANAKNFILRCFAISVMDRPSASQLLEDPFLQDKPRKVRPALPINTEFGRSISVPADRFVHK-----------------------TTPPLSYNTTCNTPTTPELDITHSSSVDIDEL------PSNQFMLERRNSHG---FLLSPEIEPSTPSLRTSISETSETDGFYRLKKDSQRRTTLSKVLALDESKICDIWLKKV-DADQNSIAIRKSD--LEVLIRGLRDYIMNENEKHLEATINELKQKLNNDAVALDHLHLALYSFQDAVVCVLRYHCIKPHWMFALDNLVKRAVQAAVTIF 909          

HSP 2 Score: 287.345 bits (734), Expect = 3.806e-79
Identity = 149/295 (50.51%), Postives = 197/295 (66.78%), Query Frame = 1
Query:  583 LKEKFLNDLR--RDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFR-KPEDNTPVSRSREVLNFWLEFFENTIHDCEEEVKQT 1458
            ++EKFL+D+R  RD       +L+  +  M +RLDDP +LS E++ + + S R +Q YD +V L+  L      +K + T ++ + YAFALNRRN++G+REKAL    KA E   ++ FPDM+ L GRIYKDIFV S YTD  +L  A  WY + F++QPNEY GIN ATLLVI G +   +EEL  I + LN  IG KG+++ L++YWDVATFFE+SVLA DY KA+QAAECMFKL+PP W LKSTIGNI LI  FR KPE+  P     +V  FW++FF    +   EEVK +
Sbjct:    1 MREKFLSDMRTARDTYATNGAKLQSILHEMRKRLDDPHVLSGEVVHSFMCSLRDVQDYDAMVRLVNDLKNIPNTRKYVETGNMSFLYAFALNRRNRKGDREKALESSLKALEK-KENHFPDMLCLCGRIYKDIFVESDYTDATSLAHAIKWYRQSFEVQPNEYAGINLATLLVIEGKEFTNTEELQHIGMTLNNLIGKKGSLSSLSEYWDVATFFEISVLANDYAKAIQAAECMFKLKPPNWYLKSTIGNISLIHRFRKKPEERQP-PIEEQVFQFWMDFFLEATN--TEEVKNS 291          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Ask1 (gene:FBgn0014006 transcript:FBtr0300256)

HSP 1 Score: 411.764 bits (1057), Expect = 2.153e-120
Identity = 246/668 (36.83%), Postives = 380/668 (56.89%), Query Frame = 1
Query: 1600 DTEDCQNLDRRVMYPVLVSDSEGILQPAFLQVNINSDIKSIRL---WYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKSEVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLK-KNGAL--TEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELI-KGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKARNQ-KNDITIP-DKFDHRLMSNIERSSTLTKVIKENKQGCFSAPPMDVSNSVPQNIRPISNRKRGQLLSIDLLLVIHMKTNKRFRSDESISDGNSFYSPDPPXXXXXXXXXXXXLETPSVGAFYMLRKETEARSELHKILKSVRNNVVSYWRELILEDDLKPLTYNHSCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANIL 3576
            +TE+ +N    + +P+L+ + + I  P+++ +N+++D KSI++      H     + + D+ F    IK +SL K      +LYV   +DDF ++FPS   R++FY+++  E+ + +   + +S+D     +I++EY+YD+ ++++VLG+GT+GTV+A R+   Q++IAIKEV E   ++VQPLHEEI LHS+L HRNIV YLGS SE G FKI MEQVPGGSL+ LL+ K G L   E T ++YS QILEGLKYLH+  I+HRDIKGDNVLVN Y+G++KISDFGTSKRL  I     TFTGT+QYMAPE+I +G  GYG  AD+WSFGCT +EM TGKPPF +LG+  AA+FKVG + +HP+ P+ LS  A +F+ +CF      R + + LL  PFLQ   + +        +    I++P D+F H+                       + PP+  + +      P  +      + ID L       + +F  +   S G   +   P     + +   S  ET     FY L+K+++ R+ L K+L    + +   W + + + D   +    S   LE+++    +Y+++ +++ L+  + +L+   +   +      L +YS + A+   LR H  KPH + A D ++  AV  A  I 
Sbjct:  451 NTEEVKN---SIRFPILILEPQKIYMPSYVTINMDADEKSIQIVNICLAHAKNACKKIHDFLFVASKIKSVSLYKRDDRCAYLYVHHNSDDFQIYFPSTERRQKFYDMIL-EMTADQVVFVNLSND---DANIEYEYDYDEQNRKMVLGKGTYGTVYAARDKQTQVRIAIKEVPEKNSQDVQPLHEEIKLHSQLRHRNIVRYLGSCSENGFFKIFMEQVPGGSLSDLLETKWGPLKDNESTMAFYSKQILEGLKYLHEQDIVHRDIKGDNVLVNTYSGVVKISDFGTSKRLARINPMTETFTGTLQYMAPEVIDQGVRGYGPAADIWSFGCTNVEMATGKPPFIELGSAHAAMFKVGFYKKHPNIPEELSANAKNFILRCFAISVMDRPSASQLLEDPFLQDKPRKVRPALPINTEFGRSISVPADRFVHK-----------------------TTPPLSYNTTCNTPTTPELDITHSSSVDIDEL------PSNQFMLERRNSHG---FLLSPEIEPSTPSLRTSISETSETDGFYRLKKDSQRRTTLSKVLALDESKICDIWLKKV-DADQNSIAIRKSD--LEVLIRGLRDYIMNENEKHLEATINELKQKLNNDAVALDHLHLALYSFQDAVVCVLRYHCIKPHWMFALDNLVKRAVQAAVTIF 1076          

HSP 2 Score: 366.311 bits (939), Expect = 1.103e-104
Identity = 206/454 (45.37%), Postives = 288/454 (63.44%), Query Frame = 1
Query:  106 RKSAYDELEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKKTAGNSVTIILYNVNEKGRVGVLETQCMIAMMTDNEDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLR--RDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFR-KPEDNTPVSRSREVLNFWLEFFENTIHDCEEEVKQT 1458
            R+ A +E+++    A   +  R+ F+ LD+  T VL+TFYNAD+ I+D+SI  QQR L +H GVRE+ GM ENI L Y+ +DS K+T+ SLK +  N +  + Y  N +     L +Q      + N   +      + +L  +L+  L++VE+  +AH++EKFL+D+R  RD       +L+  +  M +RLDDP +LS E++ + + S R +Q YD +V L+  L      +K + T ++ + YAFALNRRN++G+REKAL    KA E   ++ FPDM+ L GRIYKDIFV S YTD  +L  A  WY + F++QPNEY GIN ATLLVI G +   +EEL  I + LN  IG KG+++ L++YWDVATFFE+SVLA DY KA+QAAECMFKL+PP W LKSTIGNI LI  FR KPE+  P     +V  FW++FF    +   EEVK +
Sbjct:   18 RQCALEEIKQAVQSAG-ANFQRVQFERLDFGETNVLETFYNADVAIIDLSILTQQRPLSYHYGVRESFGMKENI-LTYNDIDS-KQTL-SLKLSCANYL-FLSYKRNAETNSCHLTSQ----PNSGNNSKEPNAEGRVPTLQWRLKRKLQDVEIQSKAHMREKFLSDMRTARDTYATNGAKLQSILHEMRKRLDDPHVLSGEVVHSFMCSLRDVQDYDAMVRLVNDLKNIPNTRKYVETGNMSFLYAFALNRRNRKGDREKALESSLKALEK-KENHFPDMLCLCGRIYKDIFVESDYTDATSLAHAIKWYRQSFEVQPNEYAGINLATLLVIEGKEFTNTEELQHIGMTLNNLIGKKGSLSSLSEYWDVATFFEISVLANDYAKAIQAAECMFKLKPPNWYLKSTIGNISLIHRFRKKPEERQP-PIEEQVFQFWMDFFLEATN--TEEVKNS 458          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: hpo (gene:FBgn0261456 transcript:FBtr0331920)

HSP 1 Score: 157.147 bits (396), Expect = 4.267e-39
Identity = 95/257 (36.96%), Postives = 146/257 (56.81%), Query Frame = 1
Query: 2032 LGRGTFGTVFAGRELTKQIKIAIKEVN-ESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLK-KNGALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELIKGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDF--PDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTAR 2790
            LG G++G+V+          +AIK V  ES + E+    +EI +  +     +V Y GS  ++    I ME    GS++ +++ +   LTE+  +   +  L+GL YLH  R +HRDIK  N+L+N   G  K++DFG + +L D M + +T  GT  +MAPE+I+   GY   AD+WS G T +EM  GKPP+ ++  P+ A+F + +    P F  PD  S E IDF+ KC + +P+ RAT T LL H F++ A+
Sbjct:   48 LGEGSYGSVYKAVHKESSSIVAIKLVPVESDLHEII---KEISIMQQCDSPYVVRYYGSYFKQYDLWICMEYCGAGSVSDIMRLRKKTLTEDEIATILSDTLQGLVYLHLRRKIHRDIKAANILLNT-EGYAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIE-EIGYDCVADIWSLGITALEMAEGKPPYGEI-HPMRAIFMIPQ-KPPPSFREPDRWSTEFIDFVSKCLVKEPDDRATATELLEHEFIRNAK 297          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: hpo (gene:FBgn0261456 transcript:FBtr0086500)

HSP 1 Score: 157.147 bits (396), Expect = 4.267e-39
Identity = 95/257 (36.96%), Postives = 146/257 (56.81%), Query Frame = 1
Query: 2032 LGRGTFGTVFAGRELTKQIKIAIKEVN-ESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLK-KNGALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELIKGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDF--PDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTAR 2790
            LG G++G+V+          +AIK V  ES + E+    +EI +  +     +V Y GS  ++    I ME    GS++ +++ +   LTE+  +   +  L+GL YLH  R +HRDIK  N+L+N   G  K++DFG + +L D M + +T  GT  +MAPE+I+   GY   AD+WS G T +EM  GKPP+ ++  P+ A+F + +    P F  PD  S E IDF+ KC + +P+ RAT T LL H F++ A+
Sbjct:   48 LGEGSYGSVYKAVHKESSSIVAIKLVPVESDLHEII---KEISIMQQCDSPYVVRYYGSYFKQYDLWICMEYCGAGSVSDIMRLRKKTLTEDEIATILSDTLQGLVYLHLRRKIHRDIKAANILLNT-EGYAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIE-EIGYDCVADIWSLGITALEMAEGKPPYGEI-HPMRAIFMIPQ-KPPPSFREPDRWSTEFIDFVSKCLVKEPDDRATATELLEHEFIRNAK 297          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0334539)

HSP 1 Score: 153.68 bits (387), Expect = 9.171e-38
Identity = 87/255 (34.12%), Postives = 149/255 (58.43%), Query Frame = 1
Query: 2032 LGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLKKNGALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELIKGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDF--PDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTAR 2790
            +G+G  GTV+   E +  +++AIK++N SQ  + + +  EI +     H N+V+YL S        ++ME +PGGSLT ++ +   + E   +    ++L+ L++LH N+++HRDIK DN+L+ + +G +K++DFG   ++     + +T  GT  +MAPE++     YG   D+WS G   IEM+ G+PP+ +   P+ AL+ +    + P+    D LS    DFL++C   + ++RA+   LL HPFL+ AR
Sbjct:  436 IGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKELIINEILVMRENKHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVVTET-CMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGL-DGSVKLTDFGFCAQISPEQSKRTTMVGTPYWMAPEVVTR-KQYGPKVDLWSLGIMAIEMVEGEPPYLN-ENPLKALYLIATNGK-PEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKHPFLKLAR 685          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-1i11.3 (si:ch211-1i11.3 [Source:ZFIN;Acc:ZDB-GENE-030131-8638])

HSP 1 Score: 681.019 bits (1756), Expect = 0.000e+0
Identity = 471/1381 (34.11%), Postives = 723/1381 (52.35%), Query Frame = 1
Query:  127 LEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKKTAGNSVTIILYNVNEKGRVGVLETQCMIAMMTDNEDL---KSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKP-EDNTPVSRSREVLNFWLEFFENTIHDCEEEVKQTQEENPNNIWSAKRRKSSVTPKVILTSSTRTETTIHDAAVNDEVNQIGDTEDCQNLDRRVMYPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKSEVLSGKEEMLMMSSDMI-ESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLK-KNGAL--TEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELI-KGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKARNQKNDITIPDKFDHRLMSNIERSSTLTKVIKENKQGCFSAPPMDVSNSVPQNIRPISNRKRGQLLSIDLLLVIHMKTNKRFRSD---ESISDGNSFYS-PDPPXXXXXXXXXXXXLETPSVG----AFYMLRKETEARSELHKILKSVRNNVVSYWRELILEDDLKPLTYNHSCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANILFKAGIFRL---FDADPQTPAESHYLKPFCQTNENTKFSDRRPLSRSTGITGADSNPHENDFHVSAMIVDDLTTNDIWQPPFMNFDFKNELVKLQNENNKLLQDLCETTSEYNRHLKHCISEKKNHIDYLRATLGEKLITXXXXXXXXXXXXXXENLKNWLNEIGXXXXXXXXXXNEEYTFHEFLYFISKEDLYKLQLKGGVVLKILAAIERKKK 4209
            L + C  A  V L  IS++ +   +TE+LDTFYNAD+V+++M+  I Q +L +HLGVRE+  M  N+IL     +  ++ ++ +K+  G S T I Y V+ +G+V      C  A+M   +D      +  S + SL  +L  LL+ V +    +L E    ++R  RE  T   L Q++  + +RLD  ELLS +I+++++LSYR I  YD I+ L+E+L+       +    +I++ Y FALNRRN  G+R +AL +I    E   ++V  D+  L GRIYKD+F++S + D ++ ++A+ WY K F ++P+ + GIN   LL+  G++ + S EL +I + L+  +G KG++ ++ DYWDV  +    +LA ++ K + A+E +++L+ P+W + S +    L   F KP E N P    +E  +FW+E     +  C+  V   +                  P +IL  +                              +V  P ++S SE              D ++++L +  P E  + + +WTF    I+G+S+SK  + + FLYV+  +DDF L+FPS+   + F ++V S +L   E  +  SS M  E  D+++ YE ++N  ++VLG+GT+G V+AGR+L+ Q++IAIKE+ E      QPLHEEI LH RL HRNIV YLGS SE G  KI ME+VPGGSL+SLL+ K G L   E T  +Y+ QIL+GLKYLHDN+I+HRDIKGDNVLVN Y+G+LKISDFGTSKRL  I     TFTGT+QYMAPE+I +GP GYG PAD+WS GCT+IEM TGKPPF++LG+P AA+FKVG F  HP  P+ +S +A DF+  CF P+P+KR T + LL + FL    K+  KK+      N +  P    HR MS           ++ N+  C                            S DL      +    F+ +   ES    + F + PD P    +         +PS        +MLRK++E R  LH+IL    ++VV   +E + + +   +T +H   + ELI  L  N +   DK  L   L+ LRS      +  S  Q +++S + A++  LRK   KPH + A D ++  AV  A  +L      +L   F+ +  +P   H         E    S   PL++         +P E     +++    +++               EL +L+ E+ +LL  L E   E+ + LK  +  K+ HI+ L      K  + +  + Q S    +  +  WL  + V    I ++V  E+T    L+F  K+DL    +KGG++ ++ AAI +++K
Sbjct:   77 LTEACADAHAV-LKSISYERIALGTTEILDTFYNADVVVVEMNNSICQPSLFYHLGVRESFSMTNNVILY---CNKQEDDMQVVKEQCG-SYTFIPYMVSPQGKVFA----CDAALMRAVKDFLHSSFKFESLMTSLVDRLVKLLESVHINSSEYLHEAIRREIRLAREHFTGPALSQELGRIQKRLDSVELLSPDIVMSLLLSYRDIPDYDSIINLVETLNNLPMCM-VPAHQNIKFQYIFALNRRNHPGDRVRALKLILPIVES-GETVASDVYCLCGRIYKDMFLSSGFKDTNSRDQASKWYGKAFTIEPSLHSGINNVVLLMAAGHEFDTSIELRKIGVTLSSLLGRKGSLEKMQDYWDVGFYLGAGILANEHKKVIDASERLYRLKAPMWYVASIMETYILYKQFAKPREVNHP---KQETADFWMELM---VQACKPTVSTAR-----------------CPVLILEPT------------------------------KVFQPSIISVSE------------EDDSRTVQLRHVTPLE--KGLHEWTFPASAIRGVSISKFDERSCFLYVLYNSDDFQLYFPSDLHCKGFCDLVNS-LLHQTESPVEDSSSMRGEEGDLEYIYERNENGDKVVLGKGTYGVVYAGRDLSNQVRIAIKEIPEKDSTYSQPLHEEIALHKRLKHRNIVQYLGSVSEDGFIKIFMEEVPGGSLSSLLRSKWGPLKDNEATIVFYTKQILDGLKYLHDNQIVHRDIKGDNVLVNTYSGVLKISDFGTSKRLAGINPCTETFTGTLQYMAPEIIDQGPRGYGKPADIWSLGCTIIEMATGKPPFHELGSPQAAMFKVGMFKIHPAVPECMSEQAKDFIMCCFEPNPDKRTTASELLKNGFL----KASAKKRLKPLADNSLKEPAGEFHRSMSVPVALRVENTDVEHNELSC----------------------------SFDL-----RRATSAFKGNNMAESPPSTSGFLTVPDEPQIDMTT--------SPSGSGENLGLFMLRKDSERRDTLHRILTEDISHVVQNIQETMPQAEEPCITSDH---ISELIGCLREN-IRSPDKRLLTNSLLTLRSSLLNSSVPLSSLQAVLFSFQDAVKKVLRKQQIKPHWMFALDNLLRQAVQDAITVLLPELKLQLQSSFENEEGSPETEH-------PTEADSESIVTPLAKDKETLVITKDPEEGHSTCNSLPTALISSYS---------SLAKELSELRLESRRLLMQLNEKEKEFQQLLKTSLQSKQRHINALE----HKAASAATDNKQTSHNAQNSAMVRWLRGVPVDEKTIELLVFHEFTLDSLLHFACKDDLQYCGIKGGMMCRLWAAISKQRK 1309          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-1i11.3 (si:ch211-1i11.3 [Source:ZFIN;Acc:ZDB-GENE-030131-8638])

HSP 1 Score: 664.455 bits (1713), Expect = 0.000e+0
Identity = 472/1410 (33.48%), Postives = 720/1410 (51.06%), Query Frame = 1
Query:  127 LEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKKTAGNSVTIILYNVNEKGRVGVLETQCMIAMMTDNEDL---KSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKP-EDNTPVSRSREVLNFWLEFFENTIHDCEEEVKQTQEENPNNIWSAKRRKSSVTPKVILTSSTRTETTIHDAAVNDEVNQIGDTEDCQNLDRRVMYPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKSEVLSGKEEMLMMSSDMI-ESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLK-KNGAL--TEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFT--------------------------------GTMQYMAPELI-KGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKARNQKNDITIPDKFDHRLMSNIERSSTLTKVIKENKQGCFSAPPMDVSNSVPQNIRPISNRKRGQLLSIDLLLVIHMKTNKRFRSDESISDGNSFYS-PDPPXXXXXXXXXXXXLETPSVG----AFYMLRKETEARSELHKILKSVRNNVVSYWRELILEDDLKPLTYNHSCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANILFKAGIFRL---FDADPQTPAESHYLKPFCQTNENTKFSDRRPLSRSTGITGADSNPHENDFHVSAMIVDDLTTNDIWQPPFMNFDFKNELVKLQNENNKLLQDLCETTSEYNRHLKHCISEKKNHIDYLRATLGEKLITXXXXXXXXXXXXXXENLKNWLNEIGXXXXXXXXXXNEEYTFHEFLYFISKEDLYKLQLKGGVVLKILAAIERKKK 4209
            L + C  A  V L  IS++ +   +TE+LDTFYNAD+V+++M+  I Q +L +HLGVRE+  M  N+IL     +  ++ ++ +K+  G S T I Y V+ +G+V      C  A+M   +D      +  S + SL  +L  LL+ V +    +L E    ++R  RE  T   L Q++  + +RLD  ELLS +I+++++LSYR I  YD I+ L+E+L+       +    +I++ Y FALNRRN  G+R +AL +I    E   ++V  D+  L GRIYKD+F++S + D ++ ++A+ WY K F ++P+ + GIN   LL+  G++ + S EL +I + L+  +G KG++ ++ DYWDV  +    +LA ++ K + A+E +++L+ P+W + S +    L   F KP E N P    +E  +FW+E     +  C+  V   +                  P +IL  +                              +V  P ++S SE              D ++++L +  P E  + + +WTF    I+G+S+SK  + + FLYV+  +DDF L+FPS+   + F ++V S +L   E  +  SS M  E  D+++ YE ++N  ++VLG+GT+G V+AGR+L+ Q++IAIKE+ E      QPLHEEI LH RL HRNIV YLGS SE G  KI ME+VPGGSL+SLL+ K G L   E T  +Y+ QIL+GLKYLHDN+I+HRDIKGDNVLVN Y+G+LKISDFGTSKRL  I     TFT                                GT+QYMAPE+I +GP GYG PAD+WS GCT+IEM TGKPPF++LG+P AA+FKVG F  HP  P+ +S +A DF+  CF P+P+KR T + LL + FL    K+  KK+      N +  P    HR M                              SVP  +R  +       LS    L       K     ES    + F + PD P    +         +PS        +MLRK++E R  LH+IL    ++VV   +E + + +   +T +H   + ELI  L  N +   DK  L   L+ LRS      +  S  Q +++S + A++  LRK   KPH + A D ++  AV  A  +L      +L   F+ +  +P   H         E    S   PL++         +P E     +++    +++               EL +L+ E+ +LL  L E   E+ + LK  +  K+ HI+ L      K  + +  + Q S    +  +  WL  + V    I ++V  E+T    L+F  K+DL    +KGG++ ++ AAI +++K
Sbjct:   77 LTEACADAHAV-LKSISYERIALGTTEILDTFYNADVVVVEMNNSICQPSLFYHLGVRESFSMTNNVILY---CNKQEDDMQVVKEQCG-SYTFIPYMVSPQGKVFA----CDAALMRAVKDFLHSSFKFESLMTSLVDRLVKLLESVHINSSEYLHEAIRREIRLAREHFTGPALSQELGRIQKRLDSVELLSPDIVMSLLLSYRDIPDYDSIINLVETLNNLPMCM-VPAHQNIKFQYIFALNRRNHPGDRVRALKLILPIVES-GETVASDVYCLCGRIYKDMFLSSGFKDTNSRDQASKWYGKAFTIEPSLHSGINNVVLLMAAGHEFDTSIELRKIGVTLSSLLGRKGSLEKMQDYWDVGFYLGAGILANEHKKVIDASERLYRLKAPMWYVASIMETYILYKQFAKPREVNHP---KQETADFWMELM---VQACKPTVSTAR-----------------CPVLILEPT------------------------------KVFQPSIISVSE------------EDDSRTVQLRHVTPLE--KGLHEWTFPASAIRGVSISKFDERSCFLYVLYNSDDFQLYFPSDLHCKGFCDLVNS-LLHQTESPVEDSSSMRGEEGDLEYIYERNENGDKVVLGKGTYGVVYAGRDLSNQVRIAIKEIPEKDSTYSQPLHEEIALHKRLKHRNIVQYLGSVSEDGFIKIFMEEVPGGSLSSLLRSKWGPLKDNEATIVFYTKQILDGLKYLHDNQIVHRDIKGDNVLVNTYSGVLKISDFGTSKRLAGINPCTETFTGESPSTYFTASHITLCTLLCLLFKLLMVHLCAGTLQYMAPEIIDQGPRGYGKPADIWSLGCTIIEMATGKPPFHELGSPQAAMFKVGMFKIHPAVPECMSEQAKDFIMCCFEPNPDKRTTASELLKNGFL----KASAKKRLKPLADNSLKEPAGEFHRSM------------------------------SVPVALRVENTDVEHNELSCSFDLRRATSAFKGNNMAESPPSTSGFLTVPDEPQIDMTT--------SPSGSGENLGLFMLRKDSERRDTLHRILTEDISHVVQNIQETMPQAEEPCITSDH---ISELIGCLREN-IRSPDKRLLTNSLLTLRSSLLNSSVPLSSLQAVLFSFQDAVKKVLRKQQIKPHWMFALDNLLRQAVQDAITVLLPELKLQLQSSFENEEGSPETEH-------PTEADSESIVTPLAKDKETLVITKDPEEGHSTCNSLPTALISSYS---------SLAKELSELRLESRRLLMQLNEKEKEFQQLLKTSLQSKQRHINALE----HKAASAATDNKQTSHNAQNSAMVRWLRGVPVDEKTIELLVFHEFTLDSLLHFACKDDLQYCGIKGGMMCRLWAAISKQRK 1341          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-1i11.3 (si:ch211-1i11.3 [Source:ZFIN;Acc:ZDB-GENE-030131-8638])

HSP 1 Score: 650.203 bits (1676), Expect = 0.000e+0
Identity = 428/1190 (35.97%), Postives = 643/1190 (54.03%), Query Frame = 1
Query:  127 LEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKKTAGNSVTIILYNVNEKGRVGVLETQCMIAMMTDNEDL---KSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKP-EDNTPVSRSREVLNFWLEFFENTIHDCEEEVKQTQEENPNNIWSAKRRKSSVTPKVILTSSTRTETTIHDAAVNDEVNQIGDTEDCQNLDRRVMYPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKSEVLSGKEEMLMMSSDM-IESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLK-KNGAL--TEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELI-KGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKARNQKNDITIPDKFDHRLMSNIERSSTLTKVIKENKQGCFSAPPMDVSNSVPQNIRPISNRKRGQLLSIDLLLVIHMKTNKRFRSD---ESISDGNSFYS-PDPPXXXXXXXXXXXXLETPSVG----AFYMLRKETEARSELHKILKSVRNNVVSYWRELILEDDLKPLTYNHSCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANILFKAGIFRL---FDADPQTPAESH 3636
            L + C  A  V L  IS++ +   +TE+LDTFYNAD+V+++M+  I Q +L +HLGVRE+  M  N+IL     +  ++ ++ +K+  G S T I Y V+ +G+V      C  A+M   +D      +  S + SL  +L  LL+ V +    +L E    ++R  RE  T   L Q++  + +RLD  ELLS +I+++++LSYR I  YD I+ L+E+L+       +    +I++ Y FALNRRN  G+R +AL +I    E   ++V  D+  L GRIYKD+F++S + D ++ ++A+ WY K F ++P+ + GIN   LL+  G++ + S EL +I + L+  +G KG++ ++ DYWDV  +    +LA ++ K + A+E +++L+ P+W + S +    L   F KP E N P    +E  +FW+E     +  C+  V   +                  P +IL  +                              +V  P ++S SE              D ++++L +  P E  + + +WTF    I+G+S+SK  + + FLYV+  +DDF L+FPS+   + F ++V S +L   E  +  SS M  E  D+++ YE ++N  ++VLG+GT+G V+AGR+L+ Q++IAIKE+ E      QPLHEEI LH RL HRNIV YLGS SE G  KI ME+VPGGSL+SLL+ K G L   E T  +Y+ QIL+GLKYLHDN+I+HRDIKGDNVLVN Y+G+LKISDFGTSKRL  I     TFTGT+QYMAPE+I +GP GYG PAD+WS GCT+IEM TGKPPF++LG+P AA+FKVG F  HP  P+ +S +A DF+  CF P+P+KR T + LL + FL    K+  KK+      N +  P    HR MS           ++ N+  C                            S DL      +    F+ +   ES    + F + PD P    +         +PS        +MLRK++E R  LH+IL    ++VV   +E + + +   +T +H   + ELI  L  N +   DK  L   L+ LRS      +  S  Q +++S + A++  LRK   KPH + A D ++  AV  A  +L      +L   F+ +  +P   H
Sbjct:   77 LTEACADAHAV-LKSISYERIALGTTEILDTFYNADVVVVEMNNSICQPSLFYHLGVRESFSMTNNVILY---CNKQEDDMQVVKEQCG-SYTFIPYMVSPQGKV----FACDAALMRAVKDFLHSSFKFESLMTSLVDRLVKLLESVHINSSEYLHEAIRREIRLAREHFTGPALSQELGRIQKRLDSVELLSPDIVMSLLLSYRDIPDYDSIINLVETLNNLPMCM-VPAHQNIKFQYIFALNRRNHPGDRVRALKLILPIVES-GETVASDVYCLCGRIYKDMFLSSGFKDTNSRDQASKWYGKAFTIEPSLHSGINNVVLLMAAGHEFDTSIELRKIGVTLSSLLGRKGSLEKMQDYWDVGFYLGAGILANEHKKVIDASERLYRLKAPMWYVASIMETYILYKQFAKPREVNHP---KQETADFWMELM---VQACKPTVSTAR-----------------CPVLILEPT------------------------------KVFQPSIISVSE------------EDDSRTVQLRHVTPLE--KGLHEWTFPASAIRGVSISKFDERSCFLYVLYNSDDFQLYFPSDLHCKGFCDLVNS-LLHQTESPVEDSSSMRGEEGDLEYIYERNENGDKVVLGKGTYGVVYAGRDLSNQVRIAIKEIPEKDSTYSQPLHEEIALHKRLKHRNIVQYLGSVSEDGFIKIFMEEVPGGSLSSLLRSKWGPLKDNEATIVFYTKQILDGLKYLHDNQIVHRDIKGDNVLVNTYSGVLKISDFGTSKRLAGINPCTETFTGTLQYMAPEIIDQGPRGYGKPADIWSLGCTIIEMATGKPPFHELGSPQAAMFKVGMFKIHPAVPECMSEQAKDFIMCCFEPNPDKRTTASELLKNGFL----KASAKKRLKPLADNSLKEPAGEFHRSMSVPVALRVENTDVEHNELSC----------------------------SFDL-----RRATSAFKGNNMAESPPSTSGFLTVPDEPQIDMTT--------SPSGSGENLGLFMLRKDSERRDTLHRILTEDISHVVQNIQETMPQAEEPCITSDH---ISELIGCLREN-IRSPDKRLLTNSLLTLRSSLLNSSVPLSSLQAVLFSFQDAVKKVLRKQQIKPHWMFALDNLLRQAVQDAITVLLPELKLQLQSSFENEEGSPETEH 1138          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-1i11.3 (si:ch211-1i11.3 [Source:ZFIN;Acc:ZDB-GENE-030131-8638])

HSP 1 Score: 643.654 bits (1659), Expect = 0.000e+0
Identity = 450/1325 (33.96%), Postives = 679/1325 (51.25%), Query Frame = 1
Query:  127 LEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKKTAGNSVTIILYNVNEKGRVGVLETQCMIAMMTDNEDL---KSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKP-EDNTPVSRSREVLNFWLEFFENTIHDCEEEVKQTQEENPNNIWSAKRRKSSVTPKVILTSSTRTETTIHDAAVNDEVNQIGDTEDCQNLDRRVMYPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKSEVLSGKEEMLMMSSDMI-ESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLK-KNGAL--TEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFT--------------------------------GTMQYMAPELI-KGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKARNQKNDITIPDKFDHRLMSNIERSSTLTKVIKENKQGCFSAPPMDVSNSVPQNIRPISNRKRGQLLSIDLLLVIHMKTNKRFRSDESISDGNSFYS-PDPPXXXXXXXXXXXXLETPSVG----AFYMLRKETEARSELHKILKSVRNNVVSYWRELILEDDLKPLTYNHSCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANILFKAGIFRL---FDADPQTPAESHYLKPFCQTNENTKFSDRRPLSRSTGITGADSNPHENDFHVSAMIVDDLTTNDIWQPPFMNFDFKNELVKLQNENNKLLQDLCETTSEYNRHLKHCISEKKNHIDYL 3954
            L + C  A  V L  IS++ +   +TE+LDTFYNAD+V+++M+  I Q +L +HLGVRE+  M  N+IL     +  ++ ++ +K+  G S T I Y V+ +G+V      C  A+M   +D      +  S + SL  +L  LL+ V +    +L E    ++R  RE  T   L Q++  + +RLD  ELLS +I+++++LSYR I  YD I+ L+E+L+       +    +I++ Y FALNRRN  G+R +AL +I    E   ++V  D+  L GRIYKD+F++S + D ++ ++A+ WY K F ++P+ + GIN   LL+  G++ + S EL +I + L+  +G KG++ ++ DYWDV  +    +LA ++ K + A+E +++L+ P+W + S +    L   F KP E N P    +E  +FW+E     +  C+  V   +                  P +IL  +                              +V  P ++S SE              D ++++L +  P E  + + +WTF    I+G+S+SK  + + FLYV+  +DDF L+FPS+   + F ++V S +L   E  +  SS M  E  D+++ YE ++N  ++VLG+GT+G V+AGR+L+ Q++IAIKE+ E      QPLHEEI LH RL HRNIV YLGS SE G  KI ME+VPGGSL+SLL+ K G L   E T  +Y+ QIL+GLKYLHDN+I+HRDIKGDNVLVN Y+G+LKISDFGTSKRL  I     TFT                                GT+QYMAPE+I +GP GYG PAD+WS GCT+IEM TGKPPF++LG+P AA+FKVG F  HP  P+ +S +A DF+  CF P+P+KR T + LL + FL    K+  KK+      N +  P    HR M                              SVP  +R  +       LS    L       K     ES    + F + PD P    +         +PS        +MLRK++E R  LH+IL    ++VV   +E + + +   +T +H   + ELI  L  N +   DK  L   L+ LRS      +  S  Q +++S + A++  LRK   KPH + A D ++  AV  A  +L      +L   F+ +  +P   H         E    S   PL++         +P E     +++    +++               EL +L+ E+ +LL  L E   E+ + LK  +  K+ HI+ L
Sbjct:   77 LTEACADAHAV-LKSISYERIALGTTEILDTFYNADVVVVEMNNSICQPSLFYHLGVRESFSMTNNVILY---CNKQEDDMQVVKEQCG-SYTFIPYMVSPQGKVFA----CDAALMRAVKDFLHSSFKFESLMTSLVDRLVKLLESVHINSSEYLHEAIRREIRLAREHFTGPALSQELGRIQKRLDSVELLSPDIVMSLLLSYRDIPDYDSIINLVETLNNLPMCM-VPAHQNIKFQYIFALNRRNHPGDRVRALKLILPIVES-GETVASDVYCLCGRIYKDMFLSSGFKDTNSRDQASKWYGKAFTIEPSLHSGINNVVLLMAAGHEFDTSIELRKIGVTLSSLLGRKGSLEKMQDYWDVGFYLGAGILANEHKKVIDASERLYRLKAPMWYVASIMETYILYKQFAKPREVNHP---KQETADFWMELM---VQACKPTVSTAR-----------------CPVLILEPT------------------------------KVFQPSIISVSE------------EDDSRTVQLRHVTPLE--KGLHEWTFPASAIRGVSISKFDERSCFLYVLYNSDDFQLYFPSDLHCKGFCDLVNS-LLHQTESPVEDSSSMRGEEGDLEYIYERNENGDKVVLGKGTYGVVYAGRDLSNQVRIAIKEIPEKDSTYSQPLHEEIALHKRLKHRNIVQYLGSVSEDGFIKIFMEEVPGGSLSSLLRSKWGPLKDNEATIVFYTKQILDGLKYLHDNQIVHRDIKGDNVLVNTYSGVLKISDFGTSKRLAGINPCTETFTGESPSTYFTASHITLCTLLCLLFKLLMVHLCAGTLQYMAPEIIDQGPRGYGKPADIWSLGCTIIEMATGKPPFHELGSPQAAMFKVGMFKIHPAVPECMSEQAKDFIMCCFEPNPDKRTTASELLKNGFL----KASAKKRLKPLADNSLKEPAGEFHRSM------------------------------SVPVALRVENTDVEHNELSCSFDLRRATSAFKGNNMAESPPSTSGFLTVPDEPQIDMTT--------SPSGSGENLGLFMLRKDSERRDTLHRILTEDISHVVQNIQETMPQAEEPCITSDH---ISELIGCLREN-IRSPDKRLLTNSLLTLRSSLLNSSVPLSSLQAVLFSFQDAVKKVLRKQQIKPHWMFALDNLLRQAVQDAITVLLPELKLQLQSSFENEEGSPETEH-------PTEADSESIVTPLAKDKETLVITKDPEEGHSTCNSLPTALISSYS---------SLAKELSELRLESRRLLMQLNEKEKEFQQLLKTSLQSKQRHINAL 1260          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k5 (mitogen-activated protein kinase kinase kinase 5 [Source:ZFIN;Acc:ZDB-GENE-030827-3])

HSP 1 Score: 478.404 bits (1230), Expect = 3.788e-144
Identity = 311/883 (35.22%), Postives = 471/883 (53.34%), Query Frame = 1
Query: 1633 VMYPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREF---YNVVKSEVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLK-KNGAL--TEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELI-KGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKARNQKNDITIPDKFDHRLMSNIERSSTL-TKVIKENKQGCFSAPPMDVSNSV---PQNIRPISNRK----------RGQLLSIDLLLVIHMKTNKRFRSDESISDGNSFYSPDPPXXXXXXXXXXXXLETPSVGAFYMLRKETEARSELHKILKSVRNNVVSYWRELILE-DDLKPLTYNHSCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANILFKAGIFRLFDADPQTPAESHYLKPFCQTNENTKFSDRRPLSRSTGITGADSNPHENDFHVSAMIVDDLTTNDIWQPPFMNFDFKNELVKLQNENNKLLQDLCETTSEYNRHLKHCISEKKNHIDYLRATLGEKLITXXXXXXXXXXXXXXE-NLKNWLNEIGXXXXXXXXXXNEEYTFHEFLYFISKEDLYKLQLKGGVVLKILAAIERKKKE 4212
            V +PVL+ +   + QP++L +N +++  ++ +W+  P ++ + + +W F+   ++G+S+SK  + + FLYVV+ ++DF ++F +    + F    N V  E   G +E      +  ESE ++++YEYD++ +++VLG+GTFG V+AGR+L+ Q+++AIKE+ E   +  QPLHEEI LH  L H+NIV YLGS SE G  KI MEQVPGGSL++LL+ K G L   E T  +Y+ QIL+GLKYLHDN+I+HRDIKGDNVL+N Y+G+LKISDFGTSKRL  I     TFTGT+QYMAPE+I KGP GYG PAD+WS GCT+IEM TGKPPF +LG P AA+FKVG F  HP+ PD +S EA  F+ +CF PDP+ RAT   LL+H FL        +KK+++        P        S   RS +L   V+ E+         +   N +   P N RP S+ K          R   LSI +               E+  D ++  SP                E    G F ML+K++E R+ LH+IL   R  +V +  E + +  +   L + H   L+  + D    ++   D++ +   L QL+   D+     S+ Q+ ++  + A+   LR H  KPH + A D II  AV  A  IL          A    PAE   +        N    D  P           +  H +D  V+   V  L++    +          EL +++ E  +LL++L E   EY   L+  + +++  I  L+   G        ++++ S     +  L  WL   G  +  I  I+ E+Y+  + L++++++DL  L+L+GGV+ K+ +AI   +K+
Sbjct:  546 VRFPVLILEPTKVYQPSYLSINKDAEENTLSIWHVTPDDK-KGIHEWNFSAASVRGVSISKFDERSCFLYVVNNSEDFQIYFCTEMHCKRFCDLVNTVTEEAWKGSDE------NECESEALEYDYEYDEHGEKVVLGKGTFGVVYAGRDLSNQVRLAIKEIPERDSRYSQPLHEEIALHKHLKHKNIVQYLGSISENGFIKIFMEQVPGGSLSALLRSKWGPLKNNEPTIGFYTKQILDGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTETFTGTLQYMAPEIIDKGPRGYGKPADIWSLGCTIIEMATGKPPFYELGEPQAAMFKVGMFKIHPEIPDSMSSEAKAFILRCFEPDPDSRATANDLLTHEFLTVTS----RKKRSKTSSFTALTPG-------SEYLRSISLPVPVVVEDTSSSSEYGSVSPDNELCTNPFNFRPSSSSKSYSEREVKGHRSLFLSIPV---------------ENFEDHSAPPSP----------------EEKDSGFF-MLKKDSERRATLHRILTEDREKIVLHLLEALTQGSEETKLKHQHISTLVASLGD----FVRMADRKIIASTLSQLKLELDFDSTAISQLQVALFGFQDAVNKVLRNHNIKPHWMFALDNIIRKAVQTAIVILVPELRPHFTLASESDPAEQEDIDDDAVPQGNAALKDMAP-----------ALVHHDD-TVATSGVSTLSSTVSHESQSAQRSISMELGRMKLETKRLLEELVEKEREYQAILQQVLEDREQEIKLLKCRTGPIDAPVQLVNTRSSLDGDGDLQLLEWLKLHGADADSIERIIAEDYSLDDILHYVTRDDLKTLRLRGGVLCKLWSAITEHRKK 1362          

HSP 2 Score: 276.559 bits (706), Expect = 4.841e-75
Identity = 152/426 (35.68%), Postives = 248/426 (58.22%), Query Frame = 1
Query:  172 ISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKK-------TAGNSVTIILYNVNEKGRVGVLETQCMIA----MMTDNEDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRSREVLNFWLEFF 1416
            + F  LD+  T VLD FYNAD+ +++++   +Q +L +HLGVRE+  M+ NIIL     D   ++++SL+        T   + T I Y V  + +V   E+  M      M    E L   +C     L  +L  LL   +     + +E  LN++R+ RE  T  EL  +++ + +RLD+ E LS ++++N++LSYR IQ Y+ IV L+E+L    T   + +  HI++HYAFALNRRN  G+R+KAL ++        + V  D+  LVGRIYKD+F+ S +TD ++ ++   W+ +GF+ +P  + GINYA LL+  G+Q + S EL ++ + L+  +G KG++ RL  YWDV  F   S+LA D  + +QA+E +FK++ P+W L+S +  I +   F K   + P +  +E+++FW++F 
Sbjct:  117 VPFGKLDFGETSVLDHFYNADIAVVELTDAFRQPSLFYHLGVRESFCMVNNIILY---CDHNSDSLQSLQDLICQKNMTCAANYTFIPYMVTPQSKVYCCESSLMKGLSELMQPSFEALLGPIC---MPLLDRLTQLLTGCKSNTCQYFRETVLNEIRKARELYTGAELAAELRRIQQRLDNVECLSADVVINLLLSYRDIQDYESIVKLVETLEKLPTFDPVAHP-HIKFHYAFALNRRNLPGDRQKALDIMLPLVNS-DEQVASDIYCLVGRIYKDMFLDSHFTDTNSRDQGIHWFRRGFESEPTLHSGINYAVLLLAAGHQFDSSFELRKVGVKLSSLLGKKGSLDRLQSYWDVGFFLGASILACDNTRVIQASEKLFKIKAPIWYLRSLVETILIYKHFTKVSTD-PQAPKQELVDFWMDFM 533          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: daam1 (dishevelled associated activator of morphogenesis 1 [Source:Xenbase;Acc:XB-GENE-983772])

HSP 1 Score: 673.7 bits (1737), Expect = 0.000e+0
Identity = 429/1174 (36.54%), Postives = 636/1174 (54.17%), Query Frame = 1
Query:   91 QLYDYRKSAYDELEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKKTAGNSVTIILYNVNEKGRVGVLET---QCMIAMMTDN-EDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRSREVLNFWLEFFENTIHDCEEEVKQTQEENPNNIWSAKRRKSSVTPKVILTSSTRTETTIHDAAVNDEVNQIGDTEDCQNLDRRVMYPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFY---NVVKSEVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLK-KNGAL--TEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELI-KGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKARNQKNDITIPDKFDHRLMSNIERSSTLTKVIKENKQGCFSAPPMDV-SNSVPQNIRPISNRKRGQLLSIDLLLVIHMKTNKRFRSDESISDGNSFYSPDPPXXXXXXXXXXXXLETPSVGAFYMLRKETEARSELHKILKSVRNNVVSYWRELILEDDLKPLTYNHSCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANIL 3576
            +L+    +A   L++ C     + L  + F  LD+  T VLDTFYNAD+ +++M+   +Q +L +HLGVRE+  M  NIIL     D+  ++++SLK   GN  T I Y +  + +V   E+   + M  +M  N E L   +C     L  +   +LK  +     + +E  LND+RR R + T ++L  ++  + +R+D  ELLS +II+N++LSYR IQ YD +V L+E L    T     N  HI++HYAFALNRRN  G+R KAL ++    +   D V  D+  +VGRIYKD+F+ S + D ++ + A  WY K F+ +P  + GINYA LL+  G+Q   S EL +I + L+  +G KG + +L  YWDV  +    +LA D  K + AAE +FKL+ P W L S +  I +   F+ P     V+ + E+++FW++F                E   +N+ S  R      P +IL  +   + +        EV  I             ++ VL  D +GI +                  ++ P++ +R             G+S+SK  +   FLYV++ +DDF ++F +    ++F+   N +K E     EE         + + ++F+YEYD+N  R+VLG+G  G V+AGR+L+ Q++IAIKEV E   +  QPLHEEI LH RL H+NIV YLGS S+ G  KI MEQVPGGSL++LL+ K G L   E+T  +Y+ QILEGLKYLHDN+I+HRDIKGDNVL+N Y+G+LKISDFGTSKRL  I     TFTGT+QYMAPE+I KGP GYG PAD+WS GCTVIEM TGKPPF +LG P AA+FKVG F  HPD P+ +S EA  FL +CF PDP KRAT T L++  FL+ +       +K ++Q    T+    +  L S     S + +    + +    +P  D+ S+      R  S  ++   L+  L L I          DE+  D ++  SP+               E  S   F+ML+K++E R+ L+ IL   ++ V     + +++     L ++H    +  I+D    ++   D++ +   L +L+   D+     S+ Q++++  + A+   LR H  KPH + A D II  AV  A  IL
Sbjct:  105 ELHACEAAALYSLQEACENHGAL-LETLDFGKLDFGETSVLDTFYNADIAVVEMNDAFRQPSLFYHLGVRESFSMANNIILY---CDTNSDSLQSLKMCTGN-YTFIPYMITPQNKVFCCESIFMRGMTELMPSNFELLLGPIC---LPLVDRFVQILKVAQATSCQYFREAILNDIRRARNQYTGKDLAAELIRIRQRVDSIELLSPDIIINLLLSYRDIQDYDSVVTLVEILEKLPTFNLSSNH-HIKFHYAFALNRRNHPGDRVKALEIMLPLVQ-LEDQVASDIYCIVGRIYKDMFLDSNFMDTESRDNAIHWYRKAFESEPTLHSGINYAVLLLAAGHQFETSLELRKIGVKLSSLLGKKGNLEKLQSYWDVGFYLGACILANDSSKVIHAAEKLFKLKTPAWFLNSVVETILIYQHFKTPNQEQHVT-NHELVDFWMDFL--------------VESTSSNV-SVLR-----FPVLILEPTKIYQPSYLSINSEAEVQTIS------------IWHVLPGDKKGIHE------------------WNFPADSIR-------------GVSISKFEERCCFLYVLNNSDDFQIYFCTELHCKKFFDKVNRIKEENGKNTEE------GECDGDLMEFDYEYDENGDRVVLGKGKHGVVYAGRDLSNQVRIAIKEVPERDGRCSQPLHEEIALHKRLKHKNIVQYLGSFSKGGFIKIFMEQVPGGSLSALLRSKWGPLKDNEQTIGFYTKQILEGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPNTETFTGTLQYMAPEIIDKGPRGYGKPADIWSLGCTVIEMATGKPPFYELGEPQAAMFKVGMFKIHPDIPESMSSEAKAFLLRCFEPDPVKRATATELITDEFLKVS------SRKRKSQLKLTTLSSGSNEYLRSISLPVSVMVEDTSSSSEYSSVSPDSDLRSDPFTFKTRARSCIEKDVKLNRSLFLGI---------PDENFEDSSAPPSPE---------------ERDS--GFFMLKKDSERRATLYHILTEDQDKVARNLMDALVQGSEIKLKWDH----ITAIVDSLKEFVRSTDRKIISTTLSKLKLELDFDSHAISQVQMVLFGFQDAVNKVLRNHNIKPHWMFALDNIIRKAVQTAITIL 1162          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: daam1 (dishevelled associated activator of morphogenesis 1 [Source:Xenbase;Acc:XB-GENE-983772])

HSP 1 Score: 669.078 bits (1725), Expect = 0.000e+0
Identity = 426/1181 (36.07%), Postives = 636/1181 (53.85%), Query Frame = 1
Query:   91 QLYDYRKSAYDELEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKKTAG-------NSVTIILYNVNEKGRVGVLET---QCMIAMMTDN-EDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRSREVLNFWLEFFENTIHDCEEEVKQTQEENPNNIWSAKRRKSSVTPKVILTSSTRTETTIHDAAVNDEVNQIGDTEDCQNLDRRVMYPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFY---NVVKSEVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLK-KNGAL--TEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELI-KGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKARNQKNDITIPDKFDHRLMSNIERSSTLTKVIKENKQGCFSAPPMDV-SNSVPQNIRPISNRKRGQLLSIDLLLVIHMKTNKRFRSDESISDGNSFYSPDPPXXXXXXXXXXXXLETPSVGAFYMLRKETEARSELHKILKSVRNNVVSYWRELILEDDLKPLTYNHSCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANIL 3576
            +L+    +A   L++ C     + L  + F  LD+  T VLDTFYNAD+ +++M+   +Q +L +HLGVRE+  M  NIIL     D+  ++++SLK+  G        + T I Y +  + +V   E+   + M  +M  N E L   +C     L  +   +LK  +     + +E  LND+RR R + T ++L  ++  + +R+D  ELLS +II+N++LSYR IQ YD +V L+E L    T     N  HI++HYAFALNRRN  G+R KAL ++    +   D V  D+  +VGRIYKD+F+ S + D ++ + A  WY K F+ +P  + GINYA LL+  G+Q   S EL +I + L+  +G KG + +L  YWDV  +    +LA D  K + AAE +FKL+ P W L S +  I +   F+ P     V+ + E+++FW++F                E   +N+   +       P +IL  +   + +        EV  I             ++ VL  D +GI +                  ++ P++ +R             G+S+SK  +   FLYV++ +DDF ++F +    ++F+   N +K E     EE         + + ++F+YEYD+N  R+VLG+G  G V+AGR+L+ Q++IAIKEV E   +  QPLHEEI LH RL H+NIV YLGS S+ G  KI MEQVPGGSL++LL+ K G L   E+T  +Y+ QILEGLKYLHDN+I+HRDIKGDNVL+N Y+G+LKISDFGTSKRL  I     TFTGT+QYMAPE+I KGP GYG PAD+WS GCTVIEM TGKPPF +LG P AA+FKVG F  HPD P+ +S EA  FL +CF PDP KRAT T L++  FL+ +       +K ++Q    T+    +  L S     S + +    + +    +P  D+ S+      R  S  ++   L+  L L I          DE+  D ++  SP+               E  S   F+ML+K++E R+ L+ IL   ++ V     + +++     L ++H    +  I+D    ++   D++ +   L +L+   D+     S+ Q++++  + A+   LR H  KPH + A D II  AV  A  IL
Sbjct:  105 ELHACEAAALYSLQEACENHGAL-LETLDFGKLDFGETSVLDTFYNADIAVVEMNDAFRQPSLFYHLGVRESFSMANNIILY---CDTNSDSLQSLKEIIGQKNTMCTGNYTFIPYMITPQNKVFCCESIFMRGMTELMPSNFELLLGPIC---LPLVDRFVQILKVAQATSCQYFREAILNDIRRARNQYTGKDLAAELIRIRQRVDSIELLSPDIIINLLLSYRDIQDYDSVVTLVEILEKLPTFNLSSNH-HIKFHYAFALNRRNHPGDRVKALEIMLPLVQ-LEDQVASDIYCIVGRIYKDMFLDSNFMDTESRDNAIHWYRKAFESEPTLHSGINYAVLLLAAGHQFETSLELRKIGVKLSSLLGKKGNLEKLQSYWDVGFYLGACILANDSSKVIHAAEKLFKLKTPAWFLNSVVETILIYQHFKTPNQEQHVT-NHELVDFWMDFL--------------VESTSSNVSVLR------FPVLILEPTKIYQPSYLSINSEAEVQTIS------------IWHVLPGDKKGIHE------------------WNFPADSIR-------------GVSISKFEERCCFLYVLNNSDDFQIYFCTELHCKKFFDKVNRIKEENGKNTEE------GECDGDLMEFDYEYDENGDRVVLGKGKHGVVYAGRDLSNQVRIAIKEVPERDGRCSQPLHEEIALHKRLKHKNIVQYLGSFSKGGFIKIFMEQVPGGSLSALLRSKWGPLKDNEQTIGFYTKQILEGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPNTETFTGTLQYMAPEIIDKGPRGYGKPADIWSLGCTVIEMATGKPPFYELGEPQAAMFKVGMFKIHPDIPESMSSEAKAFLLRCFEPDPVKRATATELITDEFLKVS------SRKRKSQLKLTTLSSGSNEYLRSISLPVSVMVEDTSSSSEYSSVSPDSDLRSDPFTFKTRARSCIEKDVKLNRSLFLGI---------PDENFEDSSAPPSPE---------------ERDS--GFFMLKKDSERRATLYHILTEDQDKVARNLMDALVQGSEIKLKWDH----ITAIVDSLKEFVRSTDRKIISTTLSKLKLELDFDSHAISQVQMVLFGFQDAVNKVLRNHNIKPHWMFALDNIIRKAVQTAITIL 1170          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: daam1 (dishevelled associated activator of morphogenesis 1 [Source:Xenbase;Acc:XB-GENE-983772])

HSP 1 Score: 669.078 bits (1725), Expect = 0.000e+0
Identity = 428/1181 (36.24%), Postives = 637/1181 (53.94%), Query Frame = 1
Query:   91 QLYDYRKSAYDELEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKKTAG-------NSVTIILYNVNEKGRVGVLET---QCMIAMMTDN-EDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRSREVLNFWLEFFENTIHDCEEEVKQTQEENPNNIWSAKRRKSSVTPKVILTSSTRTETTIHDAAVNDEVNQIGDTEDCQNLDRRVMYPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFY---NVVKSEVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLK-KNGAL--TEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELI-KGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKARNQKNDITIPDKFDHRLMSNIERSSTLTKVIKENKQGCFSAPPMDV-SNSVPQNIRPISNRKRGQLLSIDLLLVIHMKTNKRFRSDESISDGNSFYSPDPPXXXXXXXXXXXXLETPSVGAFYMLRKETEARSELHKILKSVRNNVVSYWRELILEDDLKPLTYNHSCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANIL 3576
            +L+    +A   L++ C     + L  + F  LD+  T VLDTFYNAD+ +++M+   +Q +L +HLGVRE+  M  NIIL     D+  ++++SLK+  G        + T I Y +  + +V   E+   + M  +M  N E L   +C     L  +   +LK  +     + +E  LND+RR R + T ++L  ++  + +R+D  ELLS +II+N++LSYR IQ YD +V L+E L    T     N  HI++HYAFALNRRN  G+R KAL ++    +   D V  D+  +VGRIYKD+F+ S + D ++ + A  WY K F+ +P  + GINYA LL+  G+Q   S EL +I + L+  +G KG + +L  YWDV  +    +LA D  K + AAE +FKL+ P W L S +  I +   F+ P     V+ + E+++FW++F                E   +N+ S  R      P +IL  +   + +        EV  I             ++ VL  D +GI +                  ++ P++ +R             G+S+SK  +   FLYV++ +DDF ++F +    ++F+   N +K E     EE         + + ++F+YEYD+N  R+VLG+G  G V+AGR+L+ Q++IAIKEV E   +  QPLHEEI LH RL H+NIV YLGS S+ G  KI MEQVPGGSL++LL+ K G L   E+T  +Y+ QILEGLKYLHDN+I+HRDIKGDNVL+N Y+G+LKISDFGTSKRL  I     TFTGT+QYMAPE+I KGP GYG PAD+WS GCTVIEM TGKPPF +LG P AA+FKVG F  HPD P+ +S EA  FL +CF PDP KRAT T L++  FL+ +       +K ++Q    T+    +  L S     S + +    + +    +P  D+ S+      R  S  ++   L+  L L I          DE+  D ++  SP+               E  S   F+ML+K++E R+ L+ IL   ++ V     + +++     L ++H    +  I+D    ++   D++ +   L +L+   D+     S+ Q++++  + A+   LR H  KPH + A D II  AV  A  IL
Sbjct:  105 ELHACEAAALYSLQEACENHGAL-LETLDFGKLDFGETSVLDTFYNADIAVVEMNDAFRQPSLFYHLGVRESFSMANNIILY---CDTNSDSLQSLKEIIGQKNTMCTGNYTFIPYMITPQNKVFCCESIFMRGMTELMPSNFELLLGPIC---LPLVDRFVQILKVAQATSCQYFREAILNDIRRARNQYTGKDLAAELIRIRQRVDSIELLSPDIIINLLLSYRDIQDYDSVVTLVEILEKLPTFNLSSNH-HIKFHYAFALNRRNHPGDRVKALEIMLPLVQ-LEDQVASDIYCIVGRIYKDMFLDSNFMDTESRDNAIHWYRKAFESEPTLHSGINYAVLLLAAGHQFETSLELRKIGVKLSSLLGKKGNLEKLQSYWDVGFYLGACILANDSSKVIHAAEKLFKLKTPAWFLNSVVETILIYQHFKTPNQEQHVT-NHELVDFWMDFL--------------VESTSSNV-SVLR-----FPVLILEPTKIYQPSYLSINSEAEVQTIS------------IWHVLPGDKKGIHE------------------WNFPADSIR-------------GVSISKFEERCCFLYVLNNSDDFQIYFCTELHCKKFFDKVNRIKEENGKNTEE------GECDGDLMEFDYEYDENGDRVVLGKGKHGVVYAGRDLSNQVRIAIKEVPERDGRCSQPLHEEIALHKRLKHKNIVQYLGSFSKGGFIKIFMEQVPGGSLSALLRSKWGPLKDNEQTIGFYTKQILEGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPNTETFTGTLQYMAPEIIDKGPRGYGKPADIWSLGCTVIEMATGKPPFYELGEPQAAMFKVGMFKIHPDIPESMSSEAKAFLLRCFEPDPVKRATATELITDEFLKVS------SRKRKSQLKLTTLSSGSNEYLRSISLPVSVMVEDTSSSSEYSSVSPDSDLRSDPFTFKTRARSCIEKDVKLNRSLFLGI---------PDENFEDSSAPPSPE---------------ERDS--GFFMLKKDSERRATLYHILTEDQDKVARNLMDALVQGSEIKLKWDH----ITAIVDSLKEFVRSTDRKIISTTLSKLKLELDFDSHAISQVQMVLFGFQDAVNKVLRNHNIKPHWMFALDNIIRKAVQTAITIL 1170          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: daam1 (dishevelled associated activator of morphogenesis 1 [Source:Xenbase;Acc:XB-GENE-983772])

HSP 1 Score: 668.307 bits (1723), Expect = 0.000e+0
Identity = 432/1204 (35.88%), Postives = 636/1204 (52.82%), Query Frame = 1
Query:   91 QLYDYRKSAYDELEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKKTAG-------NSVTIILYNVNEKGRVGVLET---QCMIAMMTDN-EDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRSREVLNFWLEFFENTIHDCEEEVKQTQEENPNNIWSAKRRKSSVTPKVILTSSTRTETTIHDAAVNDEVNQIGDTEDCQNLDRRVMYPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKSEVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLK-KNGAL--TEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELI-KGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKARNQKNDITIPDKFDHRLMSNIERSSTLTKVIKENKQGCFSAPPMDV-SNSVPQNIRPISNRKRGQLLSIDLLLVIHMKTNKRFRSDESISDGNSFYSPDPPXXXXXXXXXXXXLETPSVGAFYMLRKETEARSELHKILKSVRNNVVSYWRELILEDDLKPLTYNHSCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANILFKAGIFRLFDADPQTPAESHYLKPFC 3654
            +L+    +A   L++ C     + L  + F  LD+  T VLDTFYNAD+ +++M+   +Q +L +HLGVRE+  M  NIIL     D+  ++++SLK+  G        + T I Y +  + +V   E+   + M  +M  N E L   +C     L  +   +LK  +     + +E  LND+RR R + T ++L  ++  + +R+D  ELLS +II+N++LSYR IQ YD +V L+E L    T     N  HI++HYAFALNRRN  G+R KAL ++    +   D V  D+  +VGRIYKD+F+ S + D ++ + A  WY K F+ +P  + GINYA LL+  G+Q   S EL +I + L+  +G KG + +L  YWDV  +    +LA D  K + AAE +FKL+ P W L S +  I +   F+ P     V+ + E+++FW++F                E   +N+ S  R      P +IL  +   + +        EV  I             ++ VL  D +GI +                  ++ P++ +R             G+S+SK  +   FLYV++ +DDF ++F          N +K E     EE         + + ++F+YEYD+N  R+VLG+G  G V+AGR+L+ Q++IAIKEV E   +  QPLHEEI LH RL H+NIV YLGS S+ G  KI MEQVPGGSL++LL+ K G L   E+T  +Y+ QILEGLKYLHDN+I+HRDIKGDNVL+N Y+G+LKISDFGTSKRL  I     TFTGT+QYMAPE+I KGP GYG PAD+WS GCTVIEM TGKPPF +LG P AA+FKVG F  HPD P+ +S EA  FL +CF PDP KRAT T L++  FL           K  ++K +I++P              S + +    + +    +P  D+ S+      R  S  ++   L+  L L I          DE+  D ++  SP+               E  S   F+ML+K++E R+ L+ IL   ++ V     + +++     L ++H    +  I+D    ++   D++ +   L +L+   D+     S+ Q++++  + A+   LR H  KPH + A D II  AV  A  IL               P ESH  +P C
Sbjct:   85 ELHACEAAALYSLQEACENHGAL-LETLDFGKLDFGETSVLDTFYNADIAVVEMNDAFRQPSLFYHLGVRESFSMANNIILY---CDTNSDSLQSLKEIIGQKNTMCTGNYTFIPYMITPQNKVFCCESIFMRGMTELMPSNFELLLGPIC---LPLVDRFVQILKVAQATSCQYFREAILNDIRRARNQYTGKDLAAELIRIRQRVDSIELLSPDIIINLLLSYRDIQDYDSVVTLVEILEKLPTFNLSSNH-HIKFHYAFALNRRNHPGDRVKALEIMLPLVQ-LEDQVASDIYCIVGRIYKDMFLDSNFMDTESRDNAIHWYRKAFESEPTLHSGINYAVLLLAAGHQFETSLELRKIGVKLSSLLGKKGNLEKLQSYWDVGFYLGACILANDSSKVIHAAEKLFKLKTPAWFLNSVVETILIYQHFKTPNQEQHVT-NHELVDFWMDFL--------------VESTSSNV-SVLR-----FPVLILEPTKIYQPSYLSINSEAEVQTIS------------IWHVLPGDKKGIHE------------------WNFPADSIR-------------GVSISKFEERCCFLYVLNNSDDFQIYF----CTELHLNRIKEENGKNTEE------GECDGDLMEFDYEYDENGDRVVLGKGKHGVVYAGRDLSNQVRIAIKEVPERDGRCSQPLHEEIALHKRLKHKNIVQYLGSFSKGGFIKIFMEQVPGGSLSALLRSKWGPLKDNEQTIGFYTKQILEGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPNTETFTGTLQYMAPEIIDKGPRGYGKPADIWSLGCTVIEMATGKPPFYELGEPQAAMFKVGMFKIHPDIPESMSSEAKAFLLRCFEPDPVKRATATELITDEFL-----------KVSSRKRNISLP-------------VSVMVEDTSSSSEYSSVSPDSDLRSDPFTFKTRARSCIEKDVKLNRSLFLGI---------PDENFEDSSAPPSPE---------------ERDS--GFFMLKKDSERRATLYHILTEDQDKVARNLMDALVQGSEIKLKWDH----ITAIVDSLKEFVRSTDRKIISTTLSKLKLELDFDSHAISQVQMVLFGFQDAVNKVLRNHNIKPHWMFALDNIIRKAVQTAITIL--------------VPGESHIYRPMC 1137          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: daam1 (dishevelled associated activator of morphogenesis 1 [Source:Xenbase;Acc:XB-GENE-983772])

HSP 1 Score: 636.721 bits (1641), Expect = 0.000e+0
Identity = 372/932 (39.91%), Postives = 535/932 (57.40%), Query Frame = 1
Query:   91 QLYDYRKSAYDELEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKKTAG-------NSVTIILYNVNEKGRVGVLET---QCMIAMMTDN-EDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRSREVLNFWLEFFENTIHDCEEEVKQTQEENPNNIWSAKRRKSSVTPKVILTSSTRTETTIHDAAVNDEVNQIGDTEDCQNLDRRVMYPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFY---NVVKSEVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLK-KNGAL--TEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELI-KGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKARNQKN 2832
            +L+    +A   L++ C     + L  + F  LD+  T VLDTFYNAD+ +++M+   +Q +L +HLGVRE+  M  NIIL     D+  ++++SLK+  G        + T I Y +  + +V   E+   + M  +M  N E L   +C     L  +   +LK  +     + +E  LND+RR R + T ++L  ++  + +R+D  ELLS +II+N++LSYR IQ YD +V L+E L    T     N  HI++HYAFALNRRN  G+R KAL ++    +   D V  D+  +VGRIYKD+F+ S + D ++ + A  WY K F+ +P  + GINYA LL+  G+Q   S EL +I + L+  +G KG + +L  YWDV  +    +LA D  K + AAE +FKL+ P W L S +  I +   F+ P     V+ + E+++FW++F                E   +N+ S  R      P +IL  +   + +        EV  I             ++ VL  D +GI +                  ++ P++ +R             G+S+SK  +   FLYV++ +DDF ++F +    ++F+   N +K E     EE         + + ++F+YEYD+N  R+VLG+G  G V+AGR+L+ Q++IAIKEV E   +  QPLHEEI LH RL H+NIV YLGS S+ G  KI MEQVPGGSL++LL+ K G L   E+T  +Y+ QILEGLKYLHDN+I+HRDIKGDNVL+N Y+G+LKISDFGTSKRL  I     TFTGT+QYMAPE+I KGP GYG PAD+WS GCTVIEM TGKPPF +LG P AA+FKVG F  HPD P+ +S EA  FL +CF PDP KRAT T L++  FL+ + +    + K  +++N
Sbjct:   73 ELHACEAAALYSLQEACENHGAL-LETLDFGKLDFGETSVLDTFYNADIAVVEMNDAFRQPSLFYHLGVRESFSMANNIILY---CDTNSDSLQSLKEIIGQKNTMCTGNYTFIPYMITPQNKVFCCESIFMRGMTELMPSNFELLLGPIC---LPLVDRFVQILKVAQATSCQYFREAILNDIRRARNQYTGKDLAAELIRIRQRVDSIELLSPDIIINLLLSYRDIQDYDSVVTLVEILEKLPTFNLSSNH-HIKFHYAFALNRRNHPGDRVKALEIMLPLVQ-LEDQVASDIYCIVGRIYKDMFLDSNFMDTESRDNAIHWYRKAFESEPTLHSGINYAVLLLAAGHQFETSLELRKIGVKLSSLLGKKGNLEKLQSYWDVGFYLGACILANDSSKVIHAAEKLFKLKTPAWFLNSVVETILIYQHFKTPNQEQHVT-NHELVDFWMDFL--------------VESTSSNV-SVLR-----FPVLILEPTKIYQPSYLSINSEAEVQTIS------------IWHVLPGDKKGIHE------------------WNFPADSIR-------------GVSISKFEERCCFLYVLNNSDDFQIYFCTELHCKKFFDKVNRIKEENGKNTEE------GECDGDLMEFDYEYDENGDRVVLGKGKHGVVYAGRDLSNQVRIAIKEVPERDGRCSQPLHEEIALHKRLKHKNIVQYLGSFSKGGFIKIFMEQVPGGSLSALLRSKWGPLKDNEQTIGFYTKQILEGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPNTETFTGTLQYMAPEIIDKGPRGYGKPADIWSLGCTVIEMATGKPPFYELGEPQAAMFKVGMFKIHPDIPESMSSEAKAFLLRCFEPDPVKRATATELITDEFLKVSSRKRKSQLKLTSKEN 925          

HSP 2 Score: 58.151 bits (139), Expect = 1.407e-7
Identity = 36/134 (26.87%), Postives = 68/134 (50.75%), Query Frame = 1
Query: 3175 AFYMLRKETEARSELHKILKSVRNNVVSYWRELILEDDLKPLTYNHSCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANIL 3576
             F+ML+K++E R+ L+ IL   ++ V     + +++     L ++H    +  I+D    ++   D++ +   L +L+   D+     S+ Q++++  + A+   LR H  KPH + A D II  AV  A  IL
Sbjct:  959 GFFMLKKDSERRATLYHILTEDQDKVARNLMDALVQGSEIKLKWDH----ITAIVDSLKEFVRSTDRKIISTTLSKLKLELDFDSHAISQVQMVLFGFQDAVNKVLRNHNIKPHWMFALDNIIRKAVQTAITIL 1088          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Map3k5 (mitogen-activated protein kinase kinase kinase 5 [Source:MGI Symbol;Acc:MGI:1346876])

HSP 1 Score: 722.235 bits (1863), Expect = 0.000e+0
Identity = 475/1392 (34.12%), Postives = 720/1392 (51.72%), Query Frame = 1
Query:   79 CNDAQLYDYRKSAYDELEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKKTAGNSVTIILYNVNEKGRVGVLETQCMIA----MMTDNEDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRSREVLNFWLEFFENTIHDCEEEVKQTQEENPNNIWSAKRRKSSVTPKVILTSSTRTETTIHDAAVNDEVNQIGDTEDCQNLDRRVMYPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFY---NVVKSEVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLK-KNGAL--TEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELI-KGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKARNQKNDITIPDKFDHRLMSNIERSSTLTKVIKENKQGCFSAPPMDVSNSVPQNIRPISNRKRGQLLSIDLLLVIHMKTNKRFRS------DESISDGNSFYSPDPPXXXXXXXXXXXXLETPSVGAFYMLRKETEARSELHKILKSVRNNVVSYWRELILEDDLKP-LTYNHSCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANILFKAGIFRLFDADPQTPAESHYLKPFCQTNENTKFSDRRPLSRSTGITGADSNPHENDFHVSAMIVDDLTTNDIWQPPFMNFDFKNELVKLQNENNKLLQDLCETTSEYNRHLKHCISEKKNHIDYLRATLGEKLITXXXXXXXXXXXXXXEN--LKNWLNEIGXXXXXXXXXXNEEYTFHEFLYFISKEDLYKLQLKGGVVLKILAAI 4194
             +  QL      A   L + C  A   +L  + F  LD+  T VLD FYNAD+ +++MS   +Q +L +HLGVRE+  M  NIIL     D+  ++++SLK   GN  T I Y V    +V   ++  M      M  + E L   +C     L  +   LLK  +     + +E  L+D+R+ R   T +EL  ++  + +R+D+ E+L+ +I++N++LSYR IQ YD IV L+E+L    T   + +  H+++HYAFALNRRN  G+R KAL ++    +   + V  DM  LVGRIYKD+F+ S +TD ++ +   SW++K F+ +P    GINYA LL+  G+Q   S EL ++ + L+  +G KG + +L  YW+V  F   SVLA D+ + +QA+E +F+L+ P W LKS +  I +   F K     P S  +E+++FW++F                                      L  +T+T+ T+                        V +PVL+ +   I QP++L +N   + K+I +W+  P ++ + + +W F    ++G+S+SK  +   FLYV+  +DDF ++F +    + F+   N +  E   G E+         E + ++++YEYD+N  R+VLG+GT+G V+AGR+L+ Q++IAIKE+ E   +  QPLHEEI LH  L H+NIV YLGS SE G  KI MEQVPGGSL++LL+ K G L   E+T  +Y+ QILEGLKYLHDN+I+HRDIKGDNVL+N Y+G+LKISDFGTSKRL  I     TFTGT+QYMAPE+I KGP GYG  AD+WS GCT+IEM TGKPPF +LG P AA+FKVG F  HP+ P+ +S EA  F+ KCF PDP+KRA    LL   FL+ +       KK + Q     +    +  L S       L +    + +    +P  ++         P S + R +            K  K  R+      DE+  D ++  SP                E    G F MLRK++E R+ LH+IL   ++ VV    E + +   +P L + H   L+  + +    ++   D++ +   L +L+   D+     S+ Q++++  + A+   LR H  KPH + A D II  AV  A  IL          A     A+   L      +E+ + S  + + R   IT       E+    S +     T +   Q    + +   +L +++ E N+LL++L     E    L   I EK   I +L+       I    +    S   + E+  L  WL E G     IS  + E+YT  + LY+++++DL  L+L+GG++  +  AI
Sbjct:  107 ASQGQLVVAESEALQSLREACE-AVGATLETLHFGKLDFGETAVLDRFYNADIAVVEMSDAFRQPSLFYHLGVRESFSMANNIILY---CDTNSDSLQSLKVCTGN-YTFIPYMVTPHNKVYCCDSSFMKGLTELMQPNFELLLGPIC---LPLVDRFVQLLKVAQASSSQYFRESILSDIRKARNLYTGKELAAELARIRQRVDNIEVLTADIVINLLLSYRDIQDYDSIVKLVETLEKLPTFD-LASHHHVKFHYAFALNRRNLPGDRAKALDIMIPMVQS-EEQVASDMYCLVGRIYKDMFLDSNFTDTESRDHGASWFKKAFESEPTLQSGINYAVLLLAAGHQFESSFELRKVGVKLSSLLGKKGNLEKLQSYWEVGFFLGASVLANDHLRVIQASEKLFRLKTPAWYLKSIVETILIYKHFVKLTTEQP-SAKQELVDFWMDF--------------------------------------LVEATKTDVTV------------------------VRFPVLILEPTKIYQPSYLSINNEVEEKTISIWHVLPDDK-KGIHEWNFGASSVRGVSISKFEERCCFLYVLHNSDDFQIYFCTELHCKRFFEMVNTITEEKGRGAED------GDCEGDSLEYDYEYDENGDRVVLGKGTYGIVYAGRDLSNQVRIAIKEIPERDSRYSQPLHEEIALHKHLKHKNIVQYLGSFSENGFIKIFMEQVPGGSLSALLRSKWGPLKDNEQTIGFYTKQILEGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTETFTGTLQYMAPEIIDKGPRGYGKAADIWSLGCTIIEMATGKPPFYELGEPQAAMFKVGMFKVHPEIPESMSAEAKAFILKCFEPDPDKRACANDLLIDEFLKVS------SKKKKTQPKLSALSTGSNEYLRSISLPVPVLVEDTSSSSEYGSVSPDTELKAD------PFSFKARAKSCG--------EKDGKGIRTLFLGIPDENFEDHSAPPSP----------------EEKDSGFF-MLRKDSERRATLHRILTEDQDKVVRNLMESLAQGAEEPKLKWEHITTLISSLRE----FVRSTDRKIIATTLSKLKLELDFDSHGISQVQVVLFGFQDAVNKVLRNHNIKPHWMFALDSIIRKAVQTAITILVPELRPHFSLASESDTADPEDLD---VEDEHEELSSNQTVRRPQAIT-------EDAVATSGVSTLSSTVSHDSQNAHRSLNV--QLGRMKIETNRLLEELVRKERELQALLHQAIEEKDQEIRHLKLKSQPIDIPGFPVCHLNSPGTTTEDSELPGWLRENGADEDTISRFLAEDYTLVDVLYYVTRDDLKCLRLRGGMLCTLWKAI 1365          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Map3k5 (mitogen-activated protein kinase kinase kinase 5 [Source:MGI Symbol;Acc:MGI:1346876])

HSP 1 Score: 716.072 bits (1847), Expect = 0.000e+0
Identity = 475/1399 (33.95%), Postives = 721/1399 (51.54%), Query Frame = 1
Query:   82 NDAQLYDYRKSAYDELEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKK--------TAGNSVTIILYNVNEKGRVGVLETQCMIA----MMTDNEDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRSREVLNFWLEFFENTIHDCEEEVKQTQEENPNNIWSAKRRKSSVTPKVILTSSTRTETTIHDAAVNDEVNQIGDTEDCQNLDRRVMYPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFY---NVVKSEVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLK-KNGAL--TEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELI-KGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKARNQKNDITIPDKFDHRLMSNIERSSTLTKVIKENKQGCFSAPPMDVSNSVPQNIRPISNRKRGQLLSIDLLLVIHMKTNKRFRS------DESISDGNSFYSPDPPXXXXXXXXXXXXLETPSVGAFYMLRKETEARSELHKILKSVRNNVVSYWRELILEDDLKP-LTYNHSCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANILFKAGIFRLFDADPQTPAESHYLKPFCQTNENTKFSDRRPLSRSTGITGADSNPHENDFHVSAMIVDDLTTNDIWQPPFMNFDFKNELVKLQNENNKLLQDLCETTSEYNRHLKHCISEKKNHIDYLRATLGEKLITXXXXXXXXXXXXXXEN--LKNWLNEIGXXXXXXXXXXNEEYTFHEFLYFISKEDLYKLQLKGGVVLKILAAI 4194
            +  QL      A   L + C  A   +L  + F  LD+  T VLD FYNAD+ +++MS   +Q +L +HLGVRE+  M  NIIL     D+  ++++SLK+          GN  T I Y V    +V   ++  M      M  + E L   +C     L  +   LLK  +     + +E  L+D+R+ R   T +EL  ++  + +R+D+ E+L+ +I++N++LSYR IQ YD IV L+E+L    T   + +  H+++HYAFALNRRN  G+R KAL ++    +   + V  DM  LVGRIYKD+F+ S +TD ++ +   SW++K F+ +P    GINYA LL+  G+Q   S EL ++ + L+  +G KG + +L  YW+V  F   SVLA D+ + +QA+E +F+L+ P W LKS +  I +   F K     P S  +E+++FW++F                                      L  +T+T+ T+                        V +PVL+ +   I QP++L +N   + K+I +W+  P ++ + + +W F    ++G+S+SK  +   FLYV+  +DDF ++F +    + F+   N +  E   G E+         E + ++++YEYD+N  R+VLG+GT+G V+AGR+L+ Q++IAIKE+ E   +  QPLHEEI LH  L H+NIV YLGS SE G  KI MEQVPGGSL++LL+ K G L   E+T  +Y+ QILEGLKYLHDN+I+HRDIKGDNVL+N Y+G+LKISDFGTSKRL  I     TFTGT+QYMAPE+I KGP GYG  AD+WS GCT+IEM TGKPPF +LG P AA+FKVG F  HP+ P+ +S EA  F+ KCF PDP+KRA    LL   FL+ +       KK + Q     +    +  L S       L +    + +    +P  ++         P S + R +            K  K  R+      DE+  D ++  SP                E    G F MLRK++E R+ LH+IL   ++ VV    E + +   +P L + H   L+  + +    ++   D++ +   L +L+   D+     S+ Q++++  + A+   LR H  KPH + A D II  AV  A  IL          A     A+   L      +E+ + S  + + R   IT       E+    S +     T +   Q    + +   +L +++ E N+LL++L     E    L   I EK   I +L+       I    +    S   + E+  L  WL E G     IS  + E+YT  + LY+++++DL  L+L+GG++  +  AI
Sbjct:  108 SQGQLVVAESEALQSLREACE-AVGATLETLHFGKLDFGETAVLDRFYNADIAVVEMSDAFRQPSLFYHLGVRESFSMANNIILY---CDTNSDSLQSLKEIICQKNTVCTGN-YTFIPYMVTPHNKVYCCDSSFMKGLTELMQPNFELLLGPIC---LPLVDRFVQLLKVAQASSSQYFRESILSDIRKARNLYTGKELAAELARIRQRVDNIEVLTADIVINLLLSYRDIQDYDSIVKLVETLEKLPTFD-LASHHHVKFHYAFALNRRNLPGDRAKALDIMIPMVQS-EEQVASDMYCLVGRIYKDMFLDSNFTDTESRDHGASWFKKAFESEPTLQSGINYAVLLLAAGHQFESSFELRKVGVKLSSLLGKKGNLEKLQSYWEVGFFLGASVLANDHLRVIQASEKLFRLKTPAWYLKSIVETILIYKHFVKLTTEQP-SAKQELVDFWMDF--------------------------------------LVEATKTDVTV------------------------VRFPVLILEPTKIYQPSYLSINNEVEEKTISIWHVLPDDK-KGIHEWNFGASSVRGVSISKFEERCCFLYVLHNSDDFQIYFCTELHCKRFFEMVNTITEEKGRGAED------GDCEGDSLEYDYEYDENGDRVVLGKGTYGIVYAGRDLSNQVRIAIKEIPERDSRYSQPLHEEIALHKHLKHKNIVQYLGSFSENGFIKIFMEQVPGGSLSALLRSKWGPLKDNEQTIGFYTKQILEGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTETFTGTLQYMAPEIIDKGPRGYGKAADIWSLGCTIIEMATGKPPFYELGEPQAAMFKVGMFKVHPEIPESMSAEAKAFILKCFEPDPDKRACANDLLIDEFLKVS------SKKKKTQPKLSALSTGSNEYLRSISLPVPVLVEDTSSSSEYGSVSPDTELKAD------PFSFKARAKSCG--------EKDGKGIRTLFLGIPDENFEDHSAPPSP----------------EEKDSGFF-MLRKDSERRATLHRILTEDQDKVVRNLMESLAQGAEEPKLKWEHITTLISSLRE----FVRSTDRKIIATTLSKLKLELDFDSHGISQVQVVLFGFQDAVNKVLRNHNIKPHWMFALDSIIRKAVQTAITILVPELRPHFSLASESDTADPEDLD---VEDEHEELSSNQTVRRPQAIT-------EDAVATSGVSTLSSTVSHDSQNAHRSLNV--QLGRMKIETNRLLEELVRKERELQALLHQAIEEKDQEIRHLKLKSQPIDIPGFPVCHLNSPGTTTEDSELPGWLRENGADEDTISRFLAEDYTLVDVLYYVTRDDLKCLRLRGGMLCTLWKAI 1373          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Map3k15 (mitogen-activated protein kinase kinase kinase 15 [Source:MGI Symbol;Acc:MGI:2448588])

HSP 1 Score: 418.698 bits (1075), Expect = 6.490e-123
Identity = 201/396 (50.76%), Postives = 277/396 (69.95%), Query Frame = 1
Query: 1639 YPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKSEVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLK-KNGALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELI-KGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKAR 2820
            +PVLV +   + QP+++ +N  ++ +++ LW+  P+E ++ + +W FT   IKGISLSK  +   FLYV   +DDF ++F +      F ++VK  + +G    + +  +  + + +++EY++D N +R+VLG+G++G V+AGR+L+ Q++IAIKE+ E  I+  QPLHEEI LH  L HRNIV YLGS SE G  KI MEQVPGGSL++LL+ K G + E T  +Y+ QILEGLKYLH+N+I+HRDIKGDNVLVN Y+G++KISDFGTSKRL  I     TFTGT+QYMAPE+I +GP GYG PAD+WS GCT+IEM T +PPF++LG P AA+FKVG F  HP+ P+ LS EA  F+  CF PDP KR T   LL   FL    + ++K KK R
Sbjct:  533 FPVLVIEPTKVYQPSYVSINNEAEERTVSLWHVSPTE-MKQIHEWNFTASSIKGISLSKFDERCCFLYVHDNSDDFQIYFSTEDQCNRFCSLVKEMLNNGVGSTVELEGEA-DGDTLEYEYDHDANGERVVLGKGSYGIVYAGRDLSNQVRIAIKEIPERDIRYSQPLHEEIALHKYLKHRNIVQYLGSVSENGYIKIFMEQVPGGSLSALLRSKWGPMKEPTIKFYTKQILEGLKYLHENQIVHRDIKGDNVLVNTYSGVVKISDFGTSKRLAGINPCTETFTGTLQYMAPEIIDQGPRGYGAPADIWSLGCTIIEMATSRPPFHELGEPQAAMFKVGMFKIHPEIPEALSAEARAFILSCFEPDPQKRVTAADLLQEGFL----RQVNKGKKNR 922          

HSP 2 Score: 308.145 bits (788), Expect = 2.674e-85
Identity = 183/445 (41.12%), Postives = 263/445 (59.10%), Query Frame = 1
Query:  127 LEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKK--TAGNSVT-----IILYNVNEKGRVGVLETQCMIA----MMTDNEDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRSREVLNFWLE-FFENT 1425
            L + C  A+   L  + F  LD+  T VLD FY+AD+ I+DMS   +Q +L +HLGVRE+  M  N+IL Y   D+  +T  SLK   T  N+ +      I Y V         E+         M  + + +   +C     L  +  +LLK++ V   A+ KE  LND+R+ RE+   +EL +++  +  R+D+ E+L+++II+N++LSYR IQ YD +V L+E+L    T   + +  +I++HYAFALNRRN  G+REKAL V+ +  +   D   PDM  L GRIYKDIF+ S   +  + + A  WY KGF+LQ + Y GIN A LL++ G Q   S EL +I + LN  +G KG++ ++ +YWDV  FF VS+LA D  KAVQAAE +FKL+PPVW L+S + N+ LI  F+KP   T  S  +E LNFWL+  FE T
Sbjct:   91 LLRACE-AEGAHLTSVPFGELDFGETAVLDAFYDADVAIVDMSDISRQPSLFYHLGVRESFDMANNVILYY---DTDADTALSLKDMVTQKNTASSGNYYFIPYTVTPCADYFCCESDAQRRASEYMQPNWDTILGPLC---MPLVDRFTSLLKDIRVTSCAYYKETLLNDIRKAREKYQGDELAKELTRIKFRMDNIEVLTSDIIINLLLSYRDIQDYDAMVKLVETLKMLPTCD-LADQHNIKFHYAFALNRRNSTGDREKALQVMLQVLQS-CDHPAPDMFCLCGRIYKDIFLDSGCEEDASRDSAIEWYRKGFELQSSLYSGINLAVLLIVSGQQFETSMELRKIGVRLNSLLGRKGSLEKMNNYWDVGQFFTVSMLASDIGKAVQAAERLFKLKPPVWYLRSLVQNLLLIQRFKKP--ITEHSPRQERLNFWLDIIFEAT 524          

HSP 3 Score: 80.8777 bits (198), Expect = 1.151e-14
Identity = 83/365 (22.74%), Postives = 162/365 (44.38%), Query Frame = 1
Query: 3175 AFYMLRKETEARSELHKILKSVRNNVVSYWRELILEDDLKPLTYNHSCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANILFKAGIFRLFDADPQTPAESHYLKPFCQT---NENTKFSDRRPL--------------SRSTGITGADSNPHENDFHVSAMIVDDLTTNDIWQPPFMNFDFKNELVKLQNENNKLLQDLCETTSEYNRHLKHCISEKKNHIDYLRATLGEKLITXXXXXXXXXXXXXXENLKNWLNEIGXXXXXXXXXXNEEYTFHEFLYFISKEDLYKLQLKGGVVLKILAAIERKKKELE 4218
              ++LRK++E R+ L++IL   +N V S  +E +++   + L    S + ++ I+ +  +++   +   +   + +L+   D+     ++  LI++  + A+   LR H+ +PH + A D II  AV  A  IL               P    + +P  +T   +++T+     PL              +R   +   +  PH+ D  +                         +L KL+ E N+L + L +   EY   L+  + +K   + +L+  L  K    +        L +D  L +WL   GV ++ I  IV E+YT  + L  I+KEDL  L+L+GGV+ ++  A+ + +++++
Sbjct: 1007 GLFLLRKDSERRAILYRILWEEQNQVASNLQECVVQSSEELLL---SVSHIKQIIGILRDFIRSPEHRVMAATISKLKVDLDFDSSSINQIHLILFGFQDAVNRILRNHLIRPHWMFAMDNIIRRAVQAAVTILI--------------PELQAHFEPASETEGVDKDTEVEGDYPLVDLLSQEVHVTPRGTRPGSVAIQEGQPHQQDPSL-------------------------QLSKLRQETNRLWEHLVQKEREYQNLLRLILDQKTQELYHLQ--LQYKSNGGTENPPPPDGLGTDRELIDWLQLQGVDANTIEKIVEEDYTLSDILNDITKEDLRCLRLRGGVLCRLWHAVSQHRRQMQ 1327          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Map3k6 (mitogen-activated protein kinase kinase kinase 6 [Source:MGI Symbol;Acc:MGI:1855691])

HSP 1 Score: 380.948 bits (977), Expect = 6.375e-110
Identity = 194/388 (50.00%), Postives = 254/388 (65.46%), Query Frame = 1
Query: 1645 VLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKSEVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLKKN-GAL--TEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELI-KGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKS 2796
            VLV +   +L PA L++     + ++ L    P E   + S WTF    I GIS SK  Q   FLY +  A D  L FPS    + F  +++  V++         ++    E ++F+YEY +  +R+VLGRGT+G V+AGR+   +++IAIKE+ E   +  QPLHEEI LH RL H+NIV YLGS S+ G  KI ME+VPGGSL+SLL+   G L   E T S+Y+ QIL+GL YLH+NRI+HRDIKGDNVL+N ++G+LKISDFGTSKRL  I     TFTGT+QYMAPE+I +GP GYG  AD+WS GCTVIEM TG+PPF++LG+P AA+F+VG +  HP  P  LS EA  FL + F PDP  RA+   LL  PFLQ  ++S
Sbjct:  528 VLVLEINKVLLPARLEIQGTDPVSTVTLSLLDP-ETQEDPSSWTFPVTSICGISTSKLDQRCCFLYALPPAQDVQLCFPSVERCQRFCGLIQVLVMNPDSSAPTEEAEGAR-EVLEFDYEYSETGERLVLGRGTYGVVYAGRDRHTRVRIAIKEIPERDSRFSQPLHEEIALHKRLRHKNIVRYLGSASQGGYLKIFMEEVPGGSLSSLLRSVWGPLKDNESTISFYTRQILQGLSYLHENRIVHRDIKGDNVLINTFSGLLKISDFGTSKRLAGITPCTETFTGTLQYMAPEIIDQGPRGYGKAADIWSLGCTVIEMATGRPPFHELGSPQAAMFQVGMYKVHPPVPGSLSAEAQAFLLRTFEPDPRLRASAQELLGDPFLQPGKRS 913          

HSP 2 Score: 255.758 bits (652), Expect = 1.246e-68
Identity = 143/430 (33.26%), Postives = 225/430 (52.33%), Query Frame = 1
Query:  172 ISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHG----MDSTKETIESLKKTAGNSVTIILYNVNEKGRVGVLETQCMIAMMTDNEDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFR---KPEDNTPVSRSREVLNFWLEFFENTIHDCE 1440
            + F TL    T  LD+FYNAD+V+L++S  + Q +L +HLGVRE+  M  N++L        + + +E +         S T+I Y V   GRV   +   +  +        +   + L  L  +L  LL+        + +E    D+R+ RE  + ++L+Q++  + RRLD  ELLS +I++N++LSYR +Q Y  I+ L+E+L    T   +    ++ +HY FALNRRN+ G+REKAL+V+    + +   V PD+  + GRIYKD+F  S + +   L +A  WY K F ++P+ + GIN A LL+  G     SEEL  I + L   +  KG + ++  YWDV  +    +LA D  + V AAE ++KL  P+W L S +    L   FR   +P    P+       +FWL F    +  C+
Sbjct:   95 LPFATLALGDTAALDSFYNADVVVLEVSSSLAQPSLFYHLGVRESFSMTNNVLLCSQAELPDLQALREDVFQKNSDCVGSYTLIPYVVTATGRVLCGDAGLLRGIADGLVQAGAGTEALLTPLVGRLVRLLEATPTDSCGYFRETIRQDIRQARERFSGQQLRQELARLQRRLDSVELLSPDIVMNLLLSYRDVQDYSAIIELVETLQALPTC-DVAEQHNVCFHYTFALNRRNRPGDREKALAVLLPLVK-YEGPVAPDLYCMCGRIYKDMFFTSGFQNAGHLEQAYHWYRKAFDVEPSLHSGINAAVLLIAAGQHFEDSEELRLIGMKLACLLARKGCVEKMQYYWDVGFYLGAQILANDPIQVVLAAEQLYKLNAPIWYLVSVMETFLLYQHFRPTPEPSGGPPLR-----AHFWLHFL---LQSCQ 514          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Map3k19 (mitogen-activated protein kinase kinase kinase 19 [Source:MGI Symbol;Acc:MGI:1203481])

HSP 1 Score: 197.208 bits (500), Expect = 2.330e-53
Identity = 112/267 (41.95%), Postives = 156/267 (58.43%), Query Frame = 1
Query: 2029 VLGRGTFGTVFAGRELTKQIKIAIKEV------NESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLKKNGALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRL------GDIMQRASTFTGTMQYMAPELIKGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEF-SQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTAR 2790
            +LGRG +GTV+ G     Q+ IA+K+V        +  KE + L EE+ L   L H NIV+YLG+  E+    I ME VPGGS++S++ + G L E     Y+ QIL+G+ YLHDN ++HRDIKG+NV++ M  GI+K+ DFG +KRL      G       +  GT  +MAPE+I   SGYG  +D+WS GCTV EM TGKPP   +   +AA+F +G      P  P   S  A DF+  C   D ++R +   LL H FL+ ++
Sbjct:  253 ILGRGAYGTVYCGLTSLGQL-IAVKQVALDTSDKLATEKEYRKLQEEVDLLKALKHVNIVAYLGTCLEENTLSIFMEFVPGGSISSIINRFGPLPEMVFCKYTRQILQGVAYLHDNCVVHRDIKGNNVML-MPTGIIKLIDFGCAKRLAWAGLNGTHSDMLKSMRGTPYWMAPEVIN-ESGYGRKSDIWSIGCTVFEMATGKPPLASMDR-MAAMFYIGAHRGLMPPLPARFSEPAADFVRLCLTRDQHERPSALQLLKHSFLKRSQ 515          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|O35099|M3K5_MOUSE (Mitogen-activated protein kinase kinase kinase 5 OS=Mus musculus OX=10090 GN=Map3k5 PE=1 SV=3)

HSP 1 Score: 716.072 bits (1847), Expect = 0.000e+0
Identity = 475/1399 (33.95%), Postives = 721/1399 (51.54%), Query Frame = 1
Query:   82 NDAQLYDYRKSAYDELEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKK--------TAGNSVTIILYNVNEKGRVGVLETQCMIA----MMTDNEDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRSREVLNFWLEFFENTIHDCEEEVKQTQEENPNNIWSAKRRKSSVTPKVILTSSTRTETTIHDAAVNDEVNQIGDTEDCQNLDRRVMYPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFY---NVVKSEVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLK-KNGAL--TEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELI-KGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKARNQKNDITIPDKFDHRLMSNIERSSTLTKVIKENKQGCFSAPPMDVSNSVPQNIRPISNRKRGQLLSIDLLLVIHMKTNKRFRS------DESISDGNSFYSPDPPXXXXXXXXXXXXLETPSVGAFYMLRKETEARSELHKILKSVRNNVVSYWRELILEDDLKP-LTYNHSCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANILFKAGIFRLFDADPQTPAESHYLKPFCQTNENTKFSDRRPLSRSTGITGADSNPHENDFHVSAMIVDDLTTNDIWQPPFMNFDFKNELVKLQNENNKLLQDLCETTSEYNRHLKHCISEKKNHIDYLRATLGEKLITXXXXXXXXXXXXXXEN--LKNWLNEIGXXXXXXXXXXNEEYTFHEFLYFISKEDLYKLQLKGGVVLKILAAI 4194
            +  QL      A   L + C  A   +L  + F  LD+  T VLD FYNAD+ +++MS   +Q +L +HLGVRE+  M  NIIL     D+  ++++SLK+          GN  T I Y V    +V   ++  M      M  + E L   +C     L  +   LLK  +     + +E  L+D+R+ R   T +EL  ++  + +R+D+ E+L+ +I++N++LSYR IQ YD IV L+E+L    T   + +  H+++HYAFALNRRN  G+R KAL ++    +   + V  DM  LVGRIYKD+F+ S +TD ++ +   SW++K F+ +P    GINYA LL+  G+Q   S EL ++ + L+  +G KG + +L  YW+V  F   SVLA D+ + +QA+E +F+L+ P W LKS +  I +   F K     P S  +E+++FW++F                                      L  +T+T+ T+                        V +PVL+ +   I QP++L +N   + K+I +W+  P ++ + + +W F    ++G+S+SK  +   FLYV+  +DDF ++F +    + F+   N +  E   G E+         E + ++++YEYD+N  R+VLG+GT+G V+AGR+L+ Q++IAIKE+ E   +  QPLHEEI LH  L H+NIV YLGS SE G  KI MEQVPGGSL++LL+ K G L   E+T  +Y+ QILEGLKYLHDN+I+HRDIKGDNVL+N Y+G+LKISDFGTSKRL  I     TFTGT+QYMAPE+I KGP GYG  AD+WS GCT+IEM TGKPPF +LG P AA+FKVG F  HP+ P+ +S EA  F+ KCF PDP+KRA    LL   FL+ +       KK + Q     +    +  L S       L +    + +    +P  ++         P S + R +            K  K  R+      DE+  D ++  SP                E    G F MLRK++E R+ LH+IL   ++ VV    E + +   +P L + H   L+  + +    ++   D++ +   L +L+   D+     S+ Q++++  + A+   LR H  KPH + A D II  AV  A  IL          A     A+   L      +E+ + S  + + R   IT       E+    S +     T +   Q    + +   +L +++ E N+LL++L     E    L   I EK   I +L+       I    +    S   + E+  L  WL E G     IS  + E+YT  + LY+++++DL  L+L+GG++  +  AI
Sbjct:  108 SQGQLVVAESEALQSLREACE-AVGATLETLHFGKLDFGETAVLDRFYNADIAVVEMSDAFRQPSLFYHLGVRESFSMANNIILY---CDTNSDSLQSLKEIICQKNTVCTGN-YTFIPYMVTPHNKVYCCDSSFMKGLTELMQPNFELLLGPIC---LPLVDRFVQLLKVAQASSSQYFRESILSDIRKARNLYTGKELAAELARIRQRVDNIEVLTADIVINLLLSYRDIQDYDSIVKLVETLEKLPTFD-LASHHHVKFHYAFALNRRNLPGDRAKALDIMIPMVQS-EEQVASDMYCLVGRIYKDMFLDSNFTDTESRDHGASWFKKAFESEPTLQSGINYAVLLLAAGHQFESSFELRKVGVKLSSLLGKKGNLEKLQSYWEVGFFLGASVLANDHLRVIQASEKLFRLKTPAWYLKSIVETILIYKHFVKLTTEQP-SAKQELVDFWMDF--------------------------------------LVEATKTDVTV------------------------VRFPVLILEPTKIYQPSYLSINNEVEEKTISIWHVLPDDK-KGIHEWNFGASSVRGVSISKFEERCCFLYVLHNSDDFQIYFCTELHCKRFFEMVNTITEEKGRGAED------GDCEGDSLEYDYEYDENGDRVVLGKGTYGIVYAGRDLSNQVRIAIKEIPERDSRYSQPLHEEIALHKHLKHKNIVQYLGSFSENGFIKIFMEQVPGGSLSALLRSKWGPLKDNEQTIGFYTKQILEGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTETFTGTLQYMAPEIIDKGPRGYGKAADIWSLGCTIIEMATGKPPFYELGEPQAAMFKVGMFKVHPEIPESMSAEAKAFILKCFEPDPDKRACANDLLIDEFLKVS------SKKKKTQPKLSALSTGSNEYLRSISLPVPVLVEDTSSSSEYGSVSPDTELKAD------PFSFKARAKSCG--------EKDGKGIRTLFLGIPDENFEDHSAPPSP----------------EEKDSGFF-MLRKDSERRATLHRILTEDQDKVVRNLMESLAQGAEEPKLKWEHITTLISSLRE----FVRSTDRKIIATTLSKLKLELDFDSHGISQVQVVLFGFQDAVNKVLRNHNIKPHWMFALDSIIRKAVQTAITILVPELRPHFSLASESDTADPEDLD---VEDEHEELSSNQTVRRPQAIT-------EDAVATSGVSTLSSTVSHDSQNAHRSLNV--QLGRMKIETNRLLEELVRKERELQALLHQAIEEKDQEIRHLKLKSQPIDIPGFPVCHLNSPGTTTEDSELPGWLRENGADEDTISRFLAEDYTLVDVLYYVTRDDLKCLRLRGGMLCTLWKAI 1373          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q99683|M3K5_HUMAN (Mitogen-activated protein kinase kinase kinase 5 OS=Homo sapiens OX=9606 GN=MAP3K5 PE=1 SV=1)

HSP 1 Score: 711.835 bits (1836), Expect = 0.000e+0
Identity = 470/1392 (33.76%), Postives = 728/1392 (52.30%), Query Frame = 1
Query:   79 CNDAQLYDYRKSAYDELEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKK--------TAGNSVTIILYNVNEKGRVGVLETQCMIA----MMTDNEDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRSREVLNFWLEFFENTIHDCEEEVKQTQEENPNNIWSAKRRKSSVTPKVILTSSTRTETTIHDAAVNDEVNQIGDTEDCQNLDRRVMYPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKSEVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLK-KNGAL--TEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELI-KGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKARNQKNDITIPDKFDHRLMSNIERSSTLTKVIKENKQGCFSAPPMDVSNSVPQNIRPISNRKRGQLLSIDLLLVIHMKTNKRFRSDESISDGNSFYSPDPPXXXXXXXXXXXXLETPSVGAFYMLRKETEARSELHKILKSVRNNVVSYWRELILEDDLKP-LTYNHSCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANILFKAGIFRLFDADPQTPAESHYLKPFCQTNENTKFSDRRPLSRSTGITGADSNPHENDFHVSAMIVDDLTTNDIWQ-PPFMNFDFKN-------ELVKLQNENNKLLQDLCETTSEYNRHLKHCISEKKNHIDYLRATLGEKLITXXXXXXXXXXXXXXEN--LKNWLNEIGXXXXXXXXXXNEEYTFHEFLYFISKEDLYKLQLKGGVV 4173
             +  QL      A   L + C      +L  + F  LD+  T VLD FYNAD+ +++MS   +Q +L +HLGVRE+  M  NIIL     D+  ++++SLK+          GN  T + Y +    +V   ++  M      M  + E L   +C     L  +   LLK  +     + +E  LND+R+ R   T +EL  ++  + +R+D+ E+L+ +I++N++LSYR IQ YD IV L+E+L    T   + +  H+++HYAFALNRRN  G+R KAL ++    +     V  DM  LVGRIYKD+F+ S +TD ++ +   SW++K F+ +P    GINYA LL+  G+Q   S EL ++ + L+  +G KG + +L  YW+V  F   SVLA D+ + +QA+E +FKL+ P W LKS +  I +   F K     PV++ +E+++FW++F                                      L  +T+T+ T+                        V +PVL+ +   I QP++L +N   + K+I +W+  P ++ + + +W F+   ++G+S+SK  +   FLYV+  +DDF ++F +    ++F+ +V +     +E+         ES+ ++++YEYD+N  R+VLG+GT+G V+AGR+L+ Q++IAIKE+ E   +  QPLHEEI LH  L H+NIV YLGS SE G  KI MEQVPGGSL++LL+ K G L   E+T  +Y+ QILEGLKYLHDN+I+HRDIKGDNVL+N Y+G+LKISDFGTSKRL  I     TFTGT+QYMAPE+I KGP GYG  AD+WS GCT+IEM TGKPPF +LG P AA+FKVG F  HP+ P+ +S EA  F+ KCF PDP+KRA    LL   FL+ +       KK + Q     +    +  L S       L +    + +    +P  ++       + P S + R +  S     V  ++T      DE+  D ++  SP                E    G F MLRK++E R+ LH+IL   ++ +V    E + +   +P L + H   L+  + +    ++   D++ +   L +L+   D+     S+ Q++++  + A+   LR H  KPH + A D II  AV  A  IL            P+       L+P       +  +D+  L          SN  +      A+I D + T+ +      ++ D ++       +L +++ E N+LL++L     E    L   I EK   I +L+       I +  +    SS  + E+  L +WL   G     IS  + E+YT  + LY+++++DL  L+L+GG++
Sbjct:  100 ASQGQLVVAESEALQSLREACETVG-ATLETLHFGKLDFGETTVLDRFYNADIAVVEMSDAFRQPSLFYHLGVRESFSMANNIILY---CDTNSDSLQSLKEIICQKNTMCTGN-YTFVPYMITPHNKVYCCDSSFMKGLTELMQPNFELLLGPIC---LPLVDRFIQLLKVAQASSSQYFRESILNDIRKARNLYTGKELAAELARIRQRVDNIEVLTADIVINLLLSYRDIQDYDSIVKLVETLEKLPTFD-LASHHHVKFHYAFALNRRNLPGDRAKALDIMIPMVQS-EGQVASDMYCLVGRIYKDMFLDSNFTDTESRDHGASWFKKAFESEPTLQSGINYAVLLLAAGHQFESSFELRKVGVKLSSLLGKKGNLEKLQSYWEVGFFLGASVLANDHMRVIQASEKLFKLKTPAWYLKSIVETILIYKHFVKLTTEQPVAK-QELVDFWMDF--------------------------------------LVEATKTDVTV------------------------VRFPVLILEPTKIYQPSYLSINNEVEEKTISIWHVLPDDK-KGIHEWNFSASSVRGVSISKFEERCCFLYVLHNSDDFQIYFCTELHCKKFFEMVNTIT---EEKGRSTEEGDCESDLLEYDYEYDENGDRVVLGKGTYGIVYAGRDLSNQVRIAIKEIPERDSRYSQPLHEEIALHKHLKHKNIVQYLGSFSENGFIKIFMEQVPGGSLSALLRSKWGPLKDNEQTIGFYTKQILEGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTETFTGTLQYMAPEIIDKGPRGYGKAADIWSLGCTIIEMATGKPPFYELGEPQAAMFKVGMFKVHPEIPESMSAEAKAFILKCFEPDPDKRACANDLLVDEFLKVS------SKKKKTQPKLSALSAGSNEYLRSISLPVPVLVEDTSSSSEYGSVSPDTEL------KVDPFSFKTRAK--SCGERDVKGIRTLFLGIPDENFEDHSAPPSP----------------EEKDSGFF-MLRKDSERRATLHRILTEDQDKIVRNLMESLAQGAEEPKLKWEHITTLIASLRE----FVRSTDRKIIATTLSKLKLELDFDSHGISQVQVVLFGFQDAVNKVLRNHNIKPHWMFALDSIIRKAVQTAITILV-----------PE-------LRPHFSLASESDTADQEDLDVEDDHEEQPSN--QTVRRPQAVIEDAVATSGVSTLSSTVSHDSQSAHRSLNVQLGRMKIETNRLLEELVRKEKELQALLHRAIEEKDQEIKHLKLKSQPIEIPELPVFHLNSSGTNTEDSELTDWLRVNGADEDTISRFLAEDYTLLDVLYYVTRDDLKCLRLRGGML 1359          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6ZN16|M3K15_HUMAN (Mitogen-activated protein kinase kinase kinase 15 OS=Homo sapiens OX=9606 GN=MAP3K15 PE=1 SV=2)

HSP 1 Score: 483.797 bits (1244), Expect = 1.354e-145
Identity = 313/876 (35.73%), Postives = 465/876 (53.08%), Query Frame = 1
Query: 1639 YPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKSEVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLK-KNGALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELI-KGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKARNQKNDITIPDKFDHRLMSNIERSSTLTKVIKENKQGCFSAPPMDVSNSVPQNIRPISN--------RKRGQLLSIDLLLVIHMKTNKRFRSDESISDGNSFYSPDPPXXXXXXXXXXXXLETPSVGAFYMLRKETEARSELHKILKSVRNNVVSYWRELILEDDLK-PLTYNHSCNLLELIMDLFL---NYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANILFKAGIFRLFDADPQTPAESHYLKPFCQTNENTKFSD--RRPLSRSTGITGADSNPHENDFHVSAMIVDDLTTNDIWQPPFMNFDFKNELVKLQNENNKLLQDLCETTSEYNRHLKHCISEKKNHIDYLRATLGEKLITXXXXXXXXXXXXXXENLKNWLNEIGXXXXXXXXXXNEEYTFHEFLYFISKEDLYKLQLKGGVVLKILAAIERKKKELE 4218
            +PVLV +   + QP+++ +N  ++ +++ LW+  P+E ++ + +W FT   IKGISLSK  +   FLYV   +DDF ++F +      F+++VK  + +     + +  +  + + +++EY++D N +R+VLG+GT+G V+AGR+L+ Q++IAIKE+ E   +  QPLHEEI LH  L HRNIV YLGS SE G  KI MEQVPGGSL++LL+ K G + E T  +Y+ QILEGLKYLH+N+I+HRDIKGDNVLVN Y+G++KISDFGTSKRL  +     TFTGT+QYMAPE+I +GP GYG PAD+WS GCT+IEM T KPPF++LG P AA+FKVG F  HP+ P+ LS EA  F+  CF PDP+KRAT   LL   FL+   K          +KN I        R +           V+    QG     PM  S+S   ++ P S+        R R     +  LL +          DES +  +   +  P              E    G F +LRK++E R+ L+KIL   +N V S  +E + +   +  L+  H   ++ ++ D      + ++     KLK DL       D+     S+  L+++  + A+   LR H+ +PH + A D II  AV  A  IL               P    + +P C+T    K  D        +TG  G ++ PH+   H+S                        +L +L+ E N+LL+ L E   EY   L+  + +K   + +L+  L    IT     +      +D+ L +WL   G  +  I  IV E YT  + L  I+KEDL  L+L+GG++ ++ +A+ + ++  E
Sbjct:  529 FPVLVIEPTKVYQPSYVSINNEAEERTVSLWHVSPTE-MKQMHEWNFTASSIKGISLSKFDERCCFLYVHDNSDDFQIYFSTEEQCSRFFSLVKEMITNTAGSTVELEGE-TDGDTLEYEYDHDANGERVVLGKGTYGIVYAGRDLSNQVRIAIKEIPERDSRYSQPLHEEIALHKYLKHRNIVQYLGSVSENGYIKIFMEQVPGGSLSALLRSKWGPMKEPTIKFYTKQILEGLKYLHENQIVHRDIKGDNVLVNTYSGVVKISDFGTSKRLAGVNPCTETFTGTLQYMAPEIIDQGPRGYGAPADIWSLGCTIIEMATSKPPFHELGEPQAAMFKVGMFKIHPEIPEALSAEARAFILSCFEPDPHKRATTAELLREGFLRQVNK---------GKKNRIAFKPSEGPRGV-----------VLALPTQG----EPMATSSSEHGSVSPDSDAQPDALFERTRAPRHHLGHLLSV---------PDESSALEDRGLASSP--------------EDRDQGLF-LLRKDSERRAILYKILWEEQNQVASNLQECVAQSSEELHLSVGHIKQIIGILRDFIRSPEHRVMATTISKLKVDL-------DFDSSSISQIHLVLFGFQDAVNKILRNHLIRPHWMFAMDNIIRRAVQAAVTILI--------------PELRAHFEPTCETEGVDKDMDEAEEGYPPATG-PGQEAQPHQQ--HLSL-----------------------QLGELRQETNRLLEHLVEKEREYQNLLRQTLEQKTQELYHLQLKLKSNCIT--ENPAGPYGQRTDKELIDWLRLQGADAKTIEKIVEEGYTLSDILNEITKEDLRYLRLRGGLLCRLWSAVSQYRRAQE 1305          

HSP 2 Score: 303.908 bits (777), Expect = 4.294e-83
Identity = 178/445 (40.00%), Postives = 260/445 (58.43%), Query Frame = 1
Query:  127 LEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMD-----STKETIESLKKTAGNSVTIILYNVNEKGRVGVLETQCMIA----MMTDNEDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRS--REVLNFWLE-FFENT 1425
            L + C  A+   L  + F  LD+  T VLD FY+AD+ ++DMS   +Q +L +HLGVRE+  M  N+IL YH  D     S K+ +      +  +   I Y V         E+         M  + +++   +C     L  +  +LLK++ V    + KE  LND+R+ RE+   EEL +++  +  R+D+ E+L+++II+N++LSYR IQ YD +V L+E+L    T   + +  +I++HYAFALNRRN  G+REKAL ++ +  +   D   PDM  L GRIYKDIF+ S   D  + + A  WY KGF+LQ + Y GIN A LL++ G Q   S EL +I + LN  +G KG++ ++ +YWDV  FF VS+LA D  KAVQAAE +FKL+PPVW L+S + N+ LI  F+K    T +  S  +E LNFWL+  FE T
Sbjct:   87 LLRACE-AEGAHLTSVPFGELDFGETAVLDAFYDADVAVVDMSDVSRQPSLFYHLGVRESFDMANNVIL-YHDTDADTALSLKDMVTQKNTASSGNYYFIPYIVTPCADYFCCESDAQRRASEYMQPNWDNILGPLC---MPLVDRFISLLKDIHVTSCVYYKETLLNDIRKAREKYQGEELAKELARIKLRMDNTEVLTSDIIINLLLSYRDIQDYDAMVKLVETLEMLPTCD-LADQHNIKFHYAFALNRRNSTGDREKALQIMLQVLQS-CDHPGPDMFCLCGRIYKDIFLDSDCKDDTSRDSAIEWYRKGFELQSSLYSGINLAVLLIVAGQQFETSLELRKIGVRLNSLLGRKGSLEKMNNYWDVGQFFSVSMLAHDVGKAVQAAERLFKLKPPVWYLRSLVQNLLLIRRFKK----TIIEHSPRQERLNFWLDIIFEAT 520          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|A2AQW0|M3K15_MOUSE (Mitogen-activated protein kinase kinase kinase 15 OS=Mus musculus OX=10090 GN=Map3k15 PE=1 SV=1)

HSP 1 Score: 418.698 bits (1075), Expect = 4.408e-122
Identity = 201/396 (50.76%), Postives = 277/396 (69.95%), Query Frame = 1
Query: 1639 YPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKSEVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLK-KNGALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELI-KGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKAR 2820
            +PVLV +   + QP+++ +N  ++ +++ LW+  P+E ++ + +W FT   IKGISLSK  +   FLYV   +DDF ++F +      F ++VK  + +G    + +  +  + + +++EY++D N +R+VLG+G++G V+AGR+L+ Q++IAIKE+ E  I+  QPLHEEI LH  L HRNIV YLGS SE G  KI MEQVPGGSL++LL+ K G + E T  +Y+ QILEGLKYLH+N+I+HRDIKGDNVLVN Y+G++KISDFGTSKRL  I     TFTGT+QYMAPE+I +GP GYG PAD+WS GCT+IEM T +PPF++LG P AA+FKVG F  HP+ P+ LS EA  F+  CF PDP KR T   LL   FL    + ++K KK R
Sbjct:  533 FPVLVIEPTKVYQPSYVSINNEAEERTVSLWHVSPTE-MKQIHEWNFTASSIKGISLSKFDERCCFLYVHDNSDDFQIYFSTEDQCNRFCSLVKEMLNNGVGSTVELEGEA-DGDTLEYEYDHDANGERVVLGKGSYGIVYAGRDLSNQVRIAIKEIPERDIRYSQPLHEEIALHKYLKHRNIVQYLGSVSENGYIKIFMEQVPGGSLSALLRSKWGPMKEPTIKFYTKQILEGLKYLHENQIVHRDIKGDNVLVNTYSGVVKISDFGTSKRLAGINPCTETFTGTLQYMAPEIIDQGPRGYGAPADIWSLGCTIIEMATSRPPFHELGEPQAAMFKVGMFKIHPEIPEALSAEARAFILSCFEPDPQKRVTAADLLQEGFL----RQVNKGKKNR 922          

HSP 2 Score: 308.145 bits (788), Expect = 1.871e-84
Identity = 183/445 (41.12%), Postives = 263/445 (59.10%), Query Frame = 1
Query:  127 LEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKK--TAGNSVT-----IILYNVNEKGRVGVLETQCMIA----MMTDNEDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRSREVLNFWLE-FFENT 1425
            L + C  A+   L  + F  LD+  T VLD FY+AD+ I+DMS   +Q +L +HLGVRE+  M  N+IL Y   D+  +T  SLK   T  N+ +      I Y V         E+         M  + + +   +C     L  +  +LLK++ V   A+ KE  LND+R+ RE+   +EL +++  +  R+D+ E+L+++II+N++LSYR IQ YD +V L+E+L    T   + +  +I++HYAFALNRRN  G+REKAL V+ +  +   D   PDM  L GRIYKDIF+ S   +  + + A  WY KGF+LQ + Y GIN A LL++ G Q   S EL +I + LN  +G KG++ ++ +YWDV  FF VS+LA D  KAVQAAE +FKL+PPVW L+S + N+ LI  F+KP   T  S  +E LNFWL+  FE T
Sbjct:   91 LLRACE-AEGAHLTSVPFGELDFGETAVLDAFYDADVAIVDMSDISRQPSLFYHLGVRESFDMANNVILYY---DTDADTALSLKDMVTQKNTASSGNYYFIPYTVTPCADYFCCESDAQRRASEYMQPNWDTILGPLC---MPLVDRFTSLLKDIRVTSCAYYKETLLNDIRKAREKYQGDELAKELTRIKFRMDNIEVLTSDIIINLLLSYRDIQDYDAMVKLVETLKMLPTCD-LADQHNIKFHYAFALNRRNSTGDREKALQVMLQVLQS-CDHPAPDMFCLCGRIYKDIFLDSGCEEDASRDSAIEWYRKGFELQSSLYSGINLAVLLIVSGQQFETSMELRKIGVRLNSLLGRKGSLEKMNNYWDVGQFFTVSMLASDIGKAVQAAERLFKLKPPVWYLRSLVQNLLLIQRFKKP--ITEHSPRQERLNFWLDIIFEAT 524          

HSP 3 Score: 74.3294 bits (181), Expect = 7.993e-12
Identity = 82/350 (23.43%), Postives = 152/350 (43.43%), Query Frame = 1
Query: 3175 AFYMLRKETEARSELHKILKSVRNNVVSYWRELILEDDLKPLTYNHSCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANILFKAGIFRLFDADPQTPAESHYLKPFCQT---NENTKFSDRRPL--------------SRSTGITGADSNPHENDFHVSAMIVDDLTTNDIWQPPFMNFDFKNELVKLQNENNKLLQDLCETTSEYNRHLKHCISEKKNHIDYLRATLGEKLITXXXXXXXXXXXXXXENLKNWLNEIGXXXXXXXXXXNEEYTFHEFLYFISKEDLYKLQLKGGVV 4173
              ++LRK++E R+ L++IL   +N V S  +E +++   + L    S + ++ I+ +  +++   +   +   + +L+   D+     ++  LI++  + A+   LR H+ +PH + A D II  AV  A  IL               P    + +P  +T   +++T+     PL              +R   +   +  PH+ D  +                         +L KL+ E N+L + L +   EY   L+  + +K   + +L+  L  K    +        L +D  L +WL   GV ++ I  IV E+YT  + L  I+KEDL  L+L+GGV+
Sbjct: 1007 GLFLLRKDSERRAILYRILWEEQNQVASNLQECVVQSSEELLL---SVSHIKQIIGILRDFIRSPEHRVMAATISKLKVDLDFDSSSINQIHLILFGFQDAVNRILRNHLIRPHWMFAMDNIIRRAVQAAVTILI--------------PELQAHFEPASETEGVDKDTEVEGDYPLVDLLSQEVHVTPRGTRPGSVAIQEGQPHQQDPSL-------------------------QLSKLRQETNRLWEHLVQKEREYQNLLRLILDQKTQELYHLQ--LQYKSNGGTENPPPPDGLGTDRELIDWLQLQGVDANTIEKIVEEDYTLSDILNDITKEDLRCLRLRGGVL 1312          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9WTR2|M3K6_MOUSE (Mitogen-activated protein kinase kinase kinase 6 OS=Mus musculus OX=10090 GN=Map3k6 PE=1 SV=4)

HSP 1 Score: 380.948 bits (977), Expect = 4.416e-109
Identity = 194/388 (50.00%), Postives = 254/388 (65.46%), Query Frame = 1
Query: 1645 VLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKSEVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLKKN-GAL--TEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELI-KGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKS 2796
            VLV +   +L PA L++     + ++ L    P E   + S WTF    I GIS SK  Q   FLY +  A D  L FPS    + F  +++  V++         ++    E ++F+YEY +  +R+VLGRGT+G V+AGR+   +++IAIKE+ E   +  QPLHEEI LH RL H+NIV YLGS S+ G  KI ME+VPGGSL+SLL+   G L   E T S+Y+ QIL+GL YLH+NRI+HRDIKGDNVL+N ++G+LKISDFGTSKRL  I     TFTGT+QYMAPE+I +GP GYG  AD+WS GCTVIEM TG+PPF++LG+P AA+F+VG +  HP  P  LS EA  FL + F PDP  RA+   LL  PFLQ  ++S
Sbjct:  528 VLVLEINKVLLPARLEIQGTDPMSAVTLSLLEP-ETQEDPSSWTFPVTSICGISTSKLDQRCCFLYALPPAQDVQLCFPSVERCQRFCGLIQVLVMNPDSSAPTEEAEGAR-EVLEFDYEYSETGERLVLGRGTYGVVYAGRDRHTRVRIAIKEIPERDSRFSQPLHEEIALHKRLRHKNIVRYLGSASQGGYLKIFMEEVPGGSLSSLLRSVWGPLKDNESTISFYTRQILQGLSYLHENRIVHRDIKGDNVLINTFSGLLKISDFGTSKRLAGITPCTETFTGTLQYMAPEIIDQGPRGYGKAADIWSLGCTVIEMATGRPPFHELGSPQAAMFQVGMYKVHPPVPGSLSAEAQAFLLRTFEPDPRLRASAQELLGDPFLQPGKRS 913          

HSP 2 Score: 255.758 bits (652), Expect = 9.429e-68
Identity = 143/430 (33.26%), Postives = 225/430 (52.33%), Query Frame = 1
Query:  172 ISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHG----MDSTKETIESLKKTAGNSVTIILYNVNEKGRVGVLETQCMIAMMTDNEDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFR---KPEDNTPVSRSREVLNFWLEFFENTIHDCE 1440
            + F TL    T  LD+FYNAD+V+L++S  + Q +L +HLGVRE+  M  N++L        + + +E +         S T+I Y V   GRV   +   +  +        +   + L  L  +L  LL+        + +E    D+R+ RE  + ++L+Q++  + RRLD  ELLS +I++N++LSYR +Q Y  I+ L+E+L    T   +    ++ +HY FALNRRN+ G+REKAL+V+    + +   V PD+  + GRIYKD+F  S + +   L +A  WY K F ++P+ + GIN A LL+  G     SEEL  I + L   +  KG + ++  YWDV  +    +LA D  + V AAE ++KL  P+W L S +    L   FR   +P    P+       +FWL F    +  C+
Sbjct:   95 LPFATLALGDTAALDSFYNADVVVLEVSSSLAQPSLFYHLGVRESFSMTNNVLLCSQAELPDLQALREDVFQKNSDCVGSYTLIPYVVTATGRVLCGDAGLLRGIADGLVQAGAGTEALLTPLVGRLVRLLEATPTDSCGYFRETIRQDIRQARERFSGQQLRQELARLQRRLDSVELLSPDIVMNLLLSYRDVQDYSAIIELVETLQALPTC-DVAEQHNVCFHYTFALNRRNRPGDREKALAVLLPLVK-YEGPVAPDLYCMCGRIYKDMFFTSGFQNAGHLEQAYHWYRKAFDVEPSLHSGINAAVLLIAAGQHFEDSEELRLIGMKLACLLARKGCVEKMQYYWDVGFYLGAQILANDPIQVVLAAEQLYKLNAPIWYLVSVMETFLLYQHFRPTPEPSGGPPLR-----AHFWLHFL---LQSCQ 514          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A0M9AA09 (Mitogen-activated protein kinase kinase kinase 15 OS=Melipona quadrifasciata OX=166423 GN=WN51_08444 PE=4 SV=1)

HSP 1 Score: 894.804 bits (2311), Expect = 0.000e+0
Identity = 540/1432 (37.71%), Postives = 784/1432 (54.75%), Query Frame = 1
Query:   49 CVTDFEPNVTCNDAQLYDYRKSAYDELEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKKTAGNSVTIILYNVNEKGRVGVLETQCMIAMMTDNEDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRSREVLNFWLEFFENTIHDCEEEVKQTQEENPNNIWSAKRRKSSVTPKVILTSSTRTETTIHDAAVNDEVNQIGDTEDCQNLDRRVMYPVLVSDSEGILQPAFLQVNINSDIKSIRLW---YHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKSEVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLK-KNGAL--TEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELI-KGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKARNQKNDITIPDKFDHRLMSNIERSSTLTKVIKENKQGCFSAPPMDVSNSVPQN----IRPISNRKRGQLLSIDLLLVIHMKTNKRFRSDESISDGNSFYSPDPPXXXXXXXXXXXXLETPSV--------------GAFYMLRKETEARSELHKILKSVRNNVVSYWRELILEDDLKP-LTYNHSCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANILFKAGIFRLFDADPQTPAESHYLKPFCQTNENTKFSDRRPLSRST-GITGADSNPHENDFHVSAMIVDDLTTNDIWQPPFMNFDFKNELVKLQNENNKLLQDLCETTSEYNRHLKHCISEKKNHIDYLRA-----------------------TLGEKLITXXXXXXXXXXXXXXENLKNWLNEIGXXXXXXXXXXNEEYTFHEFLYFISKEDLYKLQLKGGVVLKILAAI 4194
            CV D +       ++    R+ A +E+ + CN  +  ++  I F+ LD+  T VLDTFYNAD+ ++D+SI++QQ AL +HLGVRE+ GM ENI+L ++ +D+  ET   +K + GN  T + Y V E G        C+            +V    + L  KL+ L ++VEV  +AH+KEKFL DLR+ RE  + EEL + + NM +RLDDP +LS E++LN+++S+R+IQ YD +V L++ L T  T +  INT  I+Y YAFALNRRNK+G+RE+AL VI+KA E   + V PDM+ L GRIYKD FV S++TD+++L  A  WY KGF++QPNEY GIN ATLLVI GN+ + SEEL  I + LN  IG KG+++ L DYWDVATFFE+SVLAEDY KA+QAAECMFKL+PP W LKSTIGNI LI  FRK  +   +S   ++  FW+++F          V+ T+ E                                          +GD+         + +P+LV +   IL P+++ VN+ ++ KS+++W     +     + V DW FT ++I+ +SL K  +  LFLYV   +DDF ++FPS   R+ FY+++  E+   +E M+      +  + ++FEYE DD ++RI+LG+GT+G V+A R+L  Q++IA+KE+ E  + +VQPLHEEI LHS+L HRNIV YLGS SE+G FKI MEQVPGGSL++LL+ K G L   E T +YY+ QILEGLKYLHD +I+HRDIKGDNVLVN Y+G++KISDFG SKRL  +     TFTGT+QYMAPE+I KG  GYG PAD+WS GCT++EM TGKPPF +LG+P AA+FKVG +  HP+ P  LS  A +F+ +CF P+P+ RAT   LL  PFL   +KS               +PD F   +    +R   L K  K +     SA P+  S S          P+  R    LLS   +    +  N    +  SI    S    D   +  +   ++ GL +P V                FY+L+K+++ R  L ++L      +   W   I + + +  L  NH    L L+M    +Y+ + ++E +   +  L+   D+     +   L IY  + A+   LR H  KPH + A D ++ NAV  A  +L                  S  L       E  + S + P   ST G++  +S        V +    D   N  W+      ++++++  L+ EN +LLQ+L E    Y   L+  + E++  ++ L                         T+ + +          ++  +D+ L  WL  + +    I   + E+YT    L  +++ED+ +L LKGG  L+I  AI
Sbjct:   51 CVLDLQ------QSEHLAQRRRALEEVRQACNLVN-ANMHHIQFEKLDFGETNVLDTFYNADVAVVDLSIQLQQSALFYHLGVRESFGMKENILL-HNDIDT--ETTIRIKLSCGN-YTFVSYRVVECG-------SCVATNPATTRITGEEVIDPKQHLTLKLKKLFQDVEVQSKAHMKEKFLADLRKARETYSGEELSKALNNMRKRLDDPNVLSGEVVLNVLISFREIQDYDAMVQLVDDLRTIPTHKNYINTPAIRYLYAFALNRRNKEGDRERALKVIQKALEKKENHV-PDMLCLCGRIYKDKFVESRHTDEESLKNAIHWYRKGFEVQPNEYAGINLATLLVIAGNEFSKSEELQHIGMVLNNLIGKKGSLSSLKDYWDVATFFEISVLAEDYSKAIQAAECMFKLKPPNWYLKSTIGNISLIDRFRKKNEEAEISPEEQIFTFWMDYF----------VEATKSE------------------------------------------VGDS---------IRFPLLVLEPTKILMPSYVNVNLGAEEKSVQIWNLCLDNMKNSCKQVHDWLFTANMIRSVSLYKRDERCLFLYVHQNSDDFQMYFPSVQCRQRFYDLIL-EMTRDQEGMVADLDAYMTDDRMKFEYELDDQNKRIMLGKGTYGIVYAARDLNTQVRIAVKEIRERNLGDVQPLHEEIKLHSQLRHRNIVQYLGSVSEEGYFKIFMEQVPGGSLSALLRSKWGPLKENESTIAYYTKQILEGLKYLHDQKIVHRDIKGDNVLVNTYSGVVKISDFGMSKRLAGLCPSTETFTGTLQYMAPEVIDKGQRGYGAPADIWSLGCTIVEMATGKPPFIELGSPQAAVFKVGYYKIHPEIPSELSERAKNFILRCFEPNPDIRATAAELLEDPFLNEKKKS----------NRLAAVPD-FSRSISVPADRLERLGKSDKSSNNQIVSASPIQTSQSDDSGGLTKSSPLRERSPAHLLSPIRMPTATLSFNSAIGNTPSIETSES----DTAGASMTRRSSSGGLLSPEVELGGQSGHKTGEEQEGFYLLKKDSQRRMTLTRVLTQDEAKICEVWMRGIHQAEGQTVLQMNH----LILLMRALRDYIAEQNQEVIVTAIRTLKEELDFDSTAINHLNLAIYLFQTAVNEVLRMHSIKPHWMFALDNLVRNAVQAAITVL------------------SPELGANLLGQERMQSSGQGPEEGSTSGVSTVNS--------VKSQKTGDSLDNKYWK------EYQDQMGALKMENLRLLQELIENQKSYQTLLQQVLEEQRGQVNALTRLCENINRRTIRQESGYNSSVSGNTVQQPISLIVSNIPSSTTSCNDQALVEWLQSLQIDEMSIERFLYEQYTLDNILNHVTREDIRRLNLKGGTELRIWQAI 1350          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A026WG16 (Mitogen-activated protein kinase kinase kinase OS=Ooceraea biroi OX=2015173 GN=X777_05386 PE=4 SV=1)

HSP 1 Score: 888.641 bits (2295), Expect = 0.000e+0
Identity = 547/1408 (38.85%), Postives = 782/1408 (55.54%), Query Frame = 1
Query:  106 RKSAYDELEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKKTAGNSVTIILYNVNEKGRVGVLETQCMIAMMTDNEDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRSREVLNFWLEFFENTIHDCEEEVKQTQEENPNNIWSAKRRKSSVTPKVILTSSTRTETTIHDAAVNDEVNQIGDTEDCQNLDRRVMYPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRN----VSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKSEVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLK-KNGAL--TEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELI-KGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKARNQKNDITIPDKFDHRLMSNIERSSTLTKVIKENKQGCFSAPPMDVSNSVPQN----IRPISNRKRGQLLSIDLLLVIHMKTNKRFRSDESISDGNSFYSPDPPXXXXXXXXXXXXLETPSV--------------GAFYMLRKETEARSELHKILKSVRNNVVSYWRELILEDDLKP-LTYNHSCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANILFKAGIFRLFDADPQTPAESHYLKPFCQTNENTKFSDRRPLSRSTGITGADSNPHENDFHVSAMIVDDLTTNDIWQPPFMNFDFKNELVKLQNENNKLLQDLCETTSEYNRHLKHCISEKKNHIDYL---------RATLGEK---------------LITXXXXXXXXXXXXXXENLKNWLNEIGXXXXXXXXXXNEEYTFHEFLYFISKEDLYKLQLKGGVVL 4176
            RK A DE+ + CN  +  ++  I F+ LD+  T VLDTFYNAD+ I+D+SI++QQ AL +HLGVRE+ GM ENI+L Y+ +D T+ TI  LK + G S T + Y V E     V  T      +T  E +  +     + L  KL+ L ++VEV  +AH+KEKFL DLR+ RE  + EEL + + NM +RLDDP +LS E++LN+++S+R+IQ YD +V L++ L T  T +  INT  I+Y YAFALNRRNK+G+RE+AL VIEKA E   + V PDM+ L GRIYKD FV S++TD+++L  A  WY KGF++QPNEY GIN ATLLVI GN+ + SEEL  I + LN  IG KG+++ L DYWDVATFFE+SVLAEDY KA+QAAECMFKL+PP W LKSTIGNI LI  FRK  +   V+   ++  FW+++F          V+ T+ E                                          +GD+         + +P+LV +   IL P+++ VN+ ++ KSI++W +   + +RN    V DW FT ++I+ +SL K  +  LFLYV   +DDF ++ PS   R+ FY+++  E+   +E M+      +  + ++FEYE DD ++RIVLG+GT+G V+A R+L  Q++IA+KE+ E  + +VQPLHEEI LHS+L HRNIV YLGS SE G FKI MEQVPGGSL++LL+ K G L   E T SYY+ Q+LEGLKYLHD +I+HRDIKGDNVLVN Y+G++KISDFG SKRL  +     TF GT+QYMAPE+I KG  GYG PAD+WS GCT++EM TGKPPF +LG+P AA+FKVG +  HP+ P  LS  A  F+ +CF P+P+ RAT   LL  PFL        KKK +R     +  P  F   +    +R   L K  K N     +A  M +S S          P+  R    LLS   +    +  N    +  SI    S    D   +  +   ++ GL +P V                FY+L+K+++ R  L ++L      +   W   I + + +  L  +H    L L+M    +Y+ + ++E +   +  L+   D+     +   L IY  + A+   LR H  KPH + A D ++ NAV  A  +L       L   + Q         P  Q  E            ++G++  +S        V +    D   N  W+      ++++++  L+ EN +LLQ+L E+   Y   L+  + E++  ++ L         RA   E                 +  +      +S  SD  L +WL  + V  + I + + EEYT  + L  ++++DL +L L+GG+ L
Sbjct:   64 RKKALDEVRQACNLVN-ANIHHIQFEKLDFGETNVLDTFYNADVAIVDLSIQLQQSALFYHLGVRESFGMKENILL-YNDVD-TEATIR-LKLSCG-SYTFVSYRVVESCGSCV-ATNPATTRITGEEAIDPK-----QHLTLKLKKLFQDVEVQSKAHMKEKFLADLRKARETYSGEELSKALNNMRKRLDDPNVLSGEVVLNVLISFREIQDYDAMVQLVDDLRTIPTHKNYINTPAIRYLYAFALNRRNKEGDRERALKVIEKALEKKENHV-PDMLCLCGRIYKDKFVESRHTDQESLRNAIHWYRKGFEVQPNEYAGINLATLLVIAGNEFSKSEELQHIGMVLNNLIGKKGSLSSLKDYWDVATFFEISVLAEDYSKAIQAAECMFKLKPPNWYLKSTIGNISLIDRFRKRNEEAEVAPEEQIFGFWMDYF----------VEATKPE------------------------------------------VGDS---------IRFPILVLEPTKILMPSYVNVNLGAEEKSIQIW-NMCLDNMRNNCKQVHDWLFTANMIRSVSLYKRDERCLFLYVHQNSDDFQMYLPSVQCRQRFYDLIL-EMTRDQEGMVTDLDAYMTDDRMKFEYELDDQNKRIVLGKGTYGVVYAARDLNTQVRIAVKEIRERNLGDVQPLHEEIKLHSQLRHRNIVQYLGSVSEDGYFKIFMEQVPGGSLSALLRSKWGPLKENESTISYYTKQMLEGLKYLHDQKIVHRDIKGDNVLVNTYSGVVKISDFGMSKRLAGLCPSTETFAGTLQYMAPEVIDKGQRGYGAPADIWSLGCTIVEMATGKPPFIELGSPQAAVFKVGYYKIHPEIPSELSERAKSFILRCFEPNPDVRATAAELLEDPFLN------EKKKSSR-----LVAPPDFSRSISVPADRLERLGKCDKTNNNHIVAAAAMQMSQSDDSGGLTKSSPLRERSPAHLLSPISMPTATLSFNSTIGNTPSIETSES----DTTGASITRRSSSGGLLSPEVELGGQPGQKSGEEQEGFYLLKKDSQRRMTLTRVLNQDEAKICEVWMRGIHQAEGQTVLQMSH----LVLLMRGLRDYIAEQNQEVIVTAIRTLKEELDFDSTAINHLHLAIYLFQTAVNEVLRMHSIKPHWMFALDNLVRNAVQAAITVLSPELGANLLGQERQ---------PGGQGPEE---------GSTSGVSTVNS--------VKSQKTADSIDNKYWK------EYRDQMGALKMENMRLLQELIESQKSYQTLLQQALEEQRAQVNTLTHLCENIHRRAARQESGYNSDIPGSTPQQPVSLAITDTHHSTASQYSDMALVDWLRNLQVDEASIDMFLYEEYTLEDVLQHVTRDDLRRLNLRGGIEL 1345          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A3L8DDH8 (Protein kinase domain-containing protein OS=Ooceraea biroi OX=2015173 GN=DMN91_008559 PE=4 SV=1)

HSP 1 Score: 882.093 bits (2278), Expect = 0.000e+0
Identity = 544/1408 (38.64%), Postives = 781/1408 (55.47%), Query Frame = 1
Query:  106 RKSAYDELEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKKTAGNSVTIILYNVNEKGRVGVLETQCMIAMMTDNEDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRSREVLNFWLEFFENTIHDCEEEVKQTQEENPNNIWSAKRRKSSVTPKVILTSSTRTETTIHDAAVNDEVNQIGDTEDCQNLDRRVMYPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRN----VSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKSEVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLK-KNGAL--TEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELI-KGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKARNQKNDITIPDKFDHRLMSNIERSSTLTKVIKENKQGCFSAPPMDVSNSVPQN----IRPISNRKRGQLLSIDLLLVIHMKTNKRFRSDESISDGNSFYSPDPPXXXXXXXXXXXXLETPSV--------------GAFYMLRKETEARSELHKILKSVRNNVVSYWRELILEDDLKP-LTYNHSCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANILFKAGIFRLFDADPQTPAESHYLKPFCQTNENTKFSDRRPLSRSTGITGADSNPHENDFHVSAMIVDDLTTNDIWQPPFMNFDFKNELVKLQNENNKLLQDLCETTSEYNRHLKHCISEKKNHIDYL---------RATLGEK---------------LITXXXXXXXXXXXXXXENLKNWLNEIGXXXXXXXXXXNEEYTFHEFLYFISKEDLYKLQLKGGVVL 4176
            RK A DE+ + CN  +  ++  I F+ LD+  T VLDTFYNAD+ I+D+SI++QQ AL +HLGVRE+ GM ENI+L Y+ +D T+ TI  LK + G S T + Y V E     V  T      +T  E +  +     + L  KL+ L ++VEV  +AH+KEKFL DLR+ RE  + EEL + + NM +RLDDP +LS E++LN+++S+R+IQ YD +V L++ L T  T +  INT  I+Y YAFALNRRNK+G+RE+AL VIEKA E   + V PDM+ L GRIYKD FV S++TD+++L  A  WY KGF++QPNEY GIN ATLLVI GN+ + SEEL  I + LN  IG KG+++ L DYWDVATFFE+SVLAEDY KA+QAAECMFKL+PP W LKSTIGNI LI  FRK  +   V+   ++  FW+++F          V+ T+ E                                          +GD+         + +P+LV +   IL P+++ VN+ ++ KSI++W +   + +RN    V DW FT ++I+ +SL K  +  LFLYV   +DDF ++ PS   R+ FY+++  E+   +E M+      +  + ++FEYE DD ++RIVLG+GT+G V+A R+L  Q++IA+KE+ E  + +VQPLHEEI LHS+L HRNIV YLGS SE G FKI MEQVPGGSL++LL+ K G L   E T SYY+ Q+LEGLKYLHD +I+HRDIKGDNVLVN Y+G++KISDFG SKRL  +     TF GT+QYMAPE+I KG  GYG PAD+WS GCT++EM TGKPPF +LG+P AA+FKVG +  HP+ P  LS  A  F+ +CF P+P+ RAT   LL  PFL          K  + + + +  P  F   +    +R   L K  K N     +A  M +S S          P+  R    LLS   +    +  N    +  SI    S    D   +  +   ++ GL +P V                FY+L+K+++ R  L ++L      +   W   I + + +  L  +H    L L+M    +Y+ + ++E +   +  L+   D+     +   L IY  + A+   LR H  KPH + A D ++ NAV  A  +L       L   + Q         P  Q  E            ++G++  +S        V +    D   N  W+      ++++++  L+ EN +LLQ+L E+   Y   L+  + E++  ++ L         RA   E                 +  +      +S  SD  L +WL  + V  + I + + EEYT  + L  ++++DL +L L+GG+ L
Sbjct:   64 RKKALDEVRQACNLVN-ANIHHIQFEKLDFGETNVLDTFYNADVAIVDLSIQLQQSALFYHLGVRESFGMKENILL-YNDVD-TEATIR-LKLSCG-SYTFVSYRVVESCGSCV-ATNPATTRITGEEAIDPK-----QHLTLKLKKLFQDVEVQSKAHMKEKFLADLRKARETYSGEELSKALNNMRKRLDDPNVLSGEVVLNVLISFREIQDYDAMVQLVDDLRTIPTHKNYINTPAIRYLYAFALNRRNKEGDRERALKVIEKALEKKENHV-PDMLCLCGRIYKDKFVESRHTDQESLRNAIHWYRKGFEVQPNEYAGINLATLLVIAGNEFSKSEELQHIGMVLNNLIGKKGSLSSLKDYWDVATFFEISVLAEDYSKAIQAAECMFKLKPPNWYLKSTIGNISLIDRFRKRNEEAEVAPEEQIFGFWMDYF----------VEATKPE------------------------------------------VGDS---------IRFPILVLEPTKILMPSYVNVNLGAEEKSIQIW-NMCLDNMRNNCKQVHDWLFTANMIRSVSLYKRDERCLFLYVHQNSDDFQMYLPSVQCRQRFYDLIL-EMTRDQEGMVTDLDAYMTDDRMKFEYELDDQNKRIVLGKGTYGVVYAARDLNTQVRIAVKEIRERNLGDVQPLHEEIKLHSQLRHRNIVQYLGSVSEDGYFKIFMEQVPGGSLSALLRSKWGPLKENESTISYYTKQMLEGLKYLHDQKIVHRDIKGDNVLVNTYSGVVKISDFGMSKRLAGLCPSTETFAGTLQYMAPEVIDKGQRGYGAPADIWSLGCTIVEMATGKPPFIELGSPQAAVFKVGYYKIHPEIPSELSERAKSFILRCFEPNPDVRATAAELLEDPFLN------EYIKLKKKKSSRLVAPPDFSRSISVPADRLERLGKCDKTNNNHIVAAAAMQMSQSDDSGGLTKSSPLRERSPAHLLSPISMPTATLSFNSTIGNTPSIETSES----DTTGASITRRSSSGGLLSPEVELGGQPGQKSGEEQEGFYLLKKDSQRRMTLTRVLNQDEAKICEVWMRGIHQAEGQTVLQMSH----LVLLMRGLRDYIAEQNQEVIVTAIRTLKEELDFDSTAINHLHLAIYLFQTAVNEVLRMHSIKPHWMFALDNLVRNAVQAAITVLSPELGANLLGQERQ---------PGGQGPEE---------GSTSGVSTVNS--------VKSQKTADSIDNKYWK------EYRDQMGALKMENMRLLQELIESQKSYQTLLQQALEEQRAQVNTLTHLCENIHRRAARQESGYNSDIPGSTPQQPVSLAITDTHHSTASQYSDMALVDWLRNLQVDEASIDMFLYEEYTLEDVLQHVTRDDLRRLNLRGGIEL 1350          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A1B6D1S4 (Protein kinase domain-containing protein OS=Clastoptera arizonana OX=38151 GN=g.17115 PE=4 SV=1)

HSP 1 Score: 876.7 bits (2264), Expect = 0.000e+0
Identity = 543/1412 (38.46%), Postives = 783/1412 (55.45%), Query Frame = 1
Query:  100 DYRKSAYDELEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKKTAGNSVTIILYNVNEKGRVGVL--ETQCMIAMMTDNEDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRSREVLNFWLEFFENTIHDCEEEVKQTQEENPNNIWSAKRRKSSVTPKVILTSSTRTETTIHDAAVNDEVNQIGDTEDCQNLDRRVMYPVLVSDSEGILQPAFLQVNINSDIKSIRLW---YHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKSEVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLK-KNGAL--TEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELI-KGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKARNQKNDITIP-DKFDHRLMSNIERSSTLTKVIKENKQGCFSAPPMDVSNSVPQNIRPISNRKRGQLLSIDLLLVIHMKTNKRFRSDESISDGNSFYSPDPPXXXXXXXXXXXXLETPSV--------------GAFYMLRKETEARSELHKILKSVRNNVVSYWRELILEDDLKP-LTYNHSCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANILFKAGIFRLFDADPQTPAESHYLKPFCQTNENTKFSDRRPLSRSTGITGADSNPHENDFHVSAMIVDDLTTNDIWQPPFMNFDFKNELVKLQNENNKLLQDLCETTSEYNRHLKHCISEKKNHIDYLRATLGEKLITXXXXXXXXXXXXXXEN-----------------LKNWLNEIGXXXXXXXXXXNEEYTFHEFLYFISKEDLYKLQLKGGVVLKILAAIERKKK 4209
            ++RK A +E+++ C   +  +L +I F+ LD+    VL TFYNAD+ ++D+S+++QQ +L +HLGVRE+ GM EN++L Y+ +D+  E    LK + G S T + Y +N          E++ +  +     DL    C    +L  KL+ LL++VEV  + H+KEKFL+DL++ R+  T EEL   + NM +RLDDP +L  E++L+M++S+R IQ YD +V L+E L T    +  I T  I+Y Y FALNRRN++G+REKAL VIEKA E   + + PDMV L GRIYKD FV S+Y DK +L  A  WY KGF++QPNEY GIN ATLLVI GN+ + SEEL  I + LN  IG KG+++ L +YWDVATFFE+SVLAEDY KAVQAAECMFKL+PP W LKSTIGNI LI  FRK  +++  S   +V  FW+++F                                        +T+TE              +GD+         + +P+L+ +   IL P+++ VN+ ++ KS++LW         + R V DW FT  +I+ +SL K  +  LFLYV   +DDF +FFPS   R+ FY++V    ++  E M       +  + I+FEYE DD  +RIVLG+GT+G VF  R+L  Q++IA+KE+ E  + +VQPLHEEI LHS+L HRNIV YLGS SE G FKI MEQVPGGSL++LL+ K G L   E T SYY+ QILEGLKYLHD +I+HRDIKGDNVLVN Y+G++KISDFGTSKRL  +     TFTGT+QYMAPE+I KG  GYG PAD+WS GCT++EM TGKPPF +LG+P AA+FKVG +  HP+ P+ LS +A  F+ +CF PDP KRA    LL  PFL   +K+       +     I++P DK +     NI  S+  T  I         +P  ++   +     P+ N+    LL       IHM +   F S    S+       D      +   ++ GL +P V                FY+L+K+++ R  L ++L   +NN+   W + I++D  +  +T  H    LE+++    +Y+ D  KE L+  +  ++   ++     +   L IY  + A+   LR H  KPH + A D ++  AV  A  +L       L   D               T + T+     P S S+ I    S+    D   S++   +              DF++++  L+ EN KLLQ+L ++   Y   LK  + ++K HI  L+ T+ + +   +  S +      + N                 L +WL  + +    I   + EEY   + L++I ++D+ +L L+GG+ LK+  AI + +K
Sbjct:   55 NHRKRALEEIKQACALVN-ANLHQIQFEKLDFGEINVLTTFYNADVALVDLSLQLQQSSLFYHLGVRESFGMKENLLL-YNDIDT--ENTLRLKLSCG-SYTFLSYRLNSNNMCVTTNPESERLAGI-----DLN---CETQYTLIIKLKKLLQDVEVQSKVHIKEKFLSDLKKARDTLTGEELSIVLHNMRKRLDDPHVLCGEVVLSMLISFRDIQDYDAMVQLVEDLKTIPNKKSYIQTPVIRYLYPFALNRRNQEGDREKALHVIEKALEKKENHI-PDMVCLCGRIYKDKFVESQYLDKTSLENAIHWYRKGFEVQPNEYAGINLATLLVIDGNEFSKSEELQHIGMVLNNLIGKKGSLSSLQEYWDVATFFEISVLAEDYSKAVQAAECMFKLKPPNWYLKSTIGNITLIDRFRKKTEDSEASPEVQVFLFWMDYF--------------------------------------VEATKTE--------------VGDS---------IRFPILIQEHSKILMPSYVTVNLGAEEKSLQLWNLCMESMRGKCRQVHDWLFTASMIRSVSLYKRDERCLFLYVNQNSDDFQMFFPSQEWRQRFYDLVLE--MTADEGMFTGLDSDVSEDQIKFEYEMDDQGKRIVLGKGTYGVVFQARDLNTQVRIAVKEIPEKNLGDVQPLHEEIKLHSQLRHRNIVQYLGSVSEDGFFKIFMEQVPGGSLSALLRSKWGPLKENESTISYYTKQILEGLKYLHDQKIVHRDIKGDNVLVNTYSGVVKISDFGTSKRLAGLCPSTETFTGTLQYMAPEVIDKGQRGYGAPADIWSLGCTIVEMATGKPPFIELGSPQAAVFKVGYYKVHPEIPNELSDKAKSFILRCFEPDPYKRADAAELLEDPFLTEKKKTSRALVAPQEYSRSISVPADKVN----VNINHSTNTTNTIGITNSKSPLSPTEEI--VLKTKSHPVKNKGASSLLP-----PIHMPSTMYFNSLSMTSE------TDQSDINITRRSSSGGLLSPEVDNGLRGPAGTPTEQDGFYLLKKDSQRRMTLSRVLNQDQNNICQVWLKNIIQDVGETIITLGH----LEILIKGMRDYIADQHKEVLESVIHAIKEDLEFDSAAINHLHLAIYLFQDAVNVVLRLHSIKPHWMFALDNLVRTAVQAAITVLSPELGANLAGQD---------------TRDATRERSDAP-SVSSTINSVKSHKTSVDSFTSSIKAKN--------------DFRDQICLLKAENTKLLQELLDSQRMYQSLLKQALDDQKVHITLLKQTMDQMMFISNCTSDREFRCSPESNSRLLPQISVTDSSADSRLIDWLKGLNLDQRSIDKFLMEEYCLEDILHYIGRDDIRRLGLRGGIELKVWKAILKWRK 1338          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A088AF69 (Protein kinase domain-containing protein OS=Apis mellifera OX=7460 GN=LOC408533 PE=4 SV=1)

HSP 1 Score: 873.233 bits (2255), Expect = 0.000e+0
Identity = 492/1185 (41.52%), Postives = 689/1185 (58.14%), Query Frame = 1
Query:  106 RKSAYDELEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKKTAGNSVTIILYNVNEKGRVGVLETQCMIAMMTDNEDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRSREVLNFWLEFFENTIHDCEEEVKQTQEENPNNIWSAKRRKSSVTPKVILTSSTRTETTIHDAAVNDEVNQIGDTEDCQNLDRRVMYPVLVSDSEGILQPAFLQVNINSDIKSIRLW---YHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKSEVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLK-KNGAL--TEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELI-KGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKARNQKNDITIPDKFDHRLMSNIERSSTLTKVIKENKQGCFSAPPMDVSNSVPQN----IRPISNRKRGQLLSIDLLLVIHMKTNKRFRSDESISDGNSFYSPDPPXXXXXXXXXXXXLETPSV--------------GAFYMLRKETEARSELHKILKSVRNNVVSYWRELI---LEDDLKPLTYNHSCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANIL 3576
            R+ A +E+ + CN  +  ++  I F+ LD+  T VLDTFYNAD+ ++D+SI++QQ AL +HLGVRE+ GM ENI+L ++ +D+  ET   +K + GN  T + Y V E G        C+            +V    + L  KL+ L ++VEV  +AH+KEKFL DLR+ RE  + EEL + + NM +RLDDP +LS E++LN+++S+R+IQ YD +V L++ L T  T +  INT  I+  YAFALNRRNK+G+RE+AL VIEKA E   + V PDM+ L GRIYKD FV S++TDK++L  A  WY KGF++QPNEY GIN ATLLVI GN+ + SEEL  I + LN  IG KG+++ L DYWDVATFFE+SVLAEDY KA+QAAECMFKL+PP W LKSTIGNI LI  FRK  +   VS   ++ +FW ++F                                        +T+ E              +GD+         + +P+LV +   IL P+++ VN+ ++ KS+++W     +     + V DW FT ++I+ +SL K  +  LFLYV   +DDF ++FPS   R+ FY+++  E+   +E M+      +  + ++FEYE DD ++RI+LG+GT+G V+A R+L  Q++IA+KE+ E  + +VQPLHEEI LHS+L HRNIV YLGS SE+G FKI MEQVPGGSL++LL+ K G L   E T +YY+ QILEGLKYLHD +I+HRDIKGDNVLVN Y+G++KISDFG SKRL  +     TFTGT+QYMAPE+I KG  GYG PAD+WS GCT++EM TGKPPF +LG+P AA+FKVG +  HP+ P  LS  A +F+ +CF P+P+ RAT   LL  PFL   +K+           N +  P  F   +    +R   L K  K N     SA P+  S S          P+  R    LLS   +    +  N    +  SI    +    D   +  +   ++ GL +P V                FY+L+K+++ R  L ++L      +   W   I   L      L  NH    L L+M    +Y+ + ++E +   +  L+   D+     +   L IY  + A+   LR H  KPH + A D ++ NAV  A N+ 
Sbjct:   63 RRRALEEVRQACNLVN-ANIHHIQFEKLDFGETNVLDTFYNADVAVVDLSIQLQQSALFYHLGVRESFGMKENILL-HNDIDT--ETTIRIKLSCGN-YTFVSYRVVECG-------SCVATNPATTRITGEEVIDPKQHLTLKLKKLFQDVEVQSKAHMKEKFLADLRKARETYSGEELSKALNNMRKRLDDPNVLSGEVVLNVLISFREIQDYDAMVQLVDDLRTIPTHKNYINTPAIRNLYAFALNRRNKEGDRERALKVIEKALEKKENHV-PDMLCLCGRIYKDKFVESRHTDKESLKNAIHWYRKGFEVQPNEYAGINLATLLVIAGNEFSKSEELQHIGMVLNNLIGKKGSLSSLKDYWDVATFFEISVLAEDYSKAIQAAECMFKLKPPNWYLKSTIGNISLIDRFRKKNEEAEVSPEEQIFSFWTDYF--------------------------------------AEATKAE--------------VGDS---------IRFPLLVLEPTKILMPSYVNVNLGAEEKSVQIWNLCLDNMKNNCKQVHDWLFTANMIRSVSLYKRDERCLFLYVHQNSDDFQMYFPSVQCRQRFYDLIL-EMTRDQEGMVTDLDAYMTDDRMKFEYELDDQNKRIMLGKGTYGIVYAARDLNTQVRIAVKEIRERNLGDVQPLHEEIKLHSQLRHRNIVQYLGSVSEEGYFKIFMEQVPGGSLSALLRSKWGPLKENESTIAYYTKQILEGLKYLHDQKIVHRDIKGDNVLVNTYSGVVKISDFGMSKRLAGLCPSTETFTGTLQYMAPEVIDKGQRGYGAPADIWSLGCTIVEMATGKPPFIELGSPQAAVFKVGYYKIHPEIPSELSERAKNFILRCFEPNPDIRATAAELLEDPFLNEKKKT-----------NRLAAPPDFSRSISVPADRVERLGKSDKTNNNHIVSASPIQTSQSDDSGGLTKSSPLRERSPAHLLSPIRMPTATLSFNSMIGNTPSIETSET----DTAGASMTRRSSSGGLLSPEVELGGQPGQKTGEEQEGFYLLKKDSQRRMTLTRVLTQDEAKICEVWMRDIQIELSTSQTVLQMNH----LILLMRALRDYIAEQNQEVIVTAIRTLKEELDFDSTAITHLNLAIYLFQTAVNEVLRMHSIKPHWMFALDNLVRNAVQAAINVF 1153          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k5 (mitogen-activated protein kinase kinase kinase 5 [Source:NCBI gene;Acc:103033000])

HSP 1 Score: 679.478 bits (1752), Expect = 0.000e+0
Identity = 372/911 (40.83%), Postives = 540/911 (59.28%), Query Frame = 1
Query:  127 LEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKKTAGNSVTIILYNVNEKGRVGVLETQCMIA----MMTDNEDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRSREVLNFWLEFFENTIHDCEEEVKQTQEENPNNIWSAKRRKSSVTPKVILTSSTRTETTIHDAAVNDEVNQIGDTEDCQNLDRRVMYPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKS---EVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLK-KNGAL--TEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELI-KGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQ-TARKSLHKKKKARN 2823
            L   C  A   +L  + F  LD+  T VLD FYNAD+ +++M+   +Q +L +HLGVRE+  M  NIIL     DS  ++++SL+  A N +  I Y V  + +V   E+  M      M    E L   +C     L  +L  +L   +     + +E  LN++R+ RE  T  EL  ++  + +RLD+ E LS +I++N++LSYR IQ Y+ IV L+E+L    T   + N  H+++HYAFALNRRN+ G+R KAL ++    E   + V  D+  LVGRIYKD+F+ S +TD ++ + +  W+ +GF+ +P  + GINYA LL+  G+Q + S EL ++ + L+  +G KG++ +L  YWDV  F   S+LA D  + +QA+E +FKL+ PVW L S +  I +   FRKP    P  R +E+++FW++F                      + + K+  SSV   V++   T+                                         + QP++L +N + +  ++ +W+  P ++ + + +W F+   ++G+S+SK  + + FLYVV+ ++DF ++F +    + F  +V S   E   G +E         +SE ++++YEYD++ +R+VLG+GTFG V+AGR+L+ Q+++AIKE+ E   +  QPLHEEI LH  L H+NIV YLGS SE G  KI MEQVPGGSL++LL+ K G L   E T  +Y+ QILEGLKYLHDN+I HRDIKGDNVL+N Y+G+LKISDFGTSKRL  I     TFTGT+QYMAPE+I KGP GYG PAD+WS GCT+IEM TGKPPF +LG P AA+FKVG F  HP+ PD +S EA  F+ +CF PDP+ RAT   LL+H FL  T+RK   KK K  N
Sbjct:   92 LRDAC-EAVGTALEIVLFGKLDFGETAVLDRFYNADIAVVEMTDAFRQPSLFYHLGVRESFSMANNIILY---CDSNSDSLQSLQTCAANYL-FIPYMVTPQNKVYCCESSLMKGLSELMQPSFEALLGPIC---MPLLDRLIQILTVTQTSSCQYFRETILNEIRKARELYTGAELAAELGRIQQRLDNVECLSADIVINLLLSYRDIQDYESIVKLVETLEKLPTFDPVANP-HVKFHYAFALNRRNQPGDRPKALDIMLPLVES-EEQVASDIYCLVGRIYKDMFLDSHFTDTESRDSSIQWFRRGFESEPTLHSGINYAVLLLAAGHQFDSSFELRKVGVKLSSLLGKKGSLDKLQSYWDVGFFLGASILACDNTRVIQASEKLFKLKAPVWYLCSLVETILIYQHFRKPSSEPPGPR-QELVDFWMDFM---------------------VEATKKDVSSVRFPVLILEPTK-----------------------------------------VYQPSYLSINNDVEENTLSIWHVAPDDKNKGIHEWNFSAASVRGVSISKFDERSSFLYVVNNSEDFQIYFCTEMHCKRFCELVNSLTEETWRGPDEA------ECDSEALEYDYEYDEHGERVVLGKGTFGVVYAGRDLSNQVRLAIKEIPERDSRYSQPLHEEIALHKHLKHKNIVQYLGSISENGFIKIFMEQVPGGSLSALLRSKWGPLKNNEPTIGFYTKQILEGLKYLHDNQIAHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTETFTGTLQYMAPEIIDKGPRGYGKPADIWSLGCTIIEMATGKPPFYELGEPQAAMFKVGMFKIHPEIPDSMSSEAKAFILRCFEPDPDLRATANELLTHEFLTVTSRK---KKAKGNN 920          

HSP 2 Score: 56.225 bits (134), Expect = 3.238e-7
Identity = 39/136 (28.68%), Postives = 69/136 (50.74%), Query Frame = 1
Query: 3172 GAFYMLRKETEARSELHKILKSVRNNVVSYWRELILE-DDLKPLTYNHSCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANIL 3576
              F+MLRK++E R+ LH+IL   ++ +V   +E + +  +   L + H   L+  + +    ++   D++ +   L QL+   D+     S+ Q+ ++  + A+   LR H  KPH + A D II  AV  A  IL
Sbjct: 1008 AGFFMLRKDSERRATLHRILTEDKDKIVINLQEALTQGSEETKLKHEHISALVASLGE----FVRMADRKIIANTLSQLKLELDFDSTAISQLQVALFGFQDALNKVLRNHNIKPHWMFALDNIIRKAVQTAITIL 1139          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k5 (mitogen-activated protein kinase kinase kinase 5 [Source:NCBI gene;Acc:103033000])

HSP 1 Score: 674.085 bits (1738), Expect = 0.000e+0
Identity = 371/918 (40.41%), Postives = 540/918 (58.82%), Query Frame = 1
Query:  127 LEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKK-------TAGNSVTIILYNVNEKGRVGVLETQCMIA----MMTDNEDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRSREVLNFWLEFFENTIHDCEEEVKQTQEENPNNIWSAKRRKSSVTPKVILTSSTRTETTIHDAAVNDEVNQIGDTEDCQNLDRRVMYPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKS---EVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLK-KNGAL--TEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELI-KGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQ-TARKSLHKKKKARN 2823
            L   C  A   +L  + F  LD+  T VLD FYNAD+ +++M+   +Q +L +HLGVRE+  M  NIIL     DS  ++++SL++       T   +   I Y V  + +V   E+  M      M    E L   +C     L  +L  +L   +     + +E  LN++R+ RE  T  EL  ++  + +RLD+ E LS +I++N++LSYR IQ Y+ IV L+E+L    T   + N  H+++HYAFALNRRN+ G+R KAL ++    E   + V  D+  LVGRIYKD+F+ S +TD ++ + +  W+ +GF+ +P  + GINYA LL+  G+Q + S EL ++ + L+  +G KG++ +L  YWDV  F   S+LA D  + +QA+E +FKL+ PVW L S +  I +   FRKP    P  R +E+++FW++F                      + + K+  SSV   V++   T+                                         + QP++L +N + +  ++ +W+  P ++ + + +W F+   ++G+S+SK  + + FLYVV+ ++DF ++F +    + F  +V S   E   G +E         +SE ++++YEYD++ +R+VLG+GTFG V+AGR+L+ Q+++AIKE+ E   +  QPLHEEI LH  L H+NIV YLGS SE G  KI MEQVPGGSL++LL+ K G L   E T  +Y+ QILEGLKYLHDN+I HRDIKGDNVL+N Y+G+LKISDFGTSKRL  I     TFTGT+QYMAPE+I KGP GYG PAD+WS GCT+IEM TGKPPF +LG P AA+FKVG F  HP+ PD +S EA  F+ +CF PDP+ RAT   LL+H FL  T+RK   KK K  N
Sbjct:   92 LRDACE-AVGTALEIVLFGKLDFGETAVLDRFYNADIAVVEMTDAFRQPSLFYHLGVRESFSMANNIILY---CDSNSDSLQSLQEIVCQKNTTCAANYLFIPYMVTPQNKVYCCESSLMKGLSELMQPSFEALLGPIC---MPLLDRLIQILTVTQTSSCQYFRETILNEIRKARELYTGAELAAELGRIQQRLDNVECLSADIVINLLLSYRDIQDYESIVKLVETLEKLPTFDPVANP-HVKFHYAFALNRRNQPGDRPKALDIMLPLVES-EEQVASDIYCLVGRIYKDMFLDSHFTDTESRDSSIQWFRRGFESEPTLHSGINYAVLLLAAGHQFDSSFELRKVGVKLSSLLGKKGSLDKLQSYWDVGFFLGASILACDNTRVIQASEKLFKLKAPVWYLCSLVETILIYQHFRKPSSEPPGPR-QELVDFWMDFM---------------------VEATKKDVSSVRFPVLILEPTK-----------------------------------------VYQPSYLSINNDVEENTLSIWHVAPDDKNKGIHEWNFSAASVRGVSISKFDERSSFLYVVNNSEDFQIYFCTEMHCKRFCELVNSLTEETWRGPDEA------ECDSEALEYDYEYDEHGERVVLGKGTFGVVYAGRDLSNQVRLAIKEIPERDSRYSQPLHEEIALHKHLKHKNIVQYLGSISENGFIKIFMEQVPGGSLSALLRSKWGPLKNNEPTIGFYTKQILEGLKYLHDNQIAHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTETFTGTLQYMAPEIIDKGPRGYGKPADIWSLGCTIIEMATGKPPFYELGEPQAAMFKVGMFKIHPEIPDSMSSEAKAFILRCFEPDPDLRATANELLTHEFLTVTSRK---KKAKGNN 928          

HSP 2 Score: 73.559 bits (179), Expect = 1.896e-12
Identity = 91/351 (25.93%), Postives = 156/351 (44.44%), Query Frame = 1
Query: 3172 GAFYMLRKETEARSELHKILKSVRNNVVSYWRELILE-DDLKPLTYNHSCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANILFKA--GIFRLFDADPQTPAESHYLKPFCQTNENTKFSDRRPLSRSTGITGADSNPHENDFHVSAMIVDDLTTNDIWQPPFMNFDFKNELVKLQNENNKLLQDLCETTSEYNRHLKHCISEKKNHIDYLRA-TLGEKLITXXXXXXXXXXXXXXENLKNWLNEIGXXXXXXXXXXNEEYTFHEFLYFISKEDLYKLQLKGGVVLKILAAIERKKKE 4212
              F+MLRK++E R+ LH+IL   ++ +V   +E + +  +   L + H   L+  + +    ++   D++ +   L QL+   D+     S+ Q+ ++  + A+   LR H  KPH + A D II  AV  A  IL       F L         E          + +    +R P + S   T A S             V  L++    +          EL +++ E N+LL++L E   EY   L+  + EK+  I  L+  +    + T S  +      + D  L  WL   G  +  I  IV EEYT  +FL+ ++++DL  L+LKGG++ K+  AI   +++
Sbjct: 1016 AGFFMLRKDSERRATLHRILTEDKDKIVINLQEALTQGSEETKLKHEHISALVASLGE----FVRMADRKIIANTLSQLKLELDFDSTAISQLQVALFGFQDALNKVLRNHNIKPHWMFALDNIIRKAVQTAITILVPELRPHFSLASESDAADQEDDDDDDDAVPHGSPTHKNRAPPTASHDDTVATSG------------VSTLSSTVSHESHTAQHSVSMELGRMKLETNRLLEELLEREREYQCILQQVLDEKEQEIKLLKMRSEPIDVATPSVSTESSIGGEGDPELLKWLRLHGADADSIDRIVAEEYTLDDFLHCVTRDDLKSLRLKGGILCKLWKAIREHREK 1350          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k5 (mitogen-activated protein kinase kinase kinase 5 [Source:NCBI gene;Acc:103033000])

HSP 1 Score: 672.159 bits (1733), Expect = 0.000e+0
Identity = 367/901 (40.73%), Postives = 533/901 (59.16%), Query Frame = 1
Query:  127 LEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKKTAGNSVTIILYNVNEKGRVGVLETQCMIA----MMTDNEDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRSREVLNFWLEFFENTIHDCEEEVKQTQEENPNNIWSAKRRKSSVTPKVILTSSTRTETTIHDAAVNDEVNQIGDTEDCQNLDRRVMYPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKS---EVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLK-KNGAL--TEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELI-KGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQ-TARK 2793
            L   C  A   +L  + F  LD+  T VLD FYNAD+ +++M+   +Q +L +HLGVRE+  M  NIIL     DS  ++++SL+  A N +  I Y V  + +V   E+  M      M    E L   +C     L  +L  +L   +     + +E  LN++R+ RE  T  EL  ++  + +RLD+ E LS +I++N++LSYR IQ Y+ IV L+E+L    T   + N  H+++HYAFALNRRN+ G+R KAL ++    E   + V  D+  LVGRIYKD+F+ S +TD ++ + +  W+ +GF+ +P  + GINYA LL+  G+Q + S EL ++ + L+  +G KG++ +L  YWDV  F   S+LA D  + +QA+E +FKL+ PVW L S +  I +   FRKP    P  R +E+++FW++F                      + + K+  SSV   V++   T+                                         + QP++L +N + +  ++ +W+  P ++ + + +W F+   ++G+S+SK  + + FLYVV+ ++DF ++F +    + F  +V S   E   G +E            D +++YEYD++ +R+VLG+GTFG V+AGR+L+ Q+++AIKE+ E   +  QPLHEEI LH  L H+NIV YLGS SE G  KI MEQVPGGSL++LL+ K G L   E T  +Y+ QILEGLKYLHDN+I HRDIKGDNVL+N Y+G+LKISDFGTSKRL  I     TFTGT+QYMAPE+I KGP GYG PAD+WS GCT+IEM TGKPPF +LG P AA+FKVG F  HP+ PD +S EA  F+ +CF PDP+ RAT   LL+H FL  T+RK
Sbjct:   92 LRDAC-EAVGTALEIVLFGKLDFGETAVLDRFYNADIAVVEMTDAFRQPSLFYHLGVRESFSMANNIILY---CDSNSDSLQSLQTCAANYL-FIPYMVTPQNKVYCCESSLMKGLSELMQPSFEALLGPIC---MPLLDRLIQILTVTQTSSCQYFRETILNEIRKARELYTGAELAAELGRIQQRLDNVECLSADIVINLLLSYRDIQDYESIVKLVETLEKLPTFDPVANP-HVKFHYAFALNRRNQPGDRPKALDIMLPLVES-EEQVASDIYCLVGRIYKDMFLDSHFTDTESRDSSIQWFRRGFESEPTLHSGINYAVLLLAAGHQFDSSFELRKVGVKLSSLLGKKGSLDKLQSYWDVGFFLGASILACDNTRVIQASEKLFKLKAPVWYLCSLVETILIYQHFRKPSSEPPGPR-QELVDFWMDFM---------------------VEATKKDVSSVRFPVLILEPTK-----------------------------------------VYQPSYLSINNDVEENTLSIWHVAPDDKNKGIHEWNFSAASVRGVSISKFDERSSFLYVVNNSEDFQIYFCTEMHCKRFCELVNSLTEETWRGPDEA---------ECDSEYDYEYDEHGERVVLGKGTFGVVYAGRDLSNQVRLAIKEIPERDSRYSQPLHEEIALHKHLKHKNIVQYLGSISENGFIKIFMEQVPGGSLSALLRSKWGPLKNNEPTIGFYTKQILEGLKYLHDNQIAHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTETFTGTLQYMAPEIIDKGPRGYGKPADIWSLGCTIIEMATGKPPFYELGEPQAAMFKVGMFKIHPEIPDSMSSEAKAFILRCFEPDPDLRATANELLTHEFLTVTSRK 910          

HSP 2 Score: 56.225 bits (134), Expect = 3.017e-7
Identity = 39/136 (28.68%), Postives = 69/136 (50.74%), Query Frame = 1
Query: 3172 GAFYMLRKETEARSELHKILKSVRNNVVSYWRELILE-DDLKPLTYNHSCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANIL 3576
              F+MLRK++E R+ LH+IL   ++ +V   +E + +  +   L + H   L+  + +    ++   D++ +   L QL+   D+     S+ Q+ ++  + A+   LR H  KPH + A D II  AV  A  IL
Sbjct: 1001 AGFFMLRKDSERRATLHRILTEDKDKIVINLQEALTQGSEETKLKHEHISALVASLGE----FVRMADRKIIANTLSQLKLELDFDSTAISQLQVALFGFQDALNKVLRNHNIKPHWMFALDNIIRKAVQTAITIL 1132          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-1i11.3 (mitogen-activated protein kinase kinase kinase 5-like [Source:NCBI gene;Acc:103038360])

HSP 1 Score: 652.514 bits (1682), Expect = 0.000e+0
Identity = 446/1372 (32.51%), Postives = 697/1372 (50.80%), Query Frame = 1
Query:  127 LEKVCNRADDVSLVR-ISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKKTAGNSVTIILYNVNEKGRVGVLETQCMIAMMTDNEDLKSQVCSN--LKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRK-PEDNTPVSRSREVLNFWLEFFENTIHDCEEEVKQTQEENPNNIWSAKRRKSSVTPKVILTSSTRTETTIHDAAVNDEVNQIGDTEDCQNLDRRVMYPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKSEVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLKKN-GAL--TEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELI-KGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQ-TARKSLHKKKKARNQKNDITIPDKFDHRLMSNIERSSTLTKVIKENKQGCFSAPPMDVSNSVPQNIRPISNRKRGQLLSIDLLLVIHMKTNKRFRSDESISDGNSFYS-PDPPXXXXXXXXXXXXLETPSVG----AFYMLRKETEARSELHKILKSVRNNVVSYWRELILEDDLKPLTYNHSCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANILFKAGIFRL---FDADPQTPAESHYLKPFCQTNENTKFSDRRPLSRSTGITGADSNPHENDFHV-SAMIVDDLTTNDIWQPPFMNFDFKNELVKLQNENNKLLQDLCETTSEYNRHLKHCISEKKNHIDYLRATL-----GEKLITXXXXXXXXXXXXXXENLKNWLNEIGXXXXXXXXXXNEEYTFHEFLYFISKEDLYKLQLKGGVV 4173
            L + C  AD  +L+  + F  +   +++ LD+FYNAD+ +++MS   +Q +L +HLGVRE+  M  NIIL     +  +  ++ LK+  G S T I Y V+ +G+V   +   M  +    E L+        L  L   L  LL+ V +    +  E    ++R  RE  + + L Q++  + +RLD  ELLS +++++++LSYR IQ Y+ I+ L+E+L+       +    +I++ Y FALNRRN  G+R KALS I    E   D V  D+  L GRIYKD+F++S +TD  + ++A  WY K F+++P  + GIN   LL+  G++ + S EL +I + L+  +G KG++ ++ DYWDV  +    +LA ++ K ++A+E +++L  P+W L S +    L   F K PE   P    +++++FW+E     +  C+  V   +                  P +IL  +                              +V  P +VS            VN     ++++L + +P +  + +  WTF    I+G+S+SK  + + FLYV+  +DDF L FPS+   + F  +V S  L G+ +        +   +++F YE  +N ++ VLGRGT+G V+AGR+L+ Q++IAIKE+ E      QPLHEEI LH RL HRNIV YLGS SE G  KI ME+VPGGSL+SLL+   G L   E T  +Y+ QILEGLKYLHDN+I+HRDIKGDNVL+N Y+G+LKISDFGTSKRL  I     TFTGT+QYMAPE+I +GP GYG PAD+WS GCT+IEM TGKPPF++LG+P AA+FKVG F  HP+ P+ +S EA   L  CF  +P+KRAT + LL + FL+ + RK +                     RLM        +T            A     S SVP  ++ + N +    LS  L L   M   K     ES    N F   P+ P          + + +P+V       ++LRK++E R  LH++L    ++VV++ +E + + +   +T  H    ++ ++      +   D+++L   L++LRS      +  S  Q  ++S + A++  LR+   KPH + A D ++  AV  A  +L      +L   F+ +  +P            +E  +   + P   S     +   P +      S  + + L ++    P         E  +L  E  +LL  L E   EY   L++ +  K+  I+ L+  +     G KL+  +  +           +  WL  + V    I+ +V   +T    ++   K+DL    +KGG++
Sbjct:   77 LREAC--ADSHALLHTLPFACIALGTSDTLDSFYNADVAVVEMSDSFRQPSLFYHLGVRESFSMTNNIILY---CNKQENDLQVLKEQCG-SYTFIPYMVSPQGKVFACDANLMRGI---KELLQPNFVIEPLLTPLVDCLVKLLENVHINASEYFHESIRREIRVARERFSGQALSQELGRIQKRLDTVELLSPDVVMSLLLSYRDIQDYESIINLVETLNNLPMCM-VAAQPNIKFQYIFALNRRNHPGDRAKALSAILPVVES-GDQVASDVYCLCGRIYKDMFLSSGFTDTQSRDQACYWYGKAFEMEPALHSGINNVVLLMAAGHEFDTSIELRKIGVTLSSLLGRKGSLEKMQDYWDVGFYLGAGILANEHKKVIEASEKLYRLNAPMWYLGSVMETYILYKQFAKPPEVRHP---KQDMVDFWMELM---VQACKPTVSTAR-----------------CPVLILEPT------------------------------KVFQPTIVS------------VNEEDQSRTVQLKHVNPLK--KGLHKWTFPASAIRGVSISKFDERSCFLYVLYNSDDFQLCFPSDLHCKGFCELVSS--LIGQNDATGDDPGPVSGGELEFMYEKGENGEKAVLGRGTYGVVYAGRDLSNQVRIAIKEIPEKDSTYSQPLHEEIALHKRLKHRNIVQYLGSVSEGGFIKIFMEEVPGGSLSSLLRSQWGPLKDNEPTIVFYTKQILEGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTETFTGTLQYMAPEIIDQGPRGYGKPADIWSLGCTIIEMATGKPPFHELGSPQAAMFKVGMFKIHPNVPESMSEEAKACLMCCFESNPDKRATASELLKNAFLRGSPRKRI---------------------RLMPESTGPEPIT------------AGEYQRSMSVPIVVQDMDNTRTD--LSSSLDLRRSMTRVKESNISESPPSSNGFLGVPEEP---------QTDMASPAVSGENLGLFLLRKDSERRDTLHRVLTDHISHVVAHIQESLPQTEEPSITSEH----IKQLIGCLRENIRSPDRKQLTNRLLKLRSSLHSDAVPLSSLQAALFSFQDAVKKVLRQRQVKPHWMFALDNLLRQAVHDAITVLLPELKLQLQSSFEVEEGSP-----------ESEKPRKGSQDPAVESPKDKHSSQYPEQQRVEAKSPSLSNGLLSS--CSP------LAQEFTQLCQETRRLLTQLSEKEKEYQELLRNSMQSKQKEIEALKVKVPPENSGNKLVFQNPQTLP---------MLRWLRAVPVDEHTINTLVAHGFTLDSLVHMACKDDLRYCGIKGGML 1292          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k15 (mitogen-activated protein kinase kinase kinase 15 [Source:ZFIN;Acc:ZDB-GENE-091204-246])

HSP 1 Score: 452.595 bits (1163), Expect = 1.093e-135
Identity = 281/793 (35.44%), Postives = 428/793 (53.97%), Query Frame = 1
Query: 1603 TEDCQNLDRRVMYPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKSEVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLK-KNGALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELI-KGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKARNQKNDITIPDKFDHRLMSNIERSSTLTKVIKENKQGCFSAPPMDVSNSVPQNIRPISNRKRGQLLSIDLLLVIHMKTNKRFRSDESISDGNSFYSPDPPXXXXXXXXXXXXLETP-SVGAFYMLRKETEARSELHKILKSVRN----NVVSYWRELILEDDLKPLTYNHSCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANILFKAGIFRLFDADPQTPAESHYLKPFCQTNENTKFSDRRPLS-RSTGITGADSNPHENDFHVSAMIVDDLTTNDIWQPPFMNFDFKNELVKLQNENNKLLQDLCETTSEYNRHLKHCISEKKNHIDYLR 3957
             E  Q     + +PVL+ +   + QP+++ +N  ++ K++ +W+  PSE  + + +W FT   IKGIS+SK  +   FLYV   +DDF ++F +      F ++VK  +  G    + +  +  + + +++EY+Y++N  R+VLGRGT+G V+AGR+L+ Q++IAIKE+ E   +  QPLHEEI LH  L  RNIV YLGS SE G  KI MEQVPGGSL++LL+ K G L E T  +Y+ QILEGL+YLH+N+I+HRDIKGDNVLVN Y+G+LKISDFGTSKRL  +     TFTGT+QYMAPE+I KGP GYG PAD+WS GCT+IEM TGKPPF++LG P AA+FKVG F  HP+ P+ LS EA  F+ +CF PDPNKRAT   LL         K L  +   + +KN I +         S+  RS +L   ++    G         S+S   ++ P  + K            +  +  KR  S+  I    S Y    P    +     S   +  S    ++L+K++E R+ L+K+L   ++    NV  Y    + +     + Y+     ++ I+ +  +++   ++  +   + +L+   D+     ++ QL+++  + ++   LR H  KPH + A D II  AV  A  IL          A     AE    +      E+  F    P++   TG+T   S        +S++I  D       Q P        +L +L+ E ++LL++L +   EY + L+  I ++ + ++  R
Sbjct:  506 VEATQGTTNGLRFPVLILEPTKVYQPSYVSINSEAEEKNVSIWHVSPSE-TKGIHEWNFTASSIKGISISKFDERCCFLYVHDNSDDFQIYFSTEDQCGRFCSMVKEVITDGSGNAVELEGEG-DGDTLEYEYDYNENGDRVVLGRGTYGVVYAGRDLSNQVRIAIKEIPERDSRYSQPLHEEIALHKYLKQRNIVQYLGSVSEDGYIKIFMEQVPGGSLSALLRSKWGPLKEATIIFYTRQILEGLRYLHENQIVHRDIKGDNVLVNTYSGVLKISDFGTSKRLAGVNPCTETFTGTLQYMAPEIIDKGPRGYGAPADIWSLGCTIIEMATGKPPFHELGEPQAAMFKVGMFKIHPEIPESLSTEAKSFILRCFEPDPNKRATAGDLL---------KDLFVRHNIKGKKNKIALKP-------SDYIRSVSLPVQLQSEATG--------SSSSEHGSVSPDCDSKHD----------VFFEKKKRSGSENLIKPSTSMYFFSVPDESPTSEDRTSPASSENSDSGLFLLKKDSERRAILYKVLNEDQDKYVCNVCPYIHVCMCQPCDSYMFYH-----IKQIICILRDFIRSPERRVMASTISKLKLDLDFDSTSINQIQLVLFGFQDSVNKVLRNHHIKPHWMFAMDNIIRRAVQAAVTILIPELQTHFGPASESEGAEKDADE--VDVEEDGDFGAVEPVAPEDTGLTSGVST-------LSSVISHDSQRT---QHP-----LGVQLTRLKQETSRLLEELVQKEKEYQQVLRQTIQQRAHELELFR 1240          

HSP 2 Score: 310.842 bits (795), Expect = 1.338e-86
Identity = 180/444 (40.54%), Postives = 264/444 (59.46%), Query Frame = 1
Query:  127 LEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLK--------KTAGNSVTIILYNVNEKGRV---GVLETQCMIAMMTDNEDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSV---IEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRSREVLNFWLEFF 1416
            L++ C+ A+   L  ++F  LD+  T VLDTFY+AD+ ++DMS   +Q +L +HLGVRE+  M  N+IL YH  D+  +T +SLK         ++GN   I          +    V + +    M    ++L   +C     L  +  +LLK++ V   A  K+  LND+R+ RE+   EEL +++  +  R+D+ E+L+ +I++N++ SYR IQ YD +V L+++L    T   + N   IQ+HYAFALNRRN  G+RE+AL V   + ++CE  A    PDM  L GRIYKD+F+ S   D  + + A   Y KGF+LQP  Y GIN A LL++ G Q   S EL +I + LN  +G KG++ ++ +YWDV  FF VS+LA D  KAVQAAE +FKL+PP+W L+S + N+KLI  F+K   NT  S  RE LNFW++  
Sbjct:   77 LQRACD-AESAILTTVTFGRLDFGETSVLDTFYDADIAVVDMSDVFRQPSLFYHLGVRESFDMANNVIL-YH--DTDPDTAQSLKDMVAQKNTASSGNYYFIPYVMTPNHEYICCENVAQRRASEYMQPSWDNLLGPLCV---PLVDRFVSLLKDIHVTSCASFKDTLLNDIRKAREKYQGEELAKELSRIKLRIDNTEVLTQDIVMNLLFSYRDIQDYDAMVKLVQTLEMLPTCD-LANQPMIQFHYAFALNRRNSPGDREQALGVMLQVLQSCEHPA----PDMFCLCGRIYKDVFLDSDCKDTKSRDNAIQ-YRKGFELQPTLYSGINLAVLLIVSGQQFESSIELRKIGVRLNSLLGRKGSLEKMNNYWDVGQFFTVSMLANDIPKAVQAAEKLFKLKPPIWYLRSVVQNLKLIQHFKK--QNTEHSPQRERLNFWMDII 505          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: map3k19 (mitogen-activated protein kinase kinase kinase 19 [Source:ZFIN;Acc:ZDB-GENE-081104-140])

HSP 1 Score: 187.193 bits (474), Expect = 3.542e-53
Identity = 111/268 (41.42%), Postives = 152/268 (56.72%), Query Frame = 1
Query: 2032 LGRGTFGTVFAGRELTKQIK-IAIKEV----------NESQIK--EVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLKKNGALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQ-----RASTFTGTMQYMAPELIKGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVG-EFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFL 2778
            LG+G FGTVF G  LT Q K IA+KE+          N+   K  E+Q L +E+ L + L H N+V YLG+  E   F I ME VPGG++   ++  G L E     Y  Q+  GL YLH + +MH D+KG N ++    G++K+ DFG ++R+   +         +  GT  +MAPE+I G +GY   ADVWS GCT+ EM  G+PPF D+  P+AAL  +G      P  P   S EA +F+E+CFI D  KR +   LLSHPF+
Sbjct:   21 LGKGAFGTVFLG--LTNQGKLIAVKELELRDAQSANGNQGGQKQSELQKLQDEVELLTTLHHPNVVEYLGTEMEGNRFSIFMEFVPGGTVAETVRGFGPLGESVCRSYIAQMTRGLAYLHGHGVMHGDVKGSNAVIT-PAGVVKLIDFGCAQRVALALSCHENGGLHSVHGTAYWMAPEVING-TGYARRADVWSLGCTLHEMAVGRPPFADM-APMAALLHIGIRNGIMPGLPQAFSKEAQEFVEQCFIRDKLKRPSSQELLSHPFI 283          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 189.119 bits (479), Expect = 1.408e-50
Identity = 113/264 (42.80%), Postives = 149/264 (56.44%), Query Frame = 1
Query: 2029 VLGRGTFGTVF------AGRELT-KQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGS--RSEKGVFKIIMEQVPGGSLTSLLKKNGALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRAS---TFTGTMQYMAPELIKGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQT 2784
            +LG+G FG V+       GREL  KQ++     V  S  KEV  L  EI L   L H  IV Y G     ++    I ME +PGGS+   L+  GALTE  T  Y+ QILEG+ +LH N I+HRDIKG N+L +   G +K+ DFG SKRL  I  + +   + TGT  +M+PE+I G  GYG  AD+WS GCTV+EMLT KPP+ +    +AA+FK+      P  P H S  A D L + F+ +   R +   LL HPF+  
Sbjct:  364 LLGQGAFGRVYLCYDADTGRELAVKQVQFDPGSVETS--KEVNALECEIQLLKNLQHERIVQYFGCLRDPQQKTLSIFMEYMPGGSIKDQLRAYGALTENVTRKYTRQILEGVSFLHGNMIVHRDIKGANILRDS-TGNVKLGDFGASKRLQTICSQGTAMRSVTGTPYWMSPEVING-EGYGRKADIWSVGCTVVEMLTEKPPWAEFEA-MAAIFKIATQPTDPRLPLHASEHARDLLRRIFV-EAKLRPSAEDLLRHPFVHV 621          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006402.1 (pep scaffold:Pmarinus_7.0:GL481397:10373:21355:-1 gene:ENSPMAG00000005783.1 transcript:ENSPMAT00000006402.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 158.688 bits (400), Expect = 3.448e-43
Identity = 95/266 (35.71%), Postives = 137/266 (51.50%), Query Frame = 1
Query: 2032 LGRGTFGTVFAGRELTKQIKIAIKEVN------ESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLKKNGALTEETTSYYSNQILEGLKYL----HDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFT----GTMQYMAPELIKGPSGYGFPADVWSFGCTVIEMLTGKPPFN--DLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQ 2781
            +G G F + F  +++     +A+K+V         Q + VQ L EEI + SRL H NI+  LG+  EK  + + +E + GGS+ +LL K G   E     Y  Q+L GL YL    H N+++HRDIKG N+LV+     L+I+DFG + RL      A  F     GT+ +MAPE+++G   YG   D+WS GC +IEM   KPP+N       +A +FK+   +  P  P  L     D   +C    P+ R     LL HP  +
Sbjct:   30 IGLGAFSSCFQAQDIGTGTLMAVKQVTYVRNTASEQDEVVQTLREEIRMMSRLDHPNIIRMLGATCEKSNYNLFIEWMAGGSVANLLNKYGPFHERVVISYVEQLLRGLAYLHSNQHSNQLIHRDIKGANLLVDSMGQRLRIADFGAAARLASKGTGAGEFQGQLLGTIAFMAPEVLRGLQ-YGRSCDIWSVGCVIIEMSCAKPPWNAEKHSNHLALIFKIASTTTAPTVPPTLCPGLRDVALRCLELQPSDRPVARDLLKHPVFR 294          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: plk3 (polo-like kinase 3 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-030131-6134])

HSP 1 Score: 159.458 bits (402), Expect = 1.050e-40
Identity = 95/257 (36.96%), Postives = 135/257 (52.53%), Query Frame = 1
Query: 2029 VLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLH-----EEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLKKNGALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELIKGPSGYGFPADVWSFGCTVIEMLTGKPPF--NDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFL 2778
            +LG+G F   +   E       A K + + +++  +P H     +EI LH +L HR+IV ++ S  ++    II+E   G SL  +L+    LTE    YY  Q++ GL+YLH   ++HRD+K  N  V     + KI D G +  L     R  T  GT  Y+APE++    G+G  AD+WS GC V  ML G+PPF  +DL    A + + G F    +FP  LSH A D L     PDP+ RA++  L SHPFL
Sbjct:   32 LLGKGGFARCYLVTEEYTGCHFAAKIITKQRVE--KPGHRAKIEQEISLHRKLHHRHIVQFISSFKDENFIYIILELCNGQSLAHMLRSRKVLTETEVKYYLRQLISGLRYLHQCGVVHRDLKLGNFFVTDSMEV-KIGDLGLATTLEPPEMRKRTVCGTPNYLAPEVLN-KRGHGPEADIWSLGCAVFTMLAGRPPFSTSDLANTYACI-RSGRF----NFPPSLSHAARDLLTSALTPDPDLRASLLDLQSHPFL 279          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: stk25a (serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-GENE-041010-92])

HSP 1 Score: 142.895 bits (359), Expect = 2.189e-36
Identity = 96/257 (37.35%), Postives = 144/257 (56.03%), Query Frame = 1
Query: 2032 LGRGTFGTVFAGRELTKQIKIAIKEVN-ESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLKKNGALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGD--NVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELIKGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARK 2793
            +G+G+FG VF G +   +  +AIK ++ E    E++ + +EI + S+     +  Y GS  +     IIME + GGS   L+K  G L E   +    +IL+GL YLH  R +HRDIKG   NVL++   G +K++DFG + +L D   + +TF GT  +MAPE+IK  S Y F AD+WS G T IE+  G+PP ++L  P+  LF + + +  P    + S    +F++ C   DP  R T   LL H F+Q + K
Sbjct:   32 IGKGSFGEVFKGIDNRTKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTHYFGSYLKGTKLWIIMEYLGGGSALDLIKP-GPLEEHQIATILREILKGLDYLHSERKIHRDIKGPAANVLLS-EQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQ-SAYDFKADIWSLGITAIELAKGEPPNSEL-HPMRVLFLIPK-NNPPTLEGNYSKAFKEFVDSCLNKDPQFRPTAKELLKHKFIQRSAK 283          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: BCK1 (MAPKKK acting in the protein kinase C signaling pathway; the kinase C signaling pathway controls cell integrity; upon activation by Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p; MAPKKK is an acronym for mitogen-activated protein (MAP) kinase kinase kinase [Source:SGD;Acc:S000003631])

HSP 1 Score: 191.815 bits (486), Expect = 1.628e-49
Identity = 100/262 (38.17%), Postives = 153/262 (58.40%), Query Frame = 1
Query: 2029 VLGRGTFGTVFAGRELTKQIKIAIKEV--------NESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLKKNGALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRAS-TFTGTMQYMAPELIKGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDH----LSHEAIDFLEKCFIPDPNKRATVTSLLSHPF 2775
            ++G+G+FG V+    +T    +A+K+V        NE+ +  V+ L  E+     L H NIV YLG  ++  ++ + +E V GGS+ SL++  G   E    + + Q+L+GL YLH   I+HRD+K DN+L++  +GI KISDFG S++  DI   +  T  GT+ +MAPE++    GY    D+WS GC V+EM  GK P+++L   +AA+FK+G+    P  P+     +S    +FL+ CF  +P KR T   LLSHPF
Sbjct: 1180 MIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDLDHLNIVQYLGFENKNNIYSLFLEYVAGGSVGSLIRMYGRFDEPLIKHLTTQVLKGLAYLHSKGILHRDMKADNLLLDQ-DGICKISDFGISRKSKDIYSNSDMTMRGTVFWMAPEMVDTKQGYSAKVDIWSLGCIVLEMFAGKRPWSNLEV-VAAMFKIGKSKSAPPIPEDTLPLISQIGRNFLDACFEINPEKRPTANELLSHPF 1439          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: SSK2 (MAP kinase kinase kinase of HOG1 mitogen-activated signaling pathway; interacts with Ssk1p, leading to autophosphorylation and activation of Ssk2p which phosphorylates Pbs2p; also mediates actin cytoskeleton recovery from osmotic stress; a HOG-independent function of Ssk2p mediates the calcium-sensitive phenotype of the ptp2 msg5 double disruptant; SSK2 has a paralog, SSK22, that arose from the whole genome duplication [Source:SGD;Acc:S000005314])

HSP 1 Score: 170.629 bits (431), Expect = 4.985e-43
Identity = 104/298 (34.90%), Postives = 155/298 (52.01%), Query Frame = 1
Query: 2020 QRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQ---PL-HEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLKKNGALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFT--------------------------------GTMQYMAPELIKGPSGYG--FPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFP--DHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARK 2793
            +R  +G GTFG V++  +L     +A+KE+N    K +Q   PL  EE+ +   L+H NIVSY G    +    I ME   GGSL +LL+      E  T  Y+ Q+LEGL YLH++ I+HRD+K +N+L++ +NG++K  DFG +K++ +   R ++                                  GT  YMAPE I G +  G     DVWS GC V+EM+TG+ P+ +L    A ++ V      P FP  D +S   + FLE+C I +P+KRA+   LL  P++   R+
Sbjct: 1268 KRNFIGGGTFGRVYSAVDLDNGEILAVKEINIQDSKSMQKIFPLIKEEMSVLEILNHPNIVSYYGVEVHRDKVNIFMEYCEGGSLAALLEHGRIEDEMVTQVYTLQLLEGLAYLHESGIVHRDVKPENILLD-FNGVIKYVDFGAAKKIANNGTRLASMNKIENADGEHEDVTHVSDSKAVKNNENALLDMMGTPMYMAPESITGSTTKGKLGADDVWSLGCVVLEMITGRRPWANLDNEWAIMYHVAA-GHTPQFPTKDEVSSAGMKFLERCLIQNPSKRASAVELLMDPWIVQIRE 1563          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: STE11 (Signal transducing MEK kinase; involved in pheromone response and pseudohyphal/invasive growth pathways where it phosphorylates Ste7p, and the high osmolarity response pathway, via phosphorylation of Pbs2p; regulated by Ste20p and Ste50p; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004354])

HSP 1 Score: 165.622 bits (418), Expect = 1.683e-42
Identity = 89/221 (40.27%), Postives = 131/221 (59.28%), Query Frame = 1
Query: 2125 KEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLKKNGALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRA---STFTGTMQYMAPELIKGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFL 2778
            K V  L  E+ L   L H NIV+Y G+  E G   I +E VPGGS++S+L   G   E   + ++ QIL G+ YLH   I+HRDIKG N+L+++  G +KI+DFG SK+L  + ++    ++  G++ +M+PE++K  +     AD+WS GC VIEM TGK PF D  + + A+FK+G  +  P+ P   + E  +FL K F  D   R +   LL HP+L
Sbjct:  496 KMVDALQHEMNLLKELHHENIVTYYGASQEGGNLNIFLEYVPGGSVSSMLNNYGPFEESLITNFTRQILIGVAYLHKKNIIHRDIKGANILIDI-KGCVKITDFGISKKLSPLNKKQNKRASLQGSVFWMSPEVVKQTATTA-KADIWSTGCVVIEMFTGKHPFPDF-SQMQAIFKIGT-NTTPEIPSWATSEGKNFLRKAFELDYQYRPSALELLQHPWL 712          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: SSK22 (MAP kinase kinase kinase of HOG1 mitogen-activated signaling pathway; functionally redundant with Ssk2p; interacts with and is activated by Ssk1p; phosphorylates Pbs2p; SSK22 has a paralog, SSK2, that arose from the whole genome duplication [Source:SGD;Acc:S000000669])

HSP 1 Score: 163.696 bits (413), Expect = 6.206e-41
Identity = 100/282 (35.46%), Postives = 150/282 (53.19%), Query Frame = 1
Query: 2020 QRIVLGRGTFGTVFAGRELTKQIKIAIKEV---NESQIKEVQPL-HEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLKKNGALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRL----------------GDIMQRASTFTGTMQYMAPELIKGPSGYG--FPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKV--GEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARK 2793
            +R  +G GTFG V++   L     +A+KE+   + + +K++ PL  EE+ +   L+H NIV Y G    +    I ME   GGSL SLL       E  T  Y+ ++LEGL YLH + ++HRDIK +N+L++ +NGI+K  DFGT++ +                G   +  +   GT  YMAPE I G +  G     DVW+ GC V+EM TG+ P+++L    A ++ V  G   Q P+  D ++     FLE+C + DP  RAT   LL  P++   R+
Sbjct: 1036 KRSFIGGGTFGQVYSAINLENGEILAVKEIKIHDTTTMKKIFPLIKEEMTVLEMLNHPNIVQYYGVEVHRDKVNIFMEYCEGGSLASLLDHGRIEDEMVTQVYTFELLEGLAYLHQSGVVHRDIKPENILLD-FNGIIKYVDFGTARTVVGSRTRTVRNAAVQDFGVETKSLNEMMGTPMYMAPETISGSAVKGKLGADDVWALGCVVLEMATGRRPWSNLDNEWAIMYHVAAGRIPQLPN-RDEMTAAGRAFLERCLVQDPTMRATAVELLIDPWMIQIRE 1315          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 153.295 bits (386), Expect = 5.758e-38
Identity = 101/276 (36.59%), Postives = 147/276 (53.26%), Query Frame = 1
Query: 2029 VLGRGTFGTVF-AGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLKKNG-ALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELIKGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKARNQKNDITIPD 2850
            V+GRG++G V+ A  + T Q+ +AIKEV     +E+  +  EI L   L+H NIV Y G   +     I++E    GSL  L+ ++   L+E  +  Y  Q L GLKYLH   ++HRDIK  N+L++  N + K++DFG S  +      A T  GT+ +MAPE++ G  G    +D+WS G TV+EMLT  PP+++L T     + V   + +P  P   S    DFL KCF+ +  KR T   LL H ++ +      K  K    K D T  D
Sbjct:   30 VIGRGSYGVVYKAINKHTDQV-VAIKEVVYENDEELNDIMAEISLLKNLNHNNIVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSENESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTV-KLADFGVSTIVN---SSALTLAGTLNWMAPEIL-GNRGASTLSDIWSLGATVVEMLTKNPPYHNL-TDANIYYAVENDTYYP--PSSFSEPLKDFLSKCFVKNMYKRPTADQLLKHVWINSTENV--KVDKLNKFKEDFTDAD 294          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO47821 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL88])

HSP 1 Score: 195.667 bits (496), Expect = 4.760e-56
Identity = 106/265 (40.00%), Postives = 161/265 (60.75%), Query Frame = 1
Query: 2029 VLGRGTFGTVFAGRELTKQIKIAIKEVN------ESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSE--KGVFKIIMEQVPGGSLTSLLKKNGALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRAS------TFTGTMQYMAPELIKGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQ 2781
            VLG+G FGTVF G   T ++ IA+K+V       ++  ++ + L EE+ L   L H+NIV Y+G+  +  +    I ME VPGGS+   LK+ GA  E     Y+ QIL+G+ YLH+N ++HRDIKG N+++ M NG++K+ DFG +K++  +    S      +  GT  +MAPE+I+  +G+G  +D+WS GCTV EM TG+PP++++  P++A+F +G  S  P   +  S  AIDF+  C   D + R +   LL H FLQ
Sbjct:   10 VLGKGAFGTVFLGLVNTGEL-IAVKQVELHPNNVDAAERQYEKLQEEVGLLKSLKHKNIVQYIGTCMDDSQCTINIFMEFVPGGSIAQALKRFGAFVEPVFRRYTRQILDGVSYLHNNNVIHRDIKGGNIML-MPNGVIKLIDFGCAKKICMVGAHVSKSNILRSMRGTPYWMAPEVIR-ETGHGRKSDIWSIGCTVFEMATGQPPWSNV-PPLSAIFAIGNGSPVPRLDESFSAAAIDFVTSCMTRDQDTRPSADELLRHDFLQ 270          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO41410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4G7])

HSP 1 Score: 193.356 bits (490), Expect = 3.259e-55
Identity = 109/263 (41.44%), Postives = 152/263 (57.79%), Query Frame = 1
Query: 2029 VLGRGTFGTVFAGRELTKQIKIAIKEVNESQIK-----EVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLKKNGALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRAS--TFTGTMQYMAPELIKGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKS 2796
            +LG G FG V+   +L    ++A+K++   Q+      EV+ L  EI       +  IV Y G  ++     I ME +PGGS+   +K++GAL E  T  YS QILEG+ YLH NRI+HRDIKG N+L ++Y G +K++DFG SKRL  I  +    +  GT  +MAPE+I G  GYG  ADVWS GCTV+EMLT KPP+ D   P+AALFK+      P+ P  LS +A++F+      +   R +   LL   F+  +  S
Sbjct:    9 LLGAGAFGQVYMCHDLDTGRELAVKQIETGQLNSSTKNEVKALEGEIEFMKAFRNERIVQYYGIETDDLHIYIFMEYLPGGSIHEHIKQHGALNESLTRKYSRQILEGILYLHTNRIVHRDIKGANILRDLY-GNVKLADFGASKRLQTIRSKTGFRSVHGTPYWMAPEVING-EGYGRKADVWSVGCTVVEMLTTKPPWADF-EPMAALFKIATQPTEPELPSDLSVDAVEFVRSTLRMNSKSRPSADELLRFSFVTNSSMS 268          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO36150 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJF2])

HSP 1 Score: 185.267 bits (469), Expect = 7.521e-48
Identity = 97/262 (37.02%), Postives = 146/262 (55.73%), Query Frame = 1
Query: 2029 VLGRGTFGTVFAGRELTKQIKIAIKEVN------ESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLKKNGALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFT----GTMQYMAPELIKGPSGYGFPADVWSFGCTVIEMLTGKPPFN--DLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFL 2778
            +LG G F + +  R++     +A+K+V+        Q K  Q + +EI + +RL H +++  LG+    G F I +E + GGS++ LL K G   E     Y  QIL+G+ YLH+N+++HRDIKG N+LV+     ++I+DFG + RL   +  A  F     GT+ +MAPE+++G S YG   DVWS GC +IEM TGKPP+N  +    +A +FK+      PD P+HL+    D + +C    P  R     LL HP  
Sbjct:  582 LLGTGAFSSCYGARDVMTGSLMAVKQVSFCRNSKSEQDKVCQTIMDEIAILARLKHPHLIKCLGATRHTGHFNIFLEWMAGGSISMLLSKYGPFEEAILIRYLRQILQGVSYLHENQVVHRDIKGANILVDSTGQDIRIADFGAAARLATQITGAGEFQGQLLGTIAFMAPEVLRGES-YGRSCDVWSVGCVLIEMATGKPPWNAHEHSNHLALIFKIACAIGPPDIPEHLNPGVRDVVLRCLESKPEDRPAAVDLLQHPLF 842          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO42845 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0A9])

HSP 1 Score: 162.155 bits (409), Expect = 8.956e-44
Identity = 97/257 (37.74%), Postives = 144/257 (56.03%), Query Frame = 1
Query: 2032 LGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLK-KNGALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELIKGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDF--PDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARK 2793
            LG G++G+VF          +AIK+V      ++Q + +EI +  +     +V Y GS  +     I+ME    GS++ L+K +N  LTEE         L+GL+YLH  R +HRDIK  N+L+N   G  K++DFG + +L D M + +T  GT  +MAPE+I+   GY   AD+WS G T +EM  GKPP+ D+  P+ A+F +      P F  P   S +  DF+ KC + +P +RAT T LL H F+Q A++
Sbjct:   30 LGEGSYGSVFKAMHKESGQVVAIKQVPVD--TDLQEIIKEISMMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDLMKIRNKTLTEEEIKCVLKYTLKGLEYLHLRRKIHRDIKAGNILLN-SEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQ-EVGYDCLADIWSLGITAMEMAEGKPPYADI-HPMRAIFMI-PTKPPPTFRDPGQWSEDFKDFVSKCLVKNPEERATATELLQHSFIQGAKQ 280          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO49047 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHW1])

HSP 1 Score: 159.844 bits (403), Expect = 3.189e-43
Identity = 93/289 (32.18%), Postives = 155/289 (53.63%), Query Frame = 1
Query: 2032 LGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLKKNGALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPEL--IKGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDF---PDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFL-----QTARKSLHKKKKARNQKNDITIPDKFDHRL 2868
            +G GT+G VF  R +      A+K V      + + + +EI +  +  H NI++Y+G+   +    I ME   GGS+  +    G  +E   S+ + + L+GL YLH+  +MHRDIKG N+L+   NG +K++DFG S R+ + M++  +F GT  +MAPE+  ++   GY    D+W+ G T IEM   +PP  DL  P+ AL+ +G+ S  P      D  S+E   F++   I +P KR +   +L+HPF      +   + L  + + ++Q+ ++   D  D +L
Sbjct:   24 VGGGTYGDVFKARVIATGDLAAVKVVKVEPGDDFELIQQEIAMMQQCRHNNIINYIGAYMRRDKLWIGMEYCGGGSIQDVYCVTGPCSETQISFVTVETLKGLAYLHEKSLMHRDIKGANILLTT-NGEVKLADFGISARITETMKKRKSFIGTPYWMAPEMAAVERTGGYDLKCDIWAVGITAIEMAELQPPMFDL-HPMRALYIIGKKSFIPPTLKEKDKWSNEMHHFIKVALIKNPKKRPSADKMLTHPFCCRHLTKAVLQDLLDRYRRKSQEKNLQPDDSDDEQL 310          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map3k5 (mitogen-activated protein kinase kinase kinase 5 [Source:NCBI gene;Acc:101175702])

HSP 1 Score: 660.988 bits (1704), Expect = 0.000e+0
Identity = 411/1163 (35.34%), Postives = 634/1163 (54.51%), Query Frame = 1
Query:  127 LEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKKTAGNSVTIILYNVNEKGRVGVLETQCMIA----MMTDNEDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRSREVLNFWLEFFENTIHDCEEEVKQTQEENPNNIWSAKRRKSSVTPKVILTSSTRTETTIHDAAVNDEVNQIGDTEDCQNLDRRVMYPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKS---EVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLK-KNGAL--TEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELI-KGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKARNQKNDITIPDKFDHRLMSNIERSSTLTKVIKENKQGCFSAPPMDVSNSVPQNIRPISNRKRGQLLSIDLLLVIHMKTNKRFRSDESISDGNSFYSPDPPXXXXXXXXXXXXLETPSVGAFYMLRKETEARSELHKILKSVRNNVVSYWRELILE--DDLKPLTYNHSCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANIL 3576
            L+  C  A    L  ++F  LD+  T VLD FYNAD+ +++M+   +Q +L +HLGVRE+  M  NIIL     D+  ++++SL+  + N  T I Y V    +V   ++  M +    M    E L   +C     L  +   LL+  E     + +E  LN++R+ R+  +  EL  ++  + +RLD+ E LS ++++N++L+YR IQ Y+ IV L+E+L    T   + +  H++++YAFALNRRN  G+R+KAL ++     D  + V  D+  LVGRIYKD+F+ S +TD  +  + +S ++KGF+ +P  + GINYA LL+  G+Q + S EL ++ + L+  +G KG++ +L  YWDV  F   S+LA D  + + A+E +FKL+ PVW L+S +  I +   F+KP    P    +E+++FW++F                      + + K+  S+V   V++   T                             +V  P  +S          +  ++  +I SI  W+  P ++ + + +W F    ++G+S+SK  + + FLYV+  A+DF ++F +    + F ++V S   E   G EE         +++ ++++YEYD++ +R++LG+GTFG V+AGR+L+ Q+++AIKE+ E   +  QPLHEEI LH  L H+NIV YLGS SE G  KI MEQVPGGSL++LL+ K G L   E T  +Y+ QILEGLKYLHDN+I HRDIKGDNVL+N Y+G+LKISDFGTSKRL  I     TFTGT+QYMAPE+I KGP GYG PAD+WS GCT+IEM TG+PPF +LG P AA+FKVG F  HP+ P+ +S EA  F+ +CF PDP++RAT   LL+  FL    +    K         I++P      +   +E +S+ ++    +     ++ P     S+           R   LSI +               E+  D ++  SPD               E  S G F + RK++E R+ LH+I+   ++ VV+   E + +  ++LK L   H   L+  + D    ++   D++ +   L  L+   D+     S+ Q+ ++S + A+   LR H  KPH + A D II  AV  A  IL
Sbjct:   90 LKDACETAGS-KLDTVNFGKLDFGETAVLDRFYNADIAVVEMTDAFRQPSLFYHLGVRESFSMANNIILY---CDTNADSLQSLQTCSAN-YTFIPYMVTPHNKVYCCDSSLMKSLTELMQPSFEMLLGPIC---MPLLDRFIQLLRVSEANSHQYFRETILNEIRKARDLYSGVELAAELNRIQQRLDNVECLSVDVVINLLLTYRDIQDYESIVKLVETLEKLPTFDPMAHP-HVKFNYAFALNRRNLPGDRQKALDIMLPLV-DADEQVASDIYCLVGRIYKDMFLESHFTDTQS--RDSSMFKKGFESEPTLHSGINYAVLLLAAGHQFDTSFELRKVGVKLSSLLGKKGSLDKLQSYWDVGFFLGASILACDNTRVIHASEKLFKLKAPVWYLRSVVETILIYQHFKKPCSEPPPQNKQELVDFWMDFL---------------------VEATKKDVSAVRFPVLILEPT-----------------------------KVYQPSYLS----------INKDVEDNIVSI--WHVAPDDKNKGIHEWNFNAKSVRGVSISKFDERSAFLYVLHNAEDFQIYFCTEIHCKRFCDLVNSLTEEAWKGPEE------GDCDADTLEYDYEYDEHGERVILGKGTFGVVYAGRDLSNQVRLAIKEIPERDSRYSQPLHEEIALHKHLKHKNIVQYLGSISENGFIKIFMEQVPGGSLSALLRSKWGPLKNNEPTIGFYTRQILEGLKYLHDNQIAHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTETFTGTLQYMAPEIIDKGPRGYGKPADIWSLGCTIIEMATGRPPFYELGEPQAAMFKVGMFKIHPEIPESMSLEAKAFILRCFEPDPDRRATAFDLLTDEFLTVTSRRKKSKNSLTEYLRSISLP------VPVVVEDTSSSSEYGSVSPDNDLNSNPFIFKPSIKCYSEKDVKGPRSLFLSIPV---------------ENFEDHSAPPSPD---------------EKDS-GFFML-RKDSERRATLHRIMTEDQDKVVANLMEALGQGCEELK-LKPQHVSTLVSSLAD----FVRMADRKIIANTLSVLKLDLDFDSAAISQLQVALFSFQDAVNKVLRNHNIKPHWMFALDNIIRKAVQTAITIL 1129          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map3k5 (mitogen-activated protein kinase kinase kinase 5 [Source:NCBI gene;Acc:101175702])

HSP 1 Score: 643.654 bits (1659), Expect = 0.000e+0
Identity = 355/917 (38.71%), Postives = 537/917 (58.56%), Query Frame = 1
Query:  127 LEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKK-------TAGNSVTIILYNVNEKGRVGVLETQCMIA----MMTDNEDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRSREVLNFWLEFFENTIHDCEEEVKQTQEENPNNIWSAKRRKSSVTPKVILTSSTRTETTIHDAAVNDEVNQIGDTEDCQNLDRRVMYPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKS---EVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLK-KNGAL--TEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELI-KGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKARN 2823
            L+  C  A    L  ++F  LD+  T VLD FYNAD+ +++M+   +Q +L +HLGVRE+  M  NIIL     D+  ++++SL++       T   + T I Y V    +V   ++  M +    M    E L   +C     L  +   LL+  E     + +E  LN++R+ R+  +  EL  ++  + +RLD+ E LS ++++N++L+YR IQ Y+ IV L+E+L    T   + +  H++++YAFALNRRN  G+R+KAL ++     D  + V  D+  LVGRIYKD+F+ S +TD  + + +  W++KGF+ +P  + GINYA LL+  G+Q + S EL ++ + L+  +G KG++ +L  YWDV  F   S+LA D  + + A+E +FKL+ PVW L+S +  I +   F+KP    P    +E+++FW++F                      + + K+  S+V   V++   T                             +V  P  +S          +  ++  +I SI  W+  P ++ + + +W F    ++G+S+SK  + + FLYV+  A+DF ++F +    + F ++V S   E   G EE         +++ ++++YEYD++ +R++LG+GTFG V+AGR+L+ Q+++AIKE+ E   +  QPLHEEI LH  L H+NIV YLGS SE G  KI MEQVPGGSL++LL+ K G L   E T  +Y+ QILEGLKYLHDN+I HRDIKGDNVL+N Y+G+LKISDFGTSKRL  I     TFTGT+QYMAPE+I KGP GYG PAD+WS GCT+IEM TG+PPF +LG P AA+FKVG F  HP+ P+ +S EA  F+ +CF PDP++RAT   LL+  FL        ++KK++N
Sbjct:   90 LKDACETAGS-KLDTVNFGKLDFGETAVLDRFYNADIAVVEMTDAFRQPSLFYHLGVRESFSMANNIILY---CDTNADSLQSLQEIICQKNTTCSANYTFIPYMVTPHNKVYCCDSSLMKSLTELMQPSFEMLLGPIC---MPLLDRFIQLLRVSEANSHQYFRETILNEIRKARDLYSGVELAAELNRIQQRLDNVECLSVDVVINLLLTYRDIQDYESIVKLVETLEKLPTFDPMAHP-HVKFNYAFALNRRNLPGDRQKALDIMLPLV-DADEQVASDIYCLVGRIYKDMFLESHFTDTQSRDSSMLWFKKGFESEPTLHSGINYAVLLLAAGHQFDTSFELRKVGVKLSSLLGKKGSLDKLQSYWDVGFFLGASILACDNTRVIHASEKLFKLKAPVWYLRSVVETILIYQHFKKPCSEPPPQNKQELVDFWMDFL---------------------VEATKKDVSAVRFPVLILEPT-----------------------------KVYQPSYLS----------INKDVEDNIVSI--WHVAPDDKNKGIHEWNFNAKSVRGVSISKFDERSAFLYVLHNAEDFQIYFCTEIHCKRFCDLVNSLTEEAWKGPEE------GDCDADTLEYDYEYDEHGERVILGKGTFGVVYAGRDLSNQVRLAIKEIPERDSRYSQPLHEEIALHKHLKHKNIVQYLGSISENGFIKIFMEQVPGGSLSALLRSKWGPLKNNEPTIGFYTRQILEGLKYLHDNQIAHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTETFTGTLQYMAPEIIDKGPRGYGKPADIWSLGCTIIEMATGRPPFYELGEPQAAMFKVGMFKIHPEIPESMSLEAKAFILRCFEPDPDRRATAFDLLTDEFLTVTS----RRKKSKN 925          

HSP 2 Score: 453.751 bits (1166), Expect = 1.928e-135
Identity = 312/880 (35.45%), Postives = 468/880 (53.18%), Query Frame = 1
Query: 1633 VMYPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKS---EVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLK-KNGAL--TEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELI-KGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKARNQKNDITIPDKFDHRLMSNIERSSTLTKVIKENKQGCFSAPPMDVSNSVPQNIRPI--------SNRKRGQLLSIDLLLVIHMKTNKRFRSDESISDGNSFYSPDPPXXXXXXXXXXXXLETPSVGAFYMLRKETEARSELHKILKSVRNNVVSYWRELILE--DDLKPLTYNHSCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANILFKAGIFRLFDADPQTPAESHYLKPFCQTNENTKFSDRRPLSRSTGITGADSNPHENDFHVSAMIVDDLTTNDIWQPPFMNFDFKNELVKLQNENNKLLQDLCETTSEYNRHLKHCISEKKNHIDYLR---ATLGEKLITXXXXXXXXXXXXXXENLKNWLNEIGXXXXXXXXXXNEEYTFHEFLYFISKEDLYKLQLKGGVVLKILAAIERKKKE 4212
            V +PVL+ +   + QP++L +N + +   + +W+  P ++ + + +W F    ++G+S+SK  + + FLYV+  A+DF ++F +    + F ++V S   E   G EE         +++ ++++YEYD++ +R++LG+GTFG V+AGR+L+ Q+++AIKE+ E   +  QPLHEEI LH  L H+NIV YLGS SE G  KI MEQVPGGSL++LL+ K G L   E T  +Y+ QILEGLKYLHDN+I HRDIKGDNVL+N Y+G+LKISDFGTSKRL  I     TFTGT+QYMAPE+I KGP GYG PAD+WS GCT+IEM TG+PPF +LG P AA+FKVG F  HP+ P+ +S EA  F+ +CF PDP++RAT   LL+  FL    +    +KK+   KN +T        L S       + +    + +    +P  D+ NS P   +P             R   LSI +               E+  D ++  SPD                      F+MLRK++E R+ LH+I+   ++ VV+   E + +  ++LK L   H   L+  + D    ++   D++ +   L  L+   D+     S+ Q+ ++S + A+   LR H  KPH + A D II  AV  A  IL          A     A+   L    +   N+    R P   +   T A S             V  L++    +          EL +++ E N+LL++L E   EY   L+  + E++  I  +R   A  G  +     L SQ +    D  L +WL   G+    I  I+NEE+T +  LY ++++DL  L L+GGV+ K+  AI   +++
Sbjct:  532 VRFPVLILEPTKVYQPSYLSINKDVEDNIVSIWHVAPDDKNKGIHEWNFNAKSVRGVSISKFDERSAFLYVLHNAEDFQIYFCTEIHCKRFCDLVNSLTEEAWKGPEE------GDCDADTLEYDYEYDEHGERVILGKGTFGVVYAGRDLSNQVRLAIKEIPERDSRYSQPLHEEIALHKHLKHKNIVQYLGSISENGFIKIFMEQVPGGSLSALLRSKWGPLKNNEPTIGFYTRQILEGLKYLHDNQIAHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTETFTGTLQYMAPEIIDKGPRGYGKPADIWSLGCTIIEMATGRPPFYELGEPQAAMFKVGMFKIHPEIPESMSLEAKAFILRCFEPDPDRRATAFDLLTDEFLTVTSR----RKKS---KNSLTAQSAGSEYLRSISLPVPVVVEDTSSSSEYGSVSPDNDL-NSNPFIFKPSIKCYSEKDVKGPRSLFLSIPV---------------ENFEDHSAPPSPDEKD-----------------SGFFMLRKDSERRATLHRIMTEDQDKVVANLMEALGQGCEELK-LKPQHVSTLVSSLAD----FVRMADRKIIANTLSVLKLDLDFDSAAISQLQVALFSFQDAVNKVLRNHNIKPHWMFALDNIIRKAVQTAITILVPELRPHFSLASESDHADQDDLDDDVEPGRNSTHQSRAPAVAARDDTVATSG------------VSTLSSTVSHESHNAQRSVSMELGRMKLETNRLLEELLEKEREYQAILQQVLEEREEEIRLMRLRSAPAGTTVDVQQELRSQRADSREDPELSSWLRLCGLEQDAIDAILNEEFTLNNMLYDVTRDDLKSLNLRGGVLCKLWKAISDHRQK 1348          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: si:ch211-1i11.3 (mitogen-activated protein kinase kinase kinase 5 [Source:NCBI gene;Acc:101167985])

HSP 1 Score: 617.461 bits (1591), Expect = 0.000e+0
Identity = 349/894 (39.04%), Postives = 521/894 (58.28%), Query Frame = 1
Query:  127 LEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKKTAGNSVTIILYNVNEKGRVGVLETQ---CMIAMMTDNEDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRK-PEDNTPVSRSREVLNFWLEFFENTIHDCEEEVKQTQEENPNNIWSAKRRKSSVTPKVILTSSTRTETTIHDAAVNDEVNQIGDTEDCQNLDRRVMYPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKSEVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLK-KNGAL--TEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELI-KGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQT 2784
            L++ C  A   +L   SF+T+   +T++LD+FYNAD+ ++ MS    Q +L +HLGVRE+  M  NIIL  +  D     +++LK+  G S T I Y V+ +G++   ++    C+   M  +  L+      L  L  +L +LL  V +    + +E   +++R  RE  +   L +++  + +RLD  +LL+ +IILN++LSYR IQ YD ++ L+E+L+       +    +I++HY FALNRRN  G+R KAL  I    E   ++V  D+  L GRIYKD+F++S +TD  + ++A  WY K F+++P  + GIN   LL+  G++   S EL +I + ++  +G KG++ ++T YWDV  +   ++L ++Y K ++A+E +++L+ PVW + S +    L   F K PE  +P    ++ ++FW+E                                     ++L SS  T +T                 DC        YPVL+ +   + QPA + V+   + +++ L   H +   + +  WTF    I+G+S SK  + + FLYV   +DDF L FPS +  + F  +V S  L    E    + + +    ++F YE ++N  ++VLG+GT+G V+AGR+L+ Q++IAIKE+ E      QPLHEEI LH RL HRNIV YLGS S+ G  KI ME+VPGGSL+SLL+ K G L   E T  +Y+ Q+LEGLKYLHDN+I+HRDIKGDNVL+N Y+G+LKISDFGTSKRL  I     TF GT+QYMAPE+I +GP GYG PAD+WS GCT+IEM TGK PF++LG+P AA+FKVG F  HP  P+ +S EA  F+  CF P+P+ RAT   LL   FL++
Sbjct:   24 LKEACADAH-ATLKTFSFETVSLGTTDILDSFYNADVAVVQMSDTFCQPSLFYHLGVRESFCMTNNIILYCYKQDGD---LQALKEQCG-SYTFIPYMVSPQGKLIAWDSTIMTCIKEWMQPSLKLEPL----LTPLVERLVHLLNNVHIQSSEYFRESIRHEIRIARERFSGPALSEELGRIQQRLDSVDLLTPDIILNLLLSYRDIQDYDAMIKLVETLNNLPMCM-VARHQNIKFHYIFALNRRNHPGDRAKALQEILPIVES-GNNVASDVYCLCGRIYKDMFMSSMFTDVPSRDRACFWYGKAFEMEPTLHSGINSVVLLMAAGHEFETSIELRKIGVTISTLLGRKGSLEKMTHYWDVGFYLGANILVKEYRKVIEASEKLYRLKAPVWFVCSLMETYILYRQFAKLPETRSP---KQDTVDFWME-------------------------------------LLLQSSKPTIST-----------------DC--------YPVLILEPSKLFQPAIVSVSKEDESRTVHL--KHVTSVKKGLHQWTFPASAIRGVSASKIDERSCFLYVHYNSDDFQLCFPSETHCKSFCELVNS--LIQLAENPSQNREHLSGGVLEFVYETNENGDKVVLGKGTYGVVYAGRDLSNQVRIAIKEIPEKDSTYSQPLHEEIALHKRLKHRNIVQYLGSVSQDGFIKIFMEEVPGGSLSSLLRSKWGPLKDNEPTIIFYTKQVLEGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTETFAGTLQYMAPEIIDQGPRGYGKPADIWSLGCTIIEMATGKTPFHELGSPQAAMFKVGMFKIHPKVPECMSDEAKGFIMSCFEPNPDNRATAAELLMDTFLKS 837          

HSP 2 Score: 92.4337 bits (228), Expect = 3.035e-18
Identity = 91/352 (25.85%), Postives = 161/352 (45.74%), Query Frame = 1
Query: 3175 AFYMLRKETEARSELHKILKSVRNNVVSYWRELILEDDLKPLTYNHSCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANILFKAGIFRL---FDADPQTPAESHYLKPFCQTNENTKFSDRRPLSRSTGITGADSNPHENDFHVSAMIVDDLTTNDIWQPPFMNFD----FKNELVKLQNENNKLLQDLCETTSEYNRHLKHCISEKKNHIDYLRATLGEKLITXXXXXXXXXXXXXXENLKNWLNEIGXXXXXXXXXXNEEYTFHEFLYFISKEDLYKLQLKGGVVLKILAAIERKKK 4209
              +MLRK++E R+ LH+IL    N+VVS  ++ + + D + LT +H   L+  + D     +   ++++L   L++LRS      +  +  Q+++++ + A++  L++   KPH + A D ++  AV  A  +L      +L   F+ +  TP E     P                  +  +   D      D   +A   ++L T D+  P  +  D       +L  L+ E  +LL  L E   EY   L++ +  K+ HID LR    E +  D  L+S+ +S    + L  WL  I V    I  ++  E+T    L+   +EDL    L+GG++ ++ AAI   +K
Sbjct:  934 GLFMLRKDSERRATLHRILTDSLNHVVSNIQQSLPQCDDRCLTADHIIKLVTCLRD----NIRSPNRQQLTRGLLELRSTLLASGIPVNNLQVVLFNFQDAVKKVLKQQQVKPHWMFALDNLLRQAVQDAITVLLPELKIQLQSSFEFE-DTPLEGQPADP-----------------DTPVVLAPDQLGEPADTLRAATKKENLLTVDLSSPTHIILDGNCTLSEKLRDLRIETRRLLSQLSEKEQEYQMLLRNSMRRKRQHIDALRK---ETVAEDKELASRKNSKPETKALVRWLKSIQVDQDTIDKLLAHEFTLDCLLFMACREDLGYCGLRGGMLCRLWAAITAHRK 1260          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: si:ch211-1i11.3 (mitogen-activated protein kinase kinase kinase 5 [Source:NCBI gene;Acc:101167985])

HSP 1 Score: 617.461 bits (1591), Expect = 0.000e+0
Identity = 349/894 (39.04%), Postives = 521/894 (58.28%), Query Frame = 1
Query:  127 LEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKKTAGNSVTIILYNVNEKGRVGVLETQ---CMIAMMTDNEDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRK-PEDNTPVSRSREVLNFWLEFFENTIHDCEEEVKQTQEENPNNIWSAKRRKSSVTPKVILTSSTRTETTIHDAAVNDEVNQIGDTEDCQNLDRRVMYPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKSEVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLK-KNGAL--TEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELI-KGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQT 2784
            L++ C  A   +L   SF+T+   +T++LD+FYNAD+ ++ MS    Q +L +HLGVRE+  M  NIIL  +  D     +++LK+  G S T I Y V+ +G++   ++    C+   M  +  L+      L  L  +L +LL  V +    + +E   +++R  RE  +   L +++  + +RLD  +LL+ +IILN++LSYR IQ YD ++ L+E+L+       +    +I++HY FALNRRN  G+R KAL  I    E   ++V  D+  L GRIYKD+F++S +TD  + ++A  WY K F+++P  + GIN   LL+  G++   S EL +I + ++  +G KG++ ++T YWDV  +   ++L ++Y K ++A+E +++L+ PVW + S +    L   F K PE  +P    ++ ++FW+E                                     ++L SS  T +T                 DC        YPVL+ +   + QPA + V+   + +++ L   H +   + +  WTF    I+G+S SK  + + FLYV   +DDF L FPS +  + F  +V S  L    E    + + +    ++F YE ++N  ++VLG+GT+G V+AGR+L+ Q++IAIKE+ E      QPLHEEI LH RL HRNIV YLGS S+ G  KI ME+VPGGSL+SLL+ K G L   E T  +Y+ Q+LEGLKYLHDN+I+HRDIKGDNVL+N Y+G+LKISDFGTSKRL  I     TF GT+QYMAPE+I +GP GYG PAD+WS GCT+IEM TGK PF++LG+P AA+FKVG F  HP  P+ +S EA  F+  CF P+P+ RAT   LL   FL++
Sbjct:   80 LKEACADAH-ATLKTFSFETVSLGTTDILDSFYNADVAVVQMSDTFCQPSLFYHLGVRESFCMTNNIILYCYKQDGD---LQALKEQCG-SYTFIPYMVSPQGKLIAWDSTIMTCIKEWMQPSLKLEPL----LTPLVERLVHLLNNVHIQSSEYFRESIRHEIRIARERFSGPALSEELGRIQQRLDSVDLLTPDIILNLLLSYRDIQDYDAMIKLVETLNNLPMCM-VARHQNIKFHYIFALNRRNHPGDRAKALQEILPIVES-GNNVASDVYCLCGRIYKDMFMSSMFTDVPSRDRACFWYGKAFEMEPTLHSGINSVVLLMAAGHEFETSIELRKIGVTISTLLGRKGSLEKMTHYWDVGFYLGANILVKEYRKVIEASEKLYRLKAPVWFVCSLMETYILYRQFAKLPETRSP---KQDTVDFWME-------------------------------------LLLQSSKPTIST-----------------DC--------YPVLILEPSKLFQPAIVSVSKEDESRTVHL--KHVTSVKKGLHQWTFPASAIRGVSASKIDERSCFLYVHYNSDDFQLCFPSETHCKSFCELVNS--LIQLAENPSQNREHLSGGVLEFVYETNENGDKVVLGKGTYGVVYAGRDLSNQVRIAIKEIPEKDSTYSQPLHEEIALHKRLKHRNIVQYLGSVSQDGFIKIFMEEVPGGSLSSLLRSKWGPLKDNEPTIIFYTKQVLEGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTETFAGTLQYMAPEIIDQGPRGYGKPADIWSLGCTIIEMATGKTPFHELGSPQAAMFKVGMFKIHPKVPECMSDEAKGFIMSCFEPNPDNRATAAELLMDTFLKS 893          

HSP 2 Score: 92.4337 bits (228), Expect = 2.634e-18
Identity = 91/352 (25.85%), Postives = 161/352 (45.74%), Query Frame = 1
Query: 3175 AFYMLRKETEARSELHKILKSVRNNVVSYWRELILEDDLKPLTYNHSCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANILFKAGIFRL---FDADPQTPAESHYLKPFCQTNENTKFSDRRPLSRSTGITGADSNPHENDFHVSAMIVDDLTTNDIWQPPFMNFD----FKNELVKLQNENNKLLQDLCETTSEYNRHLKHCISEKKNHIDYLRATLGEKLITXXXXXXXXXXXXXXENLKNWLNEIGXXXXXXXXXXNEEYTFHEFLYFISKEDLYKLQLKGGVVLKILAAIERKKK 4209
              +MLRK++E R+ LH+IL    N+VVS  ++ + + D + LT +H   L+  + D     +   ++++L   L++LRS      +  +  Q+++++ + A++  L++   KPH + A D ++  AV  A  +L      +L   F+ +  TP E     P                  +  +   D      D   +A   ++L T D+  P  +  D       +L  L+ E  +LL  L E   EY   L++ +  K+ HID LR    E +  D  L+S+ +S    + L  WL  I V    I  ++  E+T    L+   +EDL    L+GG++ ++ AAI   +K
Sbjct:  990 GLFMLRKDSERRATLHRILTDSLNHVVSNIQQSLPQCDDRCLTADHIIKLVTCLRD----NIRSPNRQQLTRGLLELRSTLLASGIPVNNLQVVLFNFQDAVKKVLKQQQVKPHWMFALDNLLRQAVQDAITVLLPELKIQLQSSFEFE-DTPLEGQPADP-----------------DTPVVLAPDQLGEPADTLRAATKKENLLTVDLSSPTHIILDGNCTLSEKLRDLRIETRRLLSQLSEKEQEYQMLLRNSMRRKRQHIDALRK---ETVAEDKELASRKNSKPETKALVRWLKSIQVDQDTIDKLLAHEFTLDCLLFMACREDLGYCGLRGGMLCRLWAAITAHRK 1316          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map3k15 (mitogen-activated protein kinase kinase kinase 15 [Source:NCBI gene;Acc:101156777])

HSP 1 Score: 417.927 bits (1073), Expect = 4.126e-123
Identity = 209/415 (50.36%), Postives = 277/415 (66.75%), Query Frame = 1
Query: 1603 TEDCQNLDRRVMYPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKSEVLSGKEEMLMMSSDMIESEDIQFEYEYDDND--QRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLK-KNGALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELI-KGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKARNQKND 2835
             E  Q    R+ +PVL+ +   + QP+++ +N  ++  ++ +W+  P+E  + + +W FT + IKGIS+SK  +   FLYV   +DDF ++F +      F + VK  +       + +     E +    EYEYD N+   R+VLGRGT+G V+AGR+L+ Q++IAIKE+ E   +  QPLHEEI LH  L HRNIV YLGS SE G  KI MEQVPGGSL++LL+ K G L E T  +Y+ QILEGL+YLH+N+I+HRDIKGDNVLVN Y+G+LKISDFGTSKRL  +     TFTGT+QYMAPE+I KGP GYG PAD+WS GCT+IEM TGKPPF++LG P AA+FKVG F  HP+ P+ LS EA  F+ +CF PDPNKR   T LL  PF++   K   KK K   + +D
Sbjct:  483 VEATQGTTNRLRFPVLILEPTKVYQPSYVSINNEAEEMNVSIWHVSPAE-TKGIHEWNFTPNSIKGISISKFDERCCFLYVHDNSDDFQIYFSTEEQCGRFCSKVKEMISDSTGNAVELEG---EGDGDTLEYEYDTNETGDRVVLGRGTYGVVYAGRDLSNQVRIAIKEIPERDSRYSQPLHEEIALHKYLKHRNIVQYLGSISENGFIKIFMEQVPGGSLSALLRSKWGPLKEATIIFYTRQILEGLRYLHENQIVHRDIKGDNVLVNTYSGVLKISDFGTSKRLAGVNPCTETFTGTLQYMAPEIIDKGPRGYGAPADIWSLGCTIIEMATGKPPFHELGEPQAAMFKVGMFKIHPEIPESLSLEAKSFILRCFEPDPNKRPITTDLLKDPFIRHNAKG--KKSKIAFKSSD 891          

HSP 2 Score: 313.538 bits (802), Expect = 2.866e-87
Identity = 177/442 (40.05%), Postives = 262/442 (59.28%), Query Frame = 1
Query:  112 SAYDELEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKKTAGNSVTIILYNVNEKGRVGVLETQCMIA----MMTDNEDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSV---IEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRSREVLNFWLEFF 1416
             A   L++ C+ A+   L  ++F  LD+  T VLD+FY+AD+ ++DMS   +Q +L +HLGVRE+  M  N+IL YH  D+  +T +SLK ++GN    I Y V         E+         M    ++L   +C     L  +  +LLK++ V   A  K+  LND+R+ RE+   EEL +++  +  R+D+ E+L+ +I++N++ SYR IQ YD +V L+++L    T   +     IQ+HYAFALNRRN  G+RE+AL V   + ++CE  A    PDM  L GRIYKDIF+ S   D    + A  WY KGF+LQP  Y GIN A LL++ G Q   S EL +I + LN  +G KG++ ++ +YWDV  FF VS+LA D  KA QAAE +FKL+PP+W L+S + N++LI  ++K   +   S  RE L+FW++  
Sbjct:   56 GALQSLQRACD-AESALLTTVTFGRLDFGETSVLDSFYDADIAVVDMSDVFRQPSLFYHLGVRESFDMANNVIL-YH--DTDPDTAQSLKASSGN-YYFIPYIVTPSHEYMCCESDAQRRASEYMQPSWDNLLGPLCV---PLTDRFTSLLKDIHVTSCASFKDTLLNDIRKAREKYQGEELAKELTRIKLRMDNTEVLTQDIVMNLLFSYRDIQDYDAMVKLVQTLELLPTCD-LATQPMIQFHYAFALNRRNSPGDREQALKVMLQVLQSCEHPA----PDMFCLCGRIYKDIFLDSDCKDTINRDNAIQWYRKGFELQPTLYSGINLAVLLIVAGQQFENSMELRKIGVRLNSLLGRKGSLEKMNNYWDVGQFFTVSMLASDIPKATQAAEKLFKLKPPLWYLRSVVQNLQLIQRYKK--QSMEHSPQRERLDFWMDII 482          

HSP 3 Score: 57.7658 bits (138), Expect = 1.221e-7
Identity = 78/347 (22.48%), Postives = 145/347 (41.79%), Query Frame = 1
Query: 3172 GAFYMLRKETEARSELHKILKSVRNNVVSYWRELILE--DDLKPLTYNHSCNLLELIMDLFLN---YLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANILFKA-----GIFRLFDADPQTPAESHYLKPFC---QTNENTKFSDRRPLSRSTGITGADSNPHENDFHVSAMIVDDLTTNDIWQPPFMNFDFKNELVKLQNENNKLLQDLCETTSEYNRHLKHCISEKKNHIDYLRATLGEKLITXXXXXXXXXXXXXXENLKNWLNEIGXXXXXXXXXXNEEYTFHEFLYFISKEDLYKLQLKGGVV 4173
            G  ++L+K++E R+ L+K+L   +  V+S  RE  ++  ++L+ L+ +H   ++ ++ D   +    ++     KLK DL       D+     ++ QL+++  + ++   LR H  KPH + A D II  AV  A  IL        G     +   +          FC    +N +       P+     IT   +  H  + H S    + L T               +L +L+ E ++LL++L +   EY + LK  + ++ + ++ +R                         L++       +   +   V EEYT  + L  +SK+DL  L L+GGV+
Sbjct:  972 GGLFLLKKDSERRAILYKVLNEDQEKVISNLRENHIQGSEELQ-LSADHIKQIICILRDFIHSPERRVMAATISKLKLDL-------DFDSTSINQIQLVLFGFQDSVNKVLRNHHIKPHWMFAMDNIIRRAVQAAITILIPELQTHFGPASECEGAEKEDEVDEEESDFCPVLTSNSDDPVVTVEPVH---SITVPLNIAHSQEHHRSQ---NQLGT---------------QLGRLKQETSRLLEELLQKEREYQQVLKTTLQQRTHDLELIR-------------------------LRHRPPTDPSTIEKVLDFVVEEYTLTDILNDVSKDDLRCLHLRGGVL 1264          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000004938.1 (SMESG000004938.1)

HSP 1 Score: 2747.61 bits (7121), Expect = 0.000e+0
Identity = 1368/1398 (97.85%), Postives = 1370/1398 (98.00%), Query Frame = 1
Query:   49 CVTDFEPNVTCNDAQLYDYRKSAYDELEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKKTAGNSVTIILYNVNEKGRVGVLETQCMIAMMTDNEDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRSREVLNFWLEFFENTIHDCEEEVKQTQEENPNNIWSAKRRKSSVTPKVILTSSTRTETTIHDAAVNDEVNQIGDTEDCQNLDRRVMYPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKSEVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLKKNGALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELIKGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKARNQKNDITIPDKFDHRLMSNIERSSTLTKVIKENKQGCFSAPPMDVSNSVPQNIRPISNRKRGQLLSIDLLLVIHMKTNKRFRSDESISDGNSFYSPDPPXXXXXXXXXXXXLETPSVGAFYMLRKETEARSELHKILKSVRNNVVSYWRELILEDDLKPLTYNHSCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANILFKAGIFRLFDADPQTPAESHYLKPFCQTNENTKFSDRRPLSRSTGITGADSNPHENDFHVSAMIVDDLTTNDIWQPPFMNFDFKNELVKLQNENNKLLQDLCETTSEYNRHLKHCISEKKNHIDYLRATLGEKLITXXXXXXXXXXXXXXENLKNWLNEIGXXXXXXXXXXNEEYTFHEFLYFISKEDLYKLQLKGGVVLKILAAIERKKKELEFENMSRND 4242
            CVTDFEPNVTCNDAQLYDYRKSAYDELEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKKTAGNSVTIILYNVNEKGRVGVLETQCMIAMMTDNEDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRSREVLNFWLEFFENTIHDCEEEVKQTQEENPNNIWSAKRRKSSVTPKVILTSSTRTETTIHDAAVNDEVNQIGDTEDCQNLDRRVMYPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKSEVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLKKNGALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELIKGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKARNQKNDITIPDKFDHRLMSNIERSSTLTKVIKENKQGCFSAPPMDVSNSVPQNI                          RFRSDESISDGNSFYSPDPPSSGGSIAGNNSGLETPSVGAFYMLRKETEARSELHKILKSVRNNVVSYWRELILEDDLKPLTYN SCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANILFKAGIFRLFDADPQTPAESHYLKPFCQTNENTKFSDRRPLSRSTGITGADSNPHENDFHVSAMIVDDLTTNDIWQPPFMNFDFKNELVKLQNENNKLLQDLCETTSEYNRHLKHCI+EKKNHIDYLRATLGEKLITDSGLSSQVS LDSD+NLKNWLNEIGVSSSVISVIVNEEYTFHEFLYFISKEDLYKLQLKGGVVLKILAAIERKKKELEFENMSRND
Sbjct:    5 CVTDFEPNVTCNDAQLYDYRKSAYDELEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKKTAGNSVTIILYNVNEKGRVGVLETQCMIAMMTDNEDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRSREVLNFWLEFFENTIHDCEEEVKQTQEENPNNIWSAKRRKSSVTPKVILTSSTRTETTIHDAAVNDEVNQIGDTEDCQNLDRRVMYPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKSEVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLKKNGALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELIKGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKARNQKNDITIPDKFDHRLMSNIERSSTLTKVIKENKQGCFSAPPMDVSNSVPQNI--------------------------RFRSDESISDGNSFYSPDPPSSGGSIAGNNSGLETPSVGAFYMLRKETEARSELHKILKSVRNNVVSYWRELILEDDLKPLTYNQSCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANILFKAGIFRLFDADPQTPAESHYLKPFCQTNENTKFSDRRPLSRSTGITGADSNPHENDFHVSAMIVDDLTTNDIWQPPFMNFDFKNELVKLQNENNKLLQDLCETTSEYNRHLKHCINEKKNHIDYLRATLGEKLITDSGLSSQVSRLDSDKNLKNWLNEIGVSSSVISVIVNEEYTFHEFLYFISKEDLYKLQLKGGVVLKILAAIERKKKELEFENMSRND 1376          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000004938.1 (SMESG000004938.1)

HSP 1 Score: 2739.91 bits (7101), Expect = 0.000e+0
Identity = 1367/1398 (97.78%), Postives = 1369/1398 (97.93%), Query Frame = 1
Query:   49 CVTDFEPNVTCNDAQLYDYRKSAYDELEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKKTAGNSVTIILYNVNEKGRVGVLETQCMIAMMTDNEDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRSREVLNFWLEFFENTIHDCEEEVKQTQEENPNNIWSAKRRKSSVTPKVILTSSTRTETTIHDAAVNDEVNQIGDTEDCQNLDRRVMYPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKSEVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLKKNGALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELIKGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKARNQKNDITIPDKFDHRLMSNIERSSTLTKVIKENKQGCFSAPPMDVSNSVPQNIRPISNRKRGQLLSIDLLLVIHMKTNKRFRSDESISDGNSFYSPDPPXXXXXXXXXXXXLETPSVGAFYMLRKETEARSELHKILKSVRNNVVSYWRELILEDDLKPLTYNHSCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANILFKAGIFRLFDADPQTPAESHYLKPFCQTNENTKFSDRRPLSRSTGITGADSNPHENDFHVSAMIVDDLTTNDIWQPPFMNFDFKNELVKLQNENNKLLQDLCETTSEYNRHLKHCISEKKNHIDYLRATLGEKLITXXXXXXXXXXXXXXENLKNWLNEIGXXXXXXXXXXNEEYTFHEFLYFISKEDLYKLQLKGGVVLKILAAIERKKKELEFENMSRND 4242
            CVTDFEPNVTCNDAQLYDYRKSAYDELEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKKTAGNSVTIILYNVNEKGRVGVLETQCMIAMMTDNEDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRSREVLNFWLEFFENTIHDCEEEVKQTQEENPNNIWSAKRRKSSVTPKVILTSSTRTETTIHDAAVNDEVNQIGDTEDCQNLDRRVMYPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKSEVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLKKNGALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELIKGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKARNQKNDITIPDKFDHRLMSNIERSSTLTKVIKENKQGCFSAPPMDVSNSVPQNI                          RFRSDESISDGNSFYSPDPPSSGGSIAGNNSGLETPSVGAFYMLRKETEARSELHKILKSVRNNVVSYWRELILEDDLKPLTYN SCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANILFK GIFRLFDADPQTPAESHYLKPFCQTNENTKFSDRRPLSRSTGITGADSNPHENDFHVSAMIVDDLTTNDIWQPPFMNFDFKNELVKLQNENNKLLQDLCETTSEYNRHLKHCI+EKKNHIDYLRATLGEKLITDSGLSSQVS LDSD+NLKNWLNEIGVSSSVISVIVNEEYTFHEFLYFISKEDLYKLQLKGGVVLKILAAIERKKKELEFENMSRND
Sbjct:    5 CVTDFEPNVTCNDAQLYDYRKSAYDELEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKKTAGNSVTIILYNVNEKGRVGVLETQCMIAMMTDNEDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRSREVLNFWLEFFENTIHDCEEEVKQTQEENPNNIWSAKRRKSSVTPKVILTSSTRTETTIHDAAVNDEVNQIGDTEDCQNLDRRVMYPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKSEVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLKKNGALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELIKGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKARNQKNDITIPDKFDHRLMSNIERSSTLTKVIKENKQGCFSAPPMDVSNSVPQNI--------------------------RFRSDESISDGNSFYSPDPPSSGGSIAGNNSGLETPSVGAFYMLRKETEARSELHKILKSVRNNVVSYWRELILEDDLKPLTYNQSCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANILFK-GIFRLFDADPQTPAESHYLKPFCQTNENTKFSDRRPLSRSTGITGADSNPHENDFHVSAMIVDDLTTNDIWQPPFMNFDFKNELVKLQNENNKLLQDLCETTSEYNRHLKHCINEKKNHIDYLRATLGEKLITDSGLSSQVSRLDSDKNLKNWLNEIGVSSSVISVIVNEEYTFHEFLYFISKEDLYKLQLKGGVVLKILAAIERKKKELEFENMSRND 1375          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000004938.1 (SMESG000004938.1)

HSP 1 Score: 2724.12 bits (7060), Expect = 0.000e+0
Identity = 1361/1398 (97.35%), Postives = 1363/1398 (97.50%), Query Frame = 1
Query:   49 CVTDFEPNVTCNDAQLYDYRKSAYDELEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKKTAGNSVTIILYNVNEKGRVGVLETQCMIAMMTDNEDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRSREVLNFWLEFFENTIHDCEEEVKQTQEENPNNIWSAKRRKSSVTPKVILTSSTRTETTIHDAAVNDEVNQIGDTEDCQNLDRRVMYPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKSEVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLKKNGALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELIKGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKARNQKNDITIPDKFDHRLMSNIERSSTLTKVIKENKQGCFSAPPMDVSNSVPQNIRPISNRKRGQLLSIDLLLVIHMKTNKRFRSDESISDGNSFYSPDPPXXXXXXXXXXXXLETPSVGAFYMLRKETEARSELHKILKSVRNNVVSYWRELILEDDLKPLTYNHSCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANILFKAGIFRLFDADPQTPAESHYLKPFCQTNENTKFSDRRPLSRSTGITGADSNPHENDFHVSAMIVDDLTTNDIWQPPFMNFDFKNELVKLQNENNKLLQDLCETTSEYNRHLKHCISEKKNHIDYLRATLGEKLITXXXXXXXXXXXXXXENLKNWLNEIGXXXXXXXXXXNEEYTFHEFLYFISKEDLYKLQLKGGVVLKILAAIERKKKELEFENMSRND 4242
            CVTDFEPNVTCNDAQLYDYRKSAYDELEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKKTAGNSVTIILYNVNEKGRVGVLETQCMIAMMTDNEDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRSREVLNFWLEFFENTIHDCEEEVKQTQEENPNNIWSAKRRKSSVTPKVILTSSTRTETTIHDAAVNDEVNQIGDTEDCQNLDRRVMYPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKSEVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLKKNGALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELIKGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKARNQKNDITIPDKFDHRLMSNIERSSTLTKVIKENKQGCFSAPPMDVSNSVPQNI                          RFRSDESISDGNSFYSPDPPSSGGSIAGNNSGLETPSVGAFYMLRKETEARSELHKILKSVRNNVVSYWRELILEDDLKPLTYN SCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANILFK       DADPQTPAESHYLKPFCQTNENTKFSDRRPLSRSTGITGADSNPHENDFHVSAMIVDDLTTNDIWQPPFMNFDFKNELVKLQNENNKLLQDLCETTSEYNRHLKHCI+EKKNHIDYLRATLGEKLITDSGLSSQVS LDSD+NLKNWLNEIGVSSSVISVIVNEEYTFHEFLYFISKEDLYKLQLKGGVVLKILAAIERKKKELEFENMSRND
Sbjct:    5 CVTDFEPNVTCNDAQLYDYRKSAYDELEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKKTAGNSVTIILYNVNEKGRVGVLETQCMIAMMTDNEDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRSREVLNFWLEFFENTIHDCEEEVKQTQEENPNNIWSAKRRKSSVTPKVILTSSTRTETTIHDAAVNDEVNQIGDTEDCQNLDRRVMYPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKSEVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLKKNGALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELIKGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKARNQKNDITIPDKFDHRLMSNIERSSTLTKVIKENKQGCFSAPPMDVSNSVPQNI--------------------------RFRSDESISDGNSFYSPDPPSSGGSIAGNNSGLETPSVGAFYMLRKETEARSELHKILKSVRNNVVSYWRELILEDDLKPLTYNQSCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANILFK-------DADPQTPAESHYLKPFCQTNENTKFSDRRPLSRSTGITGADSNPHENDFHVSAMIVDDLTTNDIWQPPFMNFDFKNELVKLQNENNKLLQDLCETTSEYNRHLKHCINEKKNHIDYLRATLGEKLITDSGLSSQVSRLDSDKNLKNWLNEIGVSSSVISVIVNEEYTFHEFLYFISKEDLYKLQLKGGVVLKILAAIERKKKELEFENMSRND 1369          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000004938.1 (SMESG000004938.1)

HSP 1 Score: 2704.09 bits (7008), Expect = 0.000e+0
Identity = 1353/1398 (96.78%), Postives = 1355/1398 (96.92%), Query Frame = 1
Query:   49 CVTDFEPNVTCNDAQLYDYRKSAYDELEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKKTAGNSVTIILYNVNEKGRVGVLETQCMIAMMTDNEDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRSREVLNFWLEFFENTIHDCEEEVKQTQEENPNNIWSAKRRKSSVTPKVILTSSTRTETTIHDAAVNDEVNQIGDTEDCQNLDRRVMYPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKSEVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLKKNGALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELIKGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKARNQKNDITIPDKFDHRLMSNIERSSTLTKVIKENKQGCFSAPPMDVSNSVPQNIRPISNRKRGQLLSIDLLLVIHMKTNKRFRSDESISDGNSFYSPDPPXXXXXXXXXXXXLETPSVGAFYMLRKETEARSELHKILKSVRNNVVSYWRELILEDDLKPLTYNHSCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANILFKAGIFRLFDADPQTPAESHYLKPFCQTNENTKFSDRRPLSRSTGITGADSNPHENDFHVSAMIVDDLTTNDIWQPPFMNFDFKNELVKLQNENNKLLQDLCETTSEYNRHLKHCISEKKNHIDYLRATLGEKLITXXXXXXXXXXXXXXENLKNWLNEIGXXXXXXXXXXNEEYTFHEFLYFISKEDLYKLQLKGGVVLKILAAIERKKKELEFENMSRND 4242
            CVTDFEPNVTCNDAQLYDYRKSAYDELEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKKTAGNSVTIILYNVNEKGRVGVLETQCMIAMMTDNEDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRSREVLNFWLEFFENTIHDCEEEVKQTQEENPNNIWSAKRRKSSVTPKVILTSSTRTETTIHDAAVNDEVNQIGDTEDCQNLDRRVMYPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKSEVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLKKNGALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELIKGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKARNQKNDITIPDKFDHRLMSNIERSSTLTKVIKENKQGCFSAPPMDV                                  RFRSDESISDGNSFYSPDPPSSGGSIAGNNSGLETPSVGAFYMLRKETEARSELHKILKSVRNNVVSYWRELILEDDLKPLTYN SCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANILFK       DADPQTPAESHYLKPFCQTNENTKFSDRRPLSRSTGITGADSNPHENDFHVSAMIVDDLTTNDIWQPPFMNFDFKNELVKLQNENNKLLQDLCETTSEYNRHLKHCI+EKKNHIDYLRATLGEKLITDSGLSSQVS LDSD+NLKNWLNEIGVSSSVISVIVNEEYTFHEFLYFISKEDLYKLQLKGGVVLKILAAIERKKKELEFENMSRND
Sbjct:    5 CVTDFEPNVTCNDAQLYDYRKSAYDELEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKKTAGNSVTIILYNVNEKGRVGVLETQCMIAMMTDNEDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRSREVLNFWLEFFENTIHDCEEEVKQTQEENPNNIWSAKRRKSSVTPKVILTSSTRTETTIHDAAVNDEVNQIGDTEDCQNLDRRVMYPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKSEVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLKKNGALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELIKGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKARNQKNDITIPDKFDHRLMSNIERSSTLTKVIKENKQGCFSAPPMDV----------------------------------RFRSDESISDGNSFYSPDPPSSGGSIAGNNSGLETPSVGAFYMLRKETEARSELHKILKSVRNNVVSYWRELILEDDLKPLTYNQSCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANILFK-------DADPQTPAESHYLKPFCQTNENTKFSDRRPLSRSTGITGADSNPHENDFHVSAMIVDDLTTNDIWQPPFMNFDFKNELVKLQNENNKLLQDLCETTSEYNRHLKHCINEKKNHIDYLRATLGEKLITDSGLSSQVSRLDSDKNLKNWLNEIGVSSSVISVIVNEEYTFHEFLYFISKEDLYKLQLKGGVVLKILAAIERKKKELEFENMSRND 1361          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000004938.1 (SMESG000004938.1)

HSP 1 Score: 2678.28 bits (6941), Expect = 0.000e+0
Identity = 1344/1398 (96.14%), Postives = 1346/1398 (96.28%), Query Frame = 1
Query:   49 CVTDFEPNVTCNDAQLYDYRKSAYDELEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKKTAGNSVTIILYNVNEKGRVGVLETQCMIAMMTDNEDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRSREVLNFWLEFFENTIHDCEEEVKQTQEENPNNIWSAKRRKSSVTPKVILTSSTRTETTIHDAAVNDEVNQIGDTEDCQNLDRRVMYPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKSEVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLKKNGALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELIKGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKARNQKNDITIPDKFDHRLMSNIERSSTLTKVIKENKQGCFSAPPMDVSNSVPQNIRPISNRKRGQLLSIDLLLVIHMKTNKRFRSDESISDGNSFYSPDPPXXXXXXXXXXXXLETPSVGAFYMLRKETEARSELHKILKSVRNNVVSYWRELILEDDLKPLTYNHSCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANILFKAGIFRLFDADPQTPAESHYLKPFCQTNENTKFSDRRPLSRSTGITGADSNPHENDFHVSAMIVDDLTTNDIWQPPFMNFDFKNELVKLQNENNKLLQDLCETTSEYNRHLKHCISEKKNHIDYLRATLGEKLITXXXXXXXXXXXXXXENLKNWLNEIGXXXXXXXXXXNEEYTFHEFLYFISKEDLYKLQLKGGVVLKILAAIERKKKELEFENMSRND 4242
            CVTDFEPNVTCNDAQLYDYRKSAYDELEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKKTAGNSVTIILYNVNEKGRVGVLETQCMIAMMTDNEDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRSREVLNFWLEFFENTIHDCEEEVKQTQEENPNNIWSAKRRKSSVTPKVILTSSTRTETTIHDAAVNDEVNQIGDTEDCQNLDRRVMYPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKSEVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLKKNGALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELIKGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKARNQKNDITIPDKFDHRLMSNIERSSTLTKVIKENKQGCFSAPPMDVSNSVPQNI                          RFRSDESISDGNSFYSPDPPSSGGSIAGNNSGLETPSVGAFYMLRKETEARSELHKILKSVRNNVVSYWRELILEDDLKPLTYN SCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANILFK       DADPQTPAESHYLKPFCQTNENTKFSDRRPLSRST                 AMIVDDLTTNDIWQPPFMNFDFKNELVKLQNENNKLLQDLCETTSEYNRHLKHCI+EKKNHIDYLRATLGEKLITDSGLSSQVS LDSD+NLKNWLNEIGVSSSVISVIVNEEYTFHEFLYFISKEDLYKLQLKGGVVLKILAAIERKKKELEFENMSRND
Sbjct:    5 CVTDFEPNVTCNDAQLYDYRKSAYDELEKVCNRADDVSLVRISFQTLDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILIYHGMDSTKETIESLKKTAGNSVTIILYNVNEKGRVGVLETQCMIAMMTDNEDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTDEELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLSTFTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFPDMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYATLLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVLAEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRSREVLNFWLEFFENTIHDCEEEVKQTQEENPNNIWSAKRRKSSVTPKVILTSSTRTETTIHDAAVNDEVNQIGDTEDCQNLDRRVMYPVLVSDSEGILQPAFLQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALFLYVVSTADDFHLFFPSNSARREFYNVVKSEVLSGKEEMLMMSSDMIESEDIQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQPLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLKKNGALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIMQRASTFTGTMQYMAPELIKGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSHPFLQTARKSLHKKKKARNQKNDITIPDKFDHRLMSNIERSSTLTKVIKENKQGCFSAPPMDVSNSVPQNI--------------------------RFRSDESISDGNSFYSPDPPSSGGSIAGNNSGLETPSVGAFYMLRKETEARSELHKILKSVRNNVVSYWRELILEDDLKPLTYNQSCNLLELIMDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIENELRKHVSKPHLLLAWDKIIGNAVSIAANILFK-------DADPQTPAESHYLKPFCQTNENTKFSDRRPLSRST-----------------AMIVDDLTTNDIWQPPFMNFDFKNELVKLQNENNKLLQDLCETTSEYNRHLKHCINEKKNHIDYLRATLGEKLITDSGLSSQVSRLDSDKNLKNWLNEIGVSSSVISVIVNEEYTFHEFLYFISKEDLYKLQLKGGVVLKILAAIERKKKELEFENMSRND 1352          
The following BLAST results are available for this feature:
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAP3K50.000e+033.76mitogen-activated protein kinase kinase kinase 5 [... [more]
MAP3K152.820e-14635.73mitogen-activated protein kinase kinase kinase 15 ... [more]
MAP3K62.281e-10749.49mitogen-activated protein kinase kinase kinase 6 [... [more]
MAP3K62.884e-10749.49mitogen-activated protein kinase kinase kinase 6 [... [more]
MAP3K157.339e-7146.01mitogen-activated protein kinase kinase kinase 15 ... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nsy-11.105e-10832.03Mitogen-activated protein kinase kinase kinase nsy... [more]
nsy-11.668e-10831.92Mitogen-activated protein kinase kinase kinase nsy... [more]
gck-11.371e-3937.25Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
gck-11.980e-3937.25Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
gck-12.172e-3937.25Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ask12.515e-12136.83gene:FBgn0014006 transcript:FBtr0083819[more]
Ask12.153e-12036.83gene:FBgn0014006 transcript:FBtr0300256[more]
hpo4.267e-3936.96gene:FBgn0261456 transcript:FBtr0331920[more]
hpo4.267e-3936.96gene:FBgn0261456 transcript:FBtr0086500[more]
Pak9.171e-3834.12gene:FBgn0267698 transcript:FBtr0334539[more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-1i11.30.000e+034.11si:ch211-1i11.3 [Source:ZFIN;Acc:ZDB-GENE-030131-8... [more]
si:ch211-1i11.30.000e+033.48si:ch211-1i11.3 [Source:ZFIN;Acc:ZDB-GENE-030131-8... [more]
si:ch211-1i11.30.000e+035.97si:ch211-1i11.3 [Source:ZFIN;Acc:ZDB-GENE-030131-8... [more]
si:ch211-1i11.30.000e+033.96si:ch211-1i11.3 [Source:ZFIN;Acc:ZDB-GENE-030131-8... [more]
map3k53.788e-14435.22mitogen-activated protein kinase kinase kinase 5 [... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
daam10.000e+036.54dishevelled associated activator of morphogenesis ... [more]
daam10.000e+036.07dishevelled associated activator of morphogenesis ... [more]
daam10.000e+036.24dishevelled associated activator of morphogenesis ... [more]
daam10.000e+035.88dishevelled associated activator of morphogenesis ... [more]
daam11.407e-739.91dishevelled associated activator of morphogenesis ... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Map3k50.000e+034.12mitogen-activated protein kinase kinase kinase 5 [... [more]
Map3k50.000e+033.95mitogen-activated protein kinase kinase kinase 5 [... [more]
Map3k156.490e-12350.76mitogen-activated protein kinase kinase kinase 15 ... [more]
Map3k66.375e-11050.00mitogen-activated protein kinase kinase kinase 6 [... [more]
Map3k192.330e-5341.95mitogen-activated protein kinase kinase kinase 19 ... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O35099|M3K5_MOUSE0.000e+033.95Mitogen-activated protein kinase kinase kinase 5 O... [more]
sp|Q99683|M3K5_HUMAN0.000e+033.76Mitogen-activated protein kinase kinase kinase 5 O... [more]
sp|Q6ZN16|M3K15_HUMAN1.354e-14535.73Mitogen-activated protein kinase kinase kinase 15 ... [more]
sp|A2AQW0|M3K15_MOUSE4.408e-12250.76Mitogen-activated protein kinase kinase kinase 15 ... [more]
sp|Q9WTR2|M3K6_MOUSE4.416e-10950.00Mitogen-activated protein kinase kinase kinase 6 O... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0M9AA090.000e+037.71Mitogen-activated protein kinase kinase kinase 15 ... [more]
A0A026WG160.000e+038.85Mitogen-activated protein kinase kinase kinase OS=... [more]
A0A3L8DDH80.000e+038.64Protein kinase domain-containing protein OS=Oocera... [more]
A0A1B6D1S40.000e+038.46Protein kinase domain-containing protein OS=Clasto... [more]
A0A088AF690.000e+041.52Protein kinase domain-containing protein OS=Apis m... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k53.238e-740.83mitogen-activated protein kinase kinase kinase 5 [... [more]
map3k51.896e-1240.41mitogen-activated protein kinase kinase kinase 5 [... [more]
map3k53.017e-740.73mitogen-activated protein kinase kinase kinase 5 [... [more]
si:ch211-1i11.30.000e+032.51mitogen-activated protein kinase kinase kinase 5-l... [more]
map3k151.093e-13535.44mitogen-activated protein kinase kinase kinase 15 ... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k193.542e-5341.42mitogen-activated protein kinase kinase kinase 19 ... [more]
map3k21.408e-5042.80mitogen-activated protein kinase kinase kinase 2 [... [more]
ENSPMAT00000006402.13.448e-4335.71pep scaffold:Pmarinus_7.0:GL481397:10373:21355:-1 ... [more]
plk31.050e-4036.96polo-like kinase 3 (Drosophila) [Source:ZFIN;Acc:Z... [more]
stk25a2.189e-3637.35serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
BCK11.628e-4938.17MAPKKK acting in the protein kinase C signaling pa... [more]
SSK24.985e-4334.90MAP kinase kinase kinase of HOG1 mitogen-activated... [more]
STE111.683e-4240.27Signal transducing MEK kinase; involved in pheromo... [more]
SSK226.206e-4135.46MAP kinase kinase kinase of HOG1 mitogen-activated... [more]
CDC155.758e-3836.59Protein kinase of the Mitotic Exit Network; locali... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO478214.760e-5640.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414103.259e-5541.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361507.521e-4837.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428458.956e-4437.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO490473.189e-4332.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k50.000e+035.34mitogen-activated protein kinase kinase kinase 5 [... [more]
map3k51.928e-13538.71mitogen-activated protein kinase kinase kinase 5 [... [more]
si:ch211-1i11.33.035e-1839.04mitogen-activated protein kinase kinase kinase 5 [... [more]
si:ch211-1i11.32.634e-1839.04mitogen-activated protein kinase kinase kinase 5 [... [more]
map3k154.126e-12350.36mitogen-activated protein kinase kinase kinase 15 ... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000004938.10.000e+097.85SMESG000004938.1[more]
SMESG000004938.10.000e+097.78SMESG000004938.1[more]
SMESG000004938.10.000e+097.35SMESG000004938.1[more]
SMESG000004938.10.000e+096.78SMESG000004938.1[more]
SMESG000004938.10.000e+096.14SMESG000004938.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016722 ID=SMED30016722|Name=Protein kinase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=4549bp
AATCTATATAAATCTTATATGGTAGTTATATAGATTATGAAGATAGTTTG
CGTGACAGACTTTGAACCAAATGTAACTTGTAATGATGCTCAACTTTACG
ACTATCGAAAAAGTGCCTACGACGAATTAGAGAAAGTATGCAATAGGGCT
GATGACGTATCACTTGTTAGAATATCGTTTCAAACTTTGGATTATAGCTC
AACTGAAGTATTAGATACATTTTACAACGCAGATATGGTCATTCTTGACA
TGAGCATTAAAATTCAACAAAGAGCATTGTTGTTTCATCTCGGAGTACGA
GAAAACTTAGGCATGATGGAAAACATAATTCTTATATATCATGGAATGGA
TTCAACGAAAGAAACCATAGAAAGTTTGAAAAAAACTGCTGGAAATAGTG
TCACGATAATTCTTTATAATGTCAATGAAAAAGGTCGAGTTGGAGTTCTA
GAAACTCAATGCATGATAGCCATGATGACGGATAATGAGGATTTAAAATC
ACAAGTATGCTCCAATCTTAAATCACTGGGATCAAAGTTGAGAAATTTGT
TGAAGGAAGTAGAAGTAATAAGAAGAGCTCATTTGAAAGAGAAATTTCTG
AATGATTTGCGACGAGATCGTGAAGAATGTACAGATGAAGAATTAAAACA
GAAAATGAAAAATATGCATCGACGTTTGGATGATCCAGAATTATTATCTA
ACGAAATAATTCTTAATATGATCTTGTCATACAGAAAAATACAAGCATAT
GATGATATTGTATATCTTATCGAAAGTCTGAGTACATTTACAACTGGACA
AAAAATTATTAATACAGTTCACATTCAATATCATTATGCATTTGCTCTTA
ATAGAAGAAATAAACAAGGAAATAGAGAAAAGGCTCTTTCGGTTATTGAA
AAAGCTTGTGAAGATTTTGCGGATTCAGTGTTTCCTGACATGGTTGGTCT
TGTCGGTAGGATATACAAAGACATATTTGTAGCGTCAAAATACACGGATA
AGGATGCGTTAAATAAAGCCACTTCGTGGTATGAAAAGGGTTTTAAGTTA
CAACCAAATGAATATTTAGGAATTAATTACGCAACTCTTCTTGTGATTGG
AGGAAATCAATTAAATGTTTCTGAAGAATTGACTCAAATAATATTATTTC
TTAACAAATCTATCGGAACTAAAGGGGCAATTGCTAGGTTAACAGACTAT
TGGGATGTTGCAACCTTTTTTGAGGTTAGCGTTTTGGCAGAAGATTATCA
CAAAGCTGTCCAAGCTGCAGAATGCATGTTTAAATTGCAACCACCAGTTT
GGGGTCTCAAATCTACTATTGGAAACATAAAGTTGATATCGTTTTTTCGG
AAACCAGAAGATAATACACCAGTTTCACGATCAAGAGAGGTTTTGAATTT
TTGGTTGGAATTTTTTGAAAATACGATTCATGACTGTGAAGAAGAAGTGA
AACAAACTCAAGAGGAAAACCCAAATAATATTTGGAGTGCTAAACGGCGC
AAATCATCTGTAACGCCAAAAGTTATTTTAACATCTTCCACGCGAACTGA
AACAACAATCCATGACGCCGCTGTTAATGATGAAGTAAATCAAATTGGAG
ATACTGAAGATTGTCAGAATTTAGATCGACGTGTAATGTATCCCGTTCTT
GTATCAGATTCAGAAGGAATTCTCCAGCCGGCTTTTCTCCAAGTCAACAT
AAACAGTGATATAAAATCCATCCGATTGTGGTATCATCATCCCTCAGAAC
GTCTCAGAAATGTCTCTGATTGGACATTCACAGAGGATCTTATTAAGGGA
ATTAGTCTTTCCAAAACATCTCAAACTGCTTTATTTCTCTACGTTGTCAG
TACAGCTGATGATTTTCATTTGTTTTTCCCGTCCAACTCTGCACGAAGAG
AATTTTACAATGTTGTCAAGTCTGAAGTGCTATCAGGAAAAGAAGAGATG
TTAATGATGTCTTCTGACATGATTGAATCAGAGGATATACAATTTGAATA
TGAATATGATGATAATGATCAGAGAATAGTGTTGGGTCGTGGAACGTTTG
GAACAGTATTTGCTGGTCGTGAGTTAACAAAACAAATAAAAATCGCAATA
AAAGAAGTTAATGAAAGTCAAATAAAAGAAGTTCAACCACTTCATGAGGA
AATTTGGCTTCATTCTCGGCTTTCTCACAGAAATATTGTAAGTTACCTTG
GCTCAAGAAGTGAAAAGGGAGTCTTTAAGATAATAATGGAACAAGTTCCT
GGCGGTAGTTTAACATCTTTGTTAAAAAAGAATGGCGCTTTAACAGAAGA
AACTACTTCTTATTATTCAAATCAGATTCTGGAAGGTTTGAAATATTTGC
ATGACAATCGTATTATGCACCGAGACATCAAAGGTGACAATGTCCTAGTC
AATATGTATAATGGAATTTTAAAAATCAGCGATTTTGGAACTTCTAAAAG
ACTCGGCGACATAATGCAAAGAGCGAGTACATTTACAGGAACAATGCAAT
ATATGGCACCTGAACTGATAAAGGGTCCCAGTGGTTATGGATTTCCGGCC
GATGTTTGGAGTTTCGGTTGCACAGTTATTGAAATGCTAACTGGCAAACC
ACCGTTTAATGATCTCGGTACACCTATTGCCGCTCTTTTTAAAGTTGGAG
AATTTTCACAACATCCTGACTTTCCAGATCATCTATCTCATGAAGCTATA
GATTTCCTGGAAAAATGTTTCATACCCGATCCAAATAAAAGAGCAACTGT
AACATCATTATTATCTCATCCGTTTCTTCAAACAGCTCGAAAATCTCTCC
ACAAAAAGAAAAAAGCTAGAAATCAGAAAAACGATATAACAATTCCAGAC
AAGTTCGATCATCGTCTCATGAGCAATATTGAAAGGAGTTCAACACTTAC
GAAAGTCATCAAAGAAAATAAACAAGGATGCTTTTCTGCACCCCCAATGG
ATGTTAGCAATAGTGTGCCTCAAAACATAAGACCAATATCTAATCGAAAG
AGAGGTCAATTGCTTTCAATTGATTTATTGTTGGTAATTCACATGAAGAC
CAATAAGCGATTTCGATCCGATGAATCGATTTCCGATGGAAATAGTTTCT
ACAGTCCTGATCCCCCGTCTTCTGGTGGATCAATTGCTGGCAACAATAGT
GGCCTAGAAACTCCGAGTGTTGGTGCGTTTTATATGCTTCGAAAAGAAAC
TGAAGCCAGGTCGGAGTTACATAAAATTTTGAAAAGTGTACGAAACAACG
TTGTCAGTTATTGGCGGGAACTGATTTTGGAAGATGACCTCAAACCGTTG
ACATATAATCATAGCTGTAATTTATTGGAATTAATTATGGATTTGTTTTT
AAATTACCTATTGGATTTTGATAAAGAGAAATTGAAATATGATTTAATTC
AACTTCGCAGTTGTCCTGATTATCCTCGTATGGACACGTCAAAAGAACAA
TTGATCATCTATTCGCTTAAGGTCGCCATTGAGAATGAGCTGCGTAAACA
CGTAAGTAAACCCCATTTACTGTTGGCATGGGACAAAATCATTGGCAATG
CGGTTTCAATTGCAGCGAATATTTTATTCAAAGCAGGTATATTTCGATTG
TTTGATGCTGATCCTCAAACCCCTGCAGAGTCCCATTATCTGAAACCTTT
TTGTCAAACAAATGAAAACACTAAATTTTCTGACCGTAGACCATTAAGCC
GTAGCACTGGTATTACTGGCGCAGATTCAAATCCTCATGAAAATGACTTT
CATGTTTCAGCTATGATAGTGGATGATTTAACAACAAATGACATTTGGCA
GCCTCCTTTTATGAATTTTGACTTCAAAAATGAGCTTGTCAAATTACAAA
ACGAAAATAACAAATTGCTGCAAGACCTGTGTGAAACGACCTCAGAATAC
AATAGGCACCTCAAGCACTGCATTAGTGAAAAGAAAAACCATATCGATTA
TTTGAGAGCAACACTAGGAGAAAAATTGATCACTGATTCCGGACTGTCTT
CACAAGTTAGCAGTTTGGATTCAGACGAAAACTTGAAGAATTGGCTCAAT
GAAATCGGTGTTTCTTCATCAGTCATCTCTGTGATTGTCAATGAAGAATA
TACGTTTCACGAATTTCTGTATTTCATATCTAAAGAAGATTTGTATAAAC
TGCAGCTAAAAGGTGGTGTTGTTCTAAAAATATTGGCAGCTATAGAGAGA
AAGAAAAAAGAATTAGAATTTGAAAATATGAGCCGAAATGATTGATTTTA
CGAGAATTAAAACTCTTGGGAACTAGGAAAAGTTTGAACATTAAAAATCA
TCAACCAATCTTCATTTGTAGATATGATTTTTTATAGCTTATTCCTGGAA
ATGAAACACTGAATGAGGGCGCCCCCAATAGTTCATCCATTGCAATACTC
TGTAAATATAATTAAATATAATTACAATTAGTTTTTTCGGAATTTTCATA
TAATTTGATTGTTATTCAGTTTATAGAACAAGACAACAAATGATTTTTTG
ATATACAAAATGTTATTTTTTGTTAATGAAATTATTAGTTTAAAAAAAA
back to top

protein sequence of SMED30016722-orf-1

>SMED30016722-orf-1 ID=SMED30016722-orf-1|Name=SMED30016722-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1403bp
MKIVCVTDFEPNVTCNDAQLYDYRKSAYDELEKVCNRADDVSLVRISFQT
LDYSSTEVLDTFYNADMVILDMSIKIQQRALLFHLGVRENLGMMENIILI
YHGMDSTKETIESLKKTAGNSVTIILYNVNEKGRVGVLETQCMIAMMTDN
EDLKSQVCSNLKSLGSKLRNLLKEVEVIRRAHLKEKFLNDLRRDREECTD
EELKQKMKNMHRRLDDPELLSNEIILNMILSYRKIQAYDDIVYLIESLST
FTTGQKIINTVHIQYHYAFALNRRNKQGNREKALSVIEKACEDFADSVFP
DMVGLVGRIYKDIFVASKYTDKDALNKATSWYEKGFKLQPNEYLGINYAT
LLVIGGNQLNVSEELTQIILFLNKSIGTKGAIARLTDYWDVATFFEVSVL
AEDYHKAVQAAECMFKLQPPVWGLKSTIGNIKLISFFRKPEDNTPVSRSR
EVLNFWLEFFENTIHDCEEEVKQTQEENPNNIWSAKRRKSSVTPKVILTS
STRTETTIHDAAVNDEVNQIGDTEDCQNLDRRVMYPVLVSDSEGILQPAF
LQVNINSDIKSIRLWYHHPSERLRNVSDWTFTEDLIKGISLSKTSQTALF
LYVVSTADDFHLFFPSNSARREFYNVVKSEVLSGKEEMLMMSSDMIESED
IQFEYEYDDNDQRIVLGRGTFGTVFAGRELTKQIKIAIKEVNESQIKEVQ
PLHEEIWLHSRLSHRNIVSYLGSRSEKGVFKIIMEQVPGGSLTSLLKKNG
ALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDF
GTSKRLGDIMQRASTFTGTMQYMAPELIKGPSGYGFPADVWSFGCTVIEM
LTGKPPFNDLGTPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPN
KRATVTSLLSHPFLQTARKSLHKKKKARNQKNDITIPDKFDHRLMSNIER
SSTLTKVIKENKQGCFSAPPMDVSNSVPQNIRPISNRKRGQLLSIDLLLV
IHMKTNKRFRSDESISDGNSFYSPDPPSSGGSIAGNNSGLETPSVGAFYM
LRKETEARSELHKILKSVRNNVVSYWRELILEDDLKPLTYNHSCNLLELI
MDLFLNYLLDFDKEKLKYDLIQLRSCPDYPRMDTSKEQLIIYSLKVAIEN
ELRKHVSKPHLLLAWDKIIGNAVSIAANILFKAGIFRLFDADPQTPAESH
YLKPFCQTNENTKFSDRRPLSRSTGITGADSNPHENDFHVSAMIVDDLTT
NDIWQPPFMNFDFKNELVKLQNENNKLLQDLCETTSEYNRHLKHCISEKK
NHIDYLRATLGEKLITDSGLSSQVSSLDSDENLKNWLNEIGVSSSVISVI
VNEEYTFHEFLYFISKEDLYKLQLKGGVVLKILAAIERKKKELEFENMSR
ND*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR025136DUF4071
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
IPR013761SAM/pointed_sf
IPR011009Kinase-like_dom_sf
IPR003114Phox_assoc
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1260..1280
NoneNo IPR availableCOILSCoilCoilcoord: 457..477
NoneNo IPR availableCOILSCoilCoilcoord: 161..181
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 738..939
e-value: 9.3E-59
score: 200.2
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 639..737
e-value: 6.7E-31
score: 108.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1213..1231
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1213..1232
NoneNo IPR availablePANTHERPTHR11584SERINE/THREONINE PROTEIN KINASEcoord: 15..1391
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 660..914
e-value: 2.3E-86
score: 302.9
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 665..914
e-value: 2.3E-67
score: 227.1
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 660..914
score: 49.234
IPR025136Domain of unknown function DUF4071PFAMPF13281DUF4071coord: 81..459
e-value: 1.5E-133
score: 445.4
IPR013761Sterile alpha motif/pointed domain superfamilyGENE3DG3DSA:1.10.150.50coord: 1326..1400
e-value: 6.0E-6
score: 27.9
IPR013761Sterile alpha motif/pointed domain superfamilySUPERFAMILYSSF47769SAM/Pointed domaincoord: 1330..1390
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 666..689
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 776..788
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 665..938