Innexin

Overview
NameInnexin
Smed IDSMED30016693
Length (bp)1705
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Innexin (SMED30016693) t-SNE clustered cells

Violin plots show distribution of expression levels for Innexin (SMED30016693) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Innexin (SMED30016693) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Innexin (SMED30016693) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016693

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30016693SMESG000059204.1 AY067877smed_ncbi_20200123PMID:17670787
Oviedo et al., 2007
whole organism asexual adult colorimetric in situ hybridization evidence
nervous systemSMED30016693SMESG000059204.1 dd_Smed_v4_3985_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30016693SMESG000059204.1 dd_Smed_v4_3985_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30016693SMESG000059204.1 dd_Smed_v4_3985_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30016693SMESG000059204.1 dd_Smed_v4_3985_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30016693SMESG000059204.1 dd_Smed_v4_3985_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30016693SMESG000059204.1 dd_Smed_v4_3985_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30016693SMESG000059204.1 dd_Smed_v4_3985_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30016693SMESG000059204.1 dd_Smed_v4_3985_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30016693SMESG000059204.1 dd_Smed_v4_3985_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016693SMESG000059204.1 Contig30503newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016693SMESG000059204.1 Contig30503uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016693SMESG000059204.1 Contig35057newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016693SMESG000059204.1 Contig35057uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 236.884 bits (603), Expect = 6.834e-72
Identity = 158/424 (37.26%), Postives = 230/424 (54.25%), Query Frame = 2
Query:  242 HLRYDDDFIDRLNYQVTXXXXXXXXXXXXXRQYVGKPIQCWSPQEFTRGWEEYAENYCWVSNTYYSSVTVRLPPK-TDRRVLMIGYYQWAWIFLGVQALLFYLPCIIWRGLYN-QSRFNIRRIIQMSASATDIIMPLXXXXXXXXXXXXIKFIAKYLDSCIRRRHLGRCKPEKKLNNNIKPGHQVSSPWCCSHKSGNCXXXXXXXXXXXXXXNAISQVYLMEAFIGTKNILYGVIVLIDLLKGRHWNESGHFPRVTFCDFQAKKLGKNHIYTLQCVLPINMILEKXXXXXXXXXXXXXXXNIFSFINWTGRLLQSRFRVQFIRKHLHIMGALVSSDRPMSRHFVEHYLGADVVFIIRLISTNSCEFVASQLANELWMIYRHRRHAELEDMKFGHGSLSPSQKSKLSGVCFGNSNRCVPLTSGAN 1507
            H R DDDF+D+LNY  T  ++F F  I+  +QYVG PIQCW P +FT  WE+Y ENYCWV NTYY  +T   P +  DRR   I YYQW    L ++AL FY+PCI+WRGL +  S  N++ + QM+                          A+ +D+  R   +       +    I+      S  C   +  N +++LY+FIK+LY+ N + QV+++ +F+GT N+ YG  +L DLL GR W  SG+FPRVT CDF+ + LG  H +T+QCVL INM  EKIF+ LWFW  ++A ++  S  +W          ++FIRK+L      +++DR   + FV  +LG D VF +R+IS ++ + +A++L   LW  +  R      +M  G  + SPS+             R  P   G+N
Sbjct:   14 HPRVDDDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDAWEQYTENYCWVENTYYLPLTSAFPLEYGDRRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACD------------------------ARMMDADARAATVQTIAGHMEDALEIQREVTDVSGMCVQKRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVHHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLR--ATDLATDRQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWHNFNDRVRKSPIEMFEGGVTQSPSKLDANFKTWLLGQTRGKPPFDGSN 411          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 231.876 bits (590), Expect = 1.519e-70
Identity = 149/382 (39.01%), Postives = 217/382 (56.81%), Query Frame = 2
Query:  242 HLRYDDDFIDRLNYQVTXXXXXXXXXXXXXRQYVGKPIQCWSPQEFTRGWEEYAENYCWVSNTYYSSVTVRLPPK-TDRRVLMIGYYQWAWIFLGVQALLFYLPCIIWRGLYN-QSRFNIRRIIQMSASATDIIMPLXXXXXXXXXXXXIKFIAKYLDSCIRRRHLGRCKPEKKLNNNIKPGHQVSSPWCCSHKSGNCXXXXXXXXXXXXXXNAISQVYLMEAFIGTKNILYGVIVLIDLLKGRHWNESGHFPRVTFCDFQAKKLGKNHIYTLQCVLPINMILEKXXXXXXXXXXXXXXXNIFSFINWTGRLLQSRFRVQFIRKHLHIMGALVSSDRPMSRHFVEHYLGADVVFIIRLISTNSCEFVASQLANELWMIYRHR 1381
            H R DDDF+D+LNY  T  ++F F  I+  +QYVG PIQCW P +FT  WE+Y ENYCWV NTYY  +T   P +  DRR   I YYQW    L ++AL FY+PCI+WRGL +  S  N++ + QM+                          A+ +D+  R   +       +    I+      S  C   +  N +++LY+FIK+LY+ N + QV+++ +F+GT N+ YG  +L DLL GR W  SG+FPRVT CDF+ + LG  H +T+QCVL INM  EKIF+ LWFW  ++A ++  S  +W          ++FIRK+L      +++DR   + FV  +LG D VF +R+IS ++ + +A++L   LW  +  R
Sbjct:   14 HPRVDDDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDAWEQYTENYCWVENTYYLPLTSAFPLEYGDRRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACD------------------------ARMMDADARAATVQTIAGHMEDALEIQREVTDVSGMCVQKRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVHHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLR--ATDLATDRQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWHNFNDR 369          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 231.876 bits (590), Expect = 1.519e-70
Identity = 149/382 (39.01%), Postives = 217/382 (56.81%), Query Frame = 2
Query:  242 HLRYDDDFIDRLNYQVTXXXXXXXXXXXXXRQYVGKPIQCWSPQEFTRGWEEYAENYCWVSNTYYSSVTVRLPPK-TDRRVLMIGYYQWAWIFLGVQALLFYLPCIIWRGLYN-QSRFNIRRIIQMSASATDIIMPLXXXXXXXXXXXXIKFIAKYLDSCIRRRHLGRCKPEKKLNNNIKPGHQVSSPWCCSHKSGNCXXXXXXXXXXXXXXNAISQVYLMEAFIGTKNILYGVIVLIDLLKGRHWNESGHFPRVTFCDFQAKKLGKNHIYTLQCVLPINMILEKXXXXXXXXXXXXXXXNIFSFINWTGRLLQSRFRVQFIRKHLHIMGALVSSDRPMSRHFVEHYLGADVVFIIRLISTNSCEFVASQLANELWMIYRHR 1381
            H R DDDF+D+LNY  T  ++F F  I+  +QYVG PIQCW P +FT  WE+Y ENYCWV NTYY  +T   P +  DRR   I YYQW    L ++AL FY+PCI+WRGL +  S  N++ + QM+                          A+ +D+  R   +       +    I+      S  C   +  N +++LY+FIK+LY+ N + QV+++ +F+GT N+ YG  +L DLL GR W  SG+FPRVT CDF+ + LG  H +T+QCVL INM  EKIF+ LWFW  ++A ++  S  +W          ++FIRK+L      +++DR   + FV  +LG D VF +R+IS ++ + +A++L   LW  +  R
Sbjct:   14 HPRVDDDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDAWEQYTENYCWVENTYYLPLTSAFPLEYGDRRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACD------------------------ARMMDADARAATVQTIAGHMEDALEIQREVTDVSGMCVQKRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVHHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLR--ATDLATDRQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWHNFNDR 369          
BLAST of Innexin vs. Ensembl Celegans
Match: unc-9 (Innexin unc-9 [Source:UniProtKB/Swiss-Prot;Acc:O01393])

HSP 1 Score: 219.935 bits (559), Expect = 5.623e-66
Identity = 146/391 (37.34%), Postives = 218/391 (55.75%), Query Frame = 2
Query:  236 SSHLRYDDDFIDRLNYQVTXXXXXXXXXXXXXRQYVGKPIQCWSPQEFTRGWEEYAENYCWVSNTYYSSVTVRLPPK-TDRRVLMIGYYQWAWIFLGVQALLFYLPCIIWRGLYNQSRFNIRRIIQMSASATDIIMPLXXXXXXXXXXXXIKFIAKYLDSCIRRRHLGRCKPEKKLNNNIKPGHQVSSPWCCSHKSGNCXXXXXXXXXXXXXXNAISQVYLMEAFIGTKNILYGVIVLIDLLKGRHWNESGHFPRVTFCDFQAKKLGKNHIYTLQCVLPINMILEKXXXXXXXXXXXXXXXNIFSFINWTGRLLQSRFRVQFIRKHLHIMGALVSSDRPMSRHFVEHYLGADVVFIIRLISTNSCEFVASQLANELWMIYRHRRHAELEDM 1405
            S     DDD ID+LNY  T  ++ +F  ++  +QYVG PIQCW P  FT   E+Y ENYCWV NTY+  +   +P    +R    IGYYQW    L ++ALLFY+P I+WR L  QS  +++ ++QM+  +  + +         S N +++ IA  ++  +  +H        KL N I           C+  SG  ++ LY+ +K+LY +N + Q++L+  F+G ++  YG+ VL DL+ GR W ESGHFPRVT CDF+ K LG  H +T+QCVL INM  EKIF+ LWFW  LLA   + S   W    +    ++ F+ K+L  +      D    R FV H+L  D VF++R+++T++ E    +LA  LW  Y   +  ++ D+
Sbjct:   14 SIQFHVDDDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFTEPMEQYTENYCWVQNTYFLPLHDYIPHNYAERENRQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQSGIHVQSLVQMACDSRLLDLE--------SRNRALQTIATNVEEALHVKHQVMSGNRLKLLNLI----------ICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLGNRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDFEVKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNYCDNKEGKMHDV 386          
BLAST of Innexin vs. Ensembl Celegans
Match: unc-7 (Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q03412])

HSP 1 Score: 213.001 bits (541), Expect = 3.754e-63
Identity = 140/401 (34.91%), Postives = 224/401 (55.86%), Query Frame = 2
Query:  248 RYDDDFIDRLNYQVTXXXXXXXXXXXXXRQYVGKPIQCWSPQEFTRGWEEYAENYCWVSNTYYSSVTVRLPPKT-DRRVLMIGYYQWAWIFLGVQALLFYLPCIIWRG-LYNQSRFNIRRIIQMSASATDIIMPLXXXXXXXXXXXXIKFIAKYLDSCIRRRHLGRCKPEKKLNNNIKPGHQVSSPWCCSHKSGNCXXXXXXXXXXXXXXNAISQVYLMEAFIGTKNILYGVIVLIDLLKGRHWNESGHFPRVTFCDFQAKKLGKNHIYTLQCVLPINMILEKXXXXXXXXXXXXXXXNIFSFINWTGRLLQSRFRVQFIRKHLHIM---GALVSSDRPMSRHFVEHYLGADVVFIIRLISTNSCEFVASQLANELWMIYRH--RRHAELEDMKFGHGSLS 1429
            R DDDF+D+LNY  T  +L  F  ++  +QYVG PIQCW P  FT   E+Y ENYCWV NTY+  +   +P +   RR   IGYYQW    L ++ALLFY+PCI+WRG LY  S  N++ ++QM+  A            +     ++  +A+++   ++  ++ R    +   +N++ G        C    G  +++LY+ IK+LY  N + Q +L+   +G+ ++ YG  +L DL+    W ++G FPRVT CDF+ + LG  H +T+QCVL INM  EKIF+ LWFW +   I+ + + + W   +      + F+RK+L ++    A   +D    R F  ++L  D VF++R+IST++ E ++S+L   LW  + +  R   +  D + G G++ 
Sbjct:   16 RLDDDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDAMEQYTENYCWVQNTYWVPMQEDIPREIYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDA--------RLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGHSRSCFSNLQLGAN------CGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSNDLAYGFSLLKDLMHAIEWEQTGMFPRVTLCDFEVRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALWQDFNNVDRSPTQFWDAEHGQGTID 402          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0301860)

HSP 1 Score: 51.9878 bits (123), Expect = 9.712e-7
Identity = 39/118 (33.05%), Postives = 58/118 (49.15%), Query Frame = 2
Query:  257 DDFIDRLNYQVTXXXXXXXXXXXXXRQYVGKPIQCWSPQEFTRGWEEYAENYCWVSNTYYSSVTVRLPPKTDRRVLMIG---------------YYQWAWIFLGVQALLFYLPCIIWR 565
            D+ + R++Y+ T I+L  F  ++  RQY+G PI C    E   G     + YCW+ +T+  +V  RL   T R V+  G               YYQW    L  QA+LFY+P  +W+
Sbjct:   20 DNNVFRMHYKATVIILIAFSLLVTSRQYIGDPIDCIV-DEIPLG---VMDTYCWIYSTF--TVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK 131          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0071005)

HSP 1 Score: 51.9878 bits (123), Expect = 9.712e-7
Identity = 39/118 (33.05%), Postives = 58/118 (49.15%), Query Frame = 2
Query:  257 DDFIDRLNYQVTXXXXXXXXXXXXXRQYVGKPIQCWSPQEFTRGWEEYAENYCWVSNTYYSSVTVRLPPKTDRRVLMIG---------------YYQWAWIFLGVQALLFYLPCIIWR 565
            D+ + R++Y+ T I+L  F  ++  RQY+G PI C    E   G     + YCW+ +T+  +V  RL   T R V+  G               YYQW    L  QA+LFY+P  +W+
Sbjct:   20 DNNVFRMHYKATVIILIAFSLLVTSRQYIGDPIDCIV-DEIPLG---VMDTYCWIYSTF--TVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK 131          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0332314)

HSP 1 Score: 51.9878 bits (123), Expect = 9.712e-7
Identity = 39/118 (33.05%), Postives = 58/118 (49.15%), Query Frame = 2
Query:  257 DDFIDRLNYQVTXXXXXXXXXXXXXRQYVGKPIQCWSPQEFTRGWEEYAENYCWVSNTYYSSVTVRLPPKTDRRVLMIG---------------YYQWAWIFLGVQALLFYLPCIIWR 565
            D+ + R++Y+ T I+L  F  ++  RQY+G PI C    E   G     + YCW+ +T+  +V  RL   T R V+  G               YYQW    L  QA+LFY+P  +W+
Sbjct:   20 DNNVFRMHYKATVIILIAFSLLVTSRQYIGDPIDCIV-DEIPLG---VMDTYCWIYSTF--TVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK 131          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0071006)

HSP 1 Score: 51.9878 bits (123), Expect = 9.712e-7
Identity = 39/118 (33.05%), Postives = 58/118 (49.15%), Query Frame = 2
Query:  257 DDFIDRLNYQVTXXXXXXXXXXXXXRQYVGKPIQCWSPQEFTRGWEEYAENYCWVSNTYYSSVTVRLPPKTDRRVLMIG---------------YYQWAWIFLGVQALLFYLPCIIWR 565
            D+ + R++Y+ T I+L  F  ++  RQY+G PI C    E   G     + YCW+ +T+  +V  RL   T R V+  G               YYQW    L  QA+LFY+P  +W+
Sbjct:   20 DNNVFRMHYKATVIILIAFSLLVTSRQYIGDPIDCIV-DEIPLG---VMDTYCWIYSTF--TVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK 131          
BLAST of Innexin vs. Ensembl Fly
Match: zpg (gene:FBgn0024177 transcript:FBtr0076983)

HSP 1 Score: 50.8322 bits (120), Expect = 1.948e-6
Identity = 36/133 (27.07%), Postives = 60/133 (45.11%), Query Frame = 2
Query:  212 LAKLGRLGSSHLRYDDDFIDRLNYQVTXXXXXXXXXXXXXRQYVGKPIQCWSPQEFTRGWEEYAENYCWVSNTYYSSVTVRLP---------PKTDRRVL------MIGYYQWAWIFLGVQALLFYLPCIIWR 565
            L+K  +  S H+    D I  L+ +VT  LL     ++  +QY G PIQC+  ++      +Y   +CW+   Y S      P         P    +V+       I YYQW  + L +++ +FY+P  +W+
Sbjct:    8 LSKYLQFKSVHIY---DAIFTLHSKVTVALLLACTFLLSSKQYFGDPIQCFGDKDM-----DYVHAFCWIYGAYVSDNVTVTPLRNGAAQCRPDAVSKVVPPENRNYITYYQWVVLVLLLESFVFYMPAFLWK 132          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|O01393|UNC9_CAEEL (Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN=unc-9 PE=1 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 7.153e-65
Identity = 146/391 (37.34%), Postives = 218/391 (55.75%), Query Frame = 2
Query:  236 SSHLRYDDDFIDRLNYQVTXXXXXXXXXXXXXRQYVGKPIQCWSPQEFTRGWEEYAENYCWVSNTYYSSVTVRLPPK-TDRRVLMIGYYQWAWIFLGVQALLFYLPCIIWRGLYNQSRFNIRRIIQMSASATDIIMPLXXXXXXXXXXXXIKFIAKYLDSCIRRRHLGRCKPEKKLNNNIKPGHQVSSPWCCSHKSGNCXXXXXXXXXXXXXXNAISQVYLMEAFIGTKNILYGVIVLIDLLKGRHWNESGHFPRVTFCDFQAKKLGKNHIYTLQCVLPINMILEKXXXXXXXXXXXXXXXNIFSFINWTGRLLQSRFRVQFIRKHLHIMGALVSSDRPMSRHFVEHYLGADVVFIIRLISTNSCEFVASQLANELWMIYRHRRHAELEDM 1405
            S     DDD ID+LNY  T  ++ +F  ++  +QYVG PIQCW P  FT   E+Y ENYCWV NTY+  +   +P    +R    IGYYQW    L ++ALLFY+P I+WR L  QS  +++ ++QM+  +  + +         S N +++ IA  ++  +  +H        KL N I           C+  SG  ++ LY+ +K+LY +N + Q++L+  F+G ++  YG+ VL DL+ GR W ESGHFPRVT CDF+ K LG  H +T+QCVL INM  EKIF+ LWFW  LLA   + S   W    +    ++ F+ K+L  +      D    R FV H+L  D VF++R+++T++ E    +LA  LW  Y   +  ++ D+
Sbjct:   14 SIQFHVDDDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFTEPMEQYTENYCWVQNTYFLPLHDYIPHNYAERENRQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQSGIHVQSLVQMACDSRLLDLE--------SRNRALQTIATNVEEALHVKHQVMSGNRLKLLNLI----------ICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLGNRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDFEVKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNYCDNKEGKMHDV 386          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q03412|UNC7_CAEEL (Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN=unc-7 PE=1 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 1.429e-60
Identity = 140/401 (34.91%), Postives = 224/401 (55.86%), Query Frame = 2
Query:  248 RYDDDFIDRLNYQVTXXXXXXXXXXXXXRQYVGKPIQCWSPQEFTRGWEEYAENYCWVSNTYYSSVTVRLPPKT-DRRVLMIGYYQWAWIFLGVQALLFYLPCIIWRG-LYNQSRFNIRRIIQMSASATDIIMPLXXXXXXXXXXXXIKFIAKYLDSCIRRRHLGRCKPEKKLNNNIKPGHQVSSPWCCSHKSGNCXXXXXXXXXXXXXXNAISQVYLMEAFIGTKNILYGVIVLIDLLKGRHWNESGHFPRVTFCDFQAKKLGKNHIYTLQCVLPINMILEKXXXXXXXXXXXXXXXNIFSFINWTGRLLQSRFRVQFIRKHLHIM---GALVSSDRPMSRHFVEHYLGADVVFIIRLISTNSCEFVASQLANELWMIYRH--RRHAELEDMKFGHGSLS 1429
            R DDDF+D+LNY  T  +L  F  ++  +QYVG PIQCW P  FT   E+Y ENYCWV NTY+  +   +P +   RR   IGYYQW    L ++ALLFY+PCI+WRG LY  S  N++ ++QM+  A            +     ++  +A+++   ++  ++ R    +   +N++ G        C    G  +++LY+ IK+LY  N + Q +L+   +G+ ++ YG  +L DL+    W ++G FPRVT CDF+ + LG  H +T+QCVL INM  EKIF+ LWFW +   I+ + + + W   +      + F+RK+L ++    A   +D    R F  ++L  D VF++R+IST++ E ++S+L   LW  + +  R   +  D + G G++ 
Sbjct:  136 RLDDDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDAMEQYTENYCWVQNTYWVPMQEDIPREIYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDA--------RLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGHSRSCFSNLQLGAN------CGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSNDLAYGFSLLKDLMHAIEWEQTGMFPRVTLCDFEVRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALWQDFNNVDRSPTQFWDAEHGQGTID 522          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|A8WVX4|INX19_CAEBR (Innexin-19 OS=Caenorhabditis briggsae OX=6238 GN=inx-19 PE=3 SV=3)

HSP 1 Score: 176.407 bits (446), Expect = 6.349e-48
Identity = 143/446 (32.06%), Postives = 212/446 (47.53%), Query Frame = 2
Query:  215 AKLGR--LGSSHLRYDDDFIDRLNYQVTXXXXXXXXXXXXXRQYVGKPIQCWSPQEFTRGWEEYAENYCWVSNTYYSSVTVRLPPK-TDRRVLMIGYYQWAWIFLGVQALLFYLPCIIWRGLYNQSRFNIRRIIQMSASATDIIMPLXXXXXXXXXXXXIKFIAKYLDSCIRRRHLG--RCKPEKKLNNNIKPGHQVSSPWCCSHK-----SGNCXXXXXXXXXXXXXXNAISQVYLMEAFIGTKN-ILYGVIVLIDLLKGRHWNESGHFPRVTFCDFQAKKLGKNHIYTLQCVLPINMILEKXXXXXXXXXXXXXXXNIFSFINWTGRLLQSRFRVQFIRKHLHIMGAL-------VSSDRPMSR-------------HFVEHYLGADVVFIIRLISTNSCEFVASQLANELWMIYRHRRHAELEDMKFGHGSLSPSQKSKLSGV 1459
            A L R  + +  +R DDD +DRLNY  T ++L +   +I  +QY G PI+CW         EEY E+YCW+ NTY+  +   +P   T R    IGYYQW    L  +AL+F LPCI WR    QS  NI+ +I  +  A  +                       LD   R++ +    C     L+     G   +  W    K     SG C+SI+Y F KLLY +N ++Q +++ A + +   + +G  VL D+  GR W E+GHFPRVT CDF+ + L   + YT+QC L IN+I EK+F  LW W ++LAII   SFI W         +V ++ K + I  +           D  + R              FV  +L +D + ++R+IS ++ + +  QL   LW  YR R   E E+    H  +   +  ++ G 
Sbjct:    5 ATLARSFISALSVRGDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWVNPHSRESMEEYIESYCWIQNTYWIPMYENVPDDHTAREEKQIGYYQWVPFILIAEALMFSLPCIFWRLCSFQSGLNIQTLINAACDAQAL-----------------------LDYSDRQKAVEAITCNFVDNLDLQSPNGRIRARGWIARIKFSRFLSGQCISIVYSFTKLLYSVNVVAQFFILNACLKSSEFVFFGFQVLSDIWAGRPWTETGHFPRVTLCDFEVRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEYKKLQKFEKDATVERLYTVIAFAPHLLDSFVSDFLKSDGILMLRMISNHAGDMIVVQLVRNLWQEYRERNWREFEE----HEEMKDVEMRRIQGT 423          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q19746|INX3_CAEEL (Innexin-3 OS=Caenorhabditis elegans OX=6239 GN=inx-3 PE=1 SV=2)

HSP 1 Score: 173.711 bits (439), Expect = 3.376e-47
Identity = 136/398 (34.17%), Postives = 194/398 (48.74%), Query Frame = 2
Query:  257 DDFIDRLNYQVTXXXXXXXXXXXXXRQYVGKPIQCWSPQEFTRGWEEYAENYCWVSNTYYSSVTVRLPPKT-DRRVLMIGYYQWAWIFLGVQALLFYLPCIIWRGLYNQSRFNIRRIIQMSASATDIIMPLXXXXXXXXXXXXIKFIAKYLDSCIRRRHLGRCKPEKKLNNNIKPGHQVSSPWCCSHKSGNCXXXXXXXXXXXXXXNAISQVYLMEAFIGTKNILYGVIVLIDLLKGRHWNESGHFPRVTFCDFQAKKLGKNHIYTLQCVLPINMILEKXXXXXXXXXXXXXXXNIFSFINWTGRLLQSRFRVQFIRKHLHIMGALVSSDRPMSRHFVEHYLGADVVFIIRLISTNSCEFVASQLANELWMIYRHRRHAE----LEDMKFGHGSLSPS 1435
            DD +DRL+Y  T  LL  F  ++  +QYVG  IQCW P EF  GWE+YAE+YC++ NT++      +P    DR+   IGYYQW  I L +QA +FYLP  IW  LY Q   +   +I    S  + +     ++     N  + FI   LD+        R K E       + G  +          G+  S+LY+ IKL+Y+ N   Q  ++  F+G +  L+G     DL  GR W +SG FPRVT CDF  +KL   H YT+QCVL INM  EKI++ +WFW V + I    + +    RL     R  +IR  L         ++ M   F  + L  D V ++R I  ++   V  ++  EL+     ++H E      D   GH + S S
Sbjct:   21 DDAVDRLSYVTTATLLAFFSIMVSCKQYVGSAIQCWMPMEFKGGWEQYAEDYCFIQNTFFIPERSEIPGDVEDRQKAEIGYYQWVPIVLAIQAFMFYLPSWIWSSLYKQCGLDFPSVI----SEAEALRSQDSETRTKGVNKLVDFIGDILDT--------RSKNEYGRFYCYRFGKGL----------GSMTSMLYICIKLMYLANVFVQFIILNKFLGNETFLWGFHTFADLYAGREWQDSGVFPRVTLCDFSVRKLANVHRYTVQCVLMINMFNEKIYLFIWFWFVFVLITTFINTLCTIYRLSFDSSRHNYIRSLLSGPVNNFKDEKAMIASFANNGLKQDGVLLMRFIDDHAGAMVTKEICEELF-----KKHGENLQHNRDFHHGHSTKSTS 391          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|O61715|INX19_CAEEL (Innexin-19 OS=Caenorhabditis elegans OX=6239 GN=inx-19 PE=1 SV=2)

HSP 1 Score: 171.4 bits (433), Expect = 6.151e-46
Identity = 143/433 (33.03%), Postives = 206/433 (47.58%), Query Frame = 2
Query:  215 AKLGR--LGSSHLRYDDDFIDRLNYQVTXXXXXXXXXXXXXRQYVGKPIQCWSPQEFTRGWEEYAENYCWVSNTYYSSVTVRLPPK-TDRRVLMIGYYQWAWIFLGVQALLFYLPCIIWRGLYNQSRFNIRRIIQMSASATDIIMPLXXXXXXXXXXXXIKFIAKYLDSCIRRRHLGRCKPEKKLNNNIKPGHQVSSP--------WCCSHK-----SGNCXXXXXXXXXXXXXXNAISQVYLMEAFIGTKNIL-YGVIVLIDLLKGRHWNESGHFPRVTFCDFQAKKLGKNHIYTLQCVLPINMILEKXXXXXXXXXXXXXXXNIFSFINWTGRLLQSRFRVQFIRKHLHIMGAL-------VSSDRPMSR-------------HFVEHYLGADVVFIIRLISTNSCEFVASQLANELWMIYRHRRHAELED 1402
            A L R  + +  +R DDD +DRLNY  T ++L +   +I  +QY G PI+CW         EEY E+YCW+ NTY+  +   +P   T R    IGYYQW    L  +AL+F LPCI WR    QS  NI+ +I  +     +                       LD+  R+      K  + +  N      + SP        W    K     SG CLSIL+ F KLLY +N ++Q  ++ A + + + L +G  VL D+  GR W E+GHFPRVT CDF+ + L   + YT+QC L IN+I EK+F  LW W ++LAII   SFI W         +V ++ K + I  +           D  + R              FV  +L +D V ++R+IS ++ + +  QL   LW  +R R   E E+
Sbjct:   21 ATLARSFINALSVRGDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWVNPHSRESMEEYIESYCWIQNTYWIPMYENVPDDHTAREEKQIGYYQWVPFILIAEALMFSLPCIFWRLCSFQSGLNIQTLINAACDGQAL-----------------------LDASDRQ------KAVEAITTNFVDNLDLQSPNGRIRARGWIARIKFSRFLSGQCLSILHSFTKLLYSMNVVAQFLILNACLKSSDFLFFGFQVLNDIWAGRPWTETGHFPRVTLCDFEVRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEFKKLQKFEKDATVERLYTVIAFAPHLLDTFVSDFLKSDGVLMLRMISNHAGDMIVVQLVRNLWQEFRERNWREFEE 424          
BLAST of Innexin vs. TrEMBL
Match: Q2L6N0 (Innexin OS=Dugesia japonica OX=6161 GN=inx4 PE=2 SV=1)

HSP 1 Score: 738.413 bits (1905), Expect = 0.000e+0
Identity = 407/445 (91.46%), Postives = 426/445 (95.73%), Query Frame = 2
Query:  188 MDATFVWKLAKLGRLGSSHLRYDDDFIDRLNYQVTXXXXXXXXXXXXXRQYVGKPIQCWSPQEFTRGWEEYAENYCWVSNTYYSSVTVRLPPKTDRRVLMIGYYQWAWIFLGVQALLFYLPCIIWRGLYNQSRFNIRRIIQMSASATDIIMPLXXXXXXXXXXXXIKFIAKYLDSCIRRRHLGRCKPEKKLNNNIKPGHQVSSPWCCSHKSGNCXXXXXXXXXXXXXXNAISQVYLMEAFIGTKNILYGVIVLIDLLKGRHWNESGHFPRVTFCDFQAKKLGKNHIYTLQCVLPINMILEKXXXXXXXXXXXXXXXNIFSFINWTGRLLQSRFRVQFIRKHLHIMGALVSSDRPMSRHFVEHYLGADVVFIIRLISTNSCEFVASQLANELWMIYRHRRHAELEDMKFGHGSLSPSQKSKLSGVCFGNSNRCVPLTSGANNDDIV 1522
            MDATFV KLAKLGRLGSSHLRYDDDFIDRLNYQ+TGILLFLFIGIIGIRQYVGKPIQCWSPQEFTRGWEEYAENYCWVSNTYY+SV+ RLP K +R+ LMIGYYQWAWIFLGVQAL+FY+PCI+WRGLYNQSRFNIRRIIQMSASATDIIMPLSEK+GN+SSNTSIKFIAKYLDSCIRRRHLGRCKP+KKLNNNIKPGHQVS+ WCCSHKSGNCL+ILYL IKLLYILNAISQVYLME FIGTK   YGV VL DLL+G HW +SGHFPRVTFCDFQAKKLGKNH+YTLQCVLPINMILEK+FIILWFWIVLL IINIFSFINWTGRLLQSRFRVQFIRKHLHIMG LVSSDRPMSRHFVEHYLGADVVFIIRLISTNSCEFVASQLANELWMIYRHRRHAELEDMKFGH SLSPSQKSKLSGVCFGNSNRCVPL+SG NNDD+V
Sbjct:    1 MDATFVRKLAKLGRLGSSHLRYDDDFIDRLNYQITGILLFLFIGIIGIRQYVGKPIQCWSPQEFTRGWEEYAENYCWVSNTYYASVSNRLPDKPNRKDLMIGYYQWAWIFLGVQALMFYIPCILWRGLYNQSRFNIRRIIQMSASATDIIMPLSEKNGNASSNTSIKFIAKYLDSCIRRRHLGRCKPDKKLNNNIKPGHQVSTSWCCSHKSGNCLTILYLLIKLLYILNAISQVYLMEIFIGTKYTFYGVYVLKDLLRGLHWADSGHFPRVTFCDFQAKKLGKNHLYTLQCVLPINMILEKVFIILWFWIVLLFIINIFSFINWTGRLLQSRFRVQFIRKHLHIMGTLVSSDRPMSRHFVEHYLGADVVFIIRLISTNSCEFVASQLANELWMIYRHRRHAELEDMKFGHASLSPSQKSKLSGVCFGNSNRCVPLSSGVNNDDVV 445          
BLAST of Innexin vs. TrEMBL
Match: A0A1I8GJJ5 (Innexin OS=Macrostomum lignano OX=282301 GN=inx PE=3 SV=1)

HSP 1 Score: 388.652 bits (997), Expect = 1.580e-125
Identity = 226/413 (54.72%), Postives = 298/413 (72.15%), Query Frame = 2
Query:  188 MDATFVWKLAKLGRLGSSHLRYDDDFIDRLNYQVTXXXXXXXXXXXXXRQYVGKPIQCWSPQEFTRGWEEYAENYCWVSNTYYSSVTV-RLPPKTDRRVLMIGYYQWAWIFLGVQALLFYLPCIIWRGLYNQSRFNIRRIIQMSASATDIIMPLXXXXXXXXXXXXIKFIAKYLDSCIRRRHLGRCKPEKKLNNNIKPGHQVSSPWCCSHKSGNCXXXXXXXXXXXXXXNAISQVYLMEAFIGTKNILYGVIVLIDLLKGRHWNESGHFPRVTFCDFQAKKLGKNHIYTLQCVLPINMILEKXXXXXXXXXXXXXXXNIFSFINWTGRLLQSRFRVQFIRKHLHIMGALVSSDRPMSRHFVEHYLGADVVFIIRLISTNSCEFVASQLANELWMIYRHRRHAELEDMKFGHGS 1423
            MDATF+WKL+KLGR+GSS  R DDDF DRLNYQ +G++LFLFIG+IGIRQYVGKPIQCW PQEFTRGWEEYAENYCWV+NTYY+S+    LP +  R  L I YYQWA I L VQAL+FY+PC+IWR   N S FN+RR++QM+A A ++++P        + N +++F+A+Y++ CI R+     + ++ L   ++      S  CC  + GN L +LY F+KLLY+LNA  Q+YLME F+GT +  +G  VL+D+L+G HW  S +FPRVTFCD QA+K+G N+ YTLQCVLP+NM LEKI++ LWFW+ L+++I + SF++W  R+  +R R  F+RK+L IM AL  +DR  SR FVE+YL  D VFI+RL+S N  + VA  LA ELW IYRH+R  ELED K    +
Sbjct:   91 MDATFMWKLSKLGRIGSSRQRVDDDFADRLNYQFSGVILFLFIGLIGIRQYVGKPIQCWIPQEFTRGWEEYAENYCWVANTYYASLEADHLPEEQSRSRLTITYYQWAPIVLAVQALMFYIPCLIWRLFMNYSGFNVRRLLQMAADA-NVVIP-------EALNKNVRFMARYMEGCIYRQR----EYKRGLGVRVRRCLSACSCICCGKRHGNFLVVLYFFVKLLYLLNAFGQLYLMEKFVGTTHTFFGFRVLLDILQGVHWYRSSNFPRVTFCDLQARKIGVNYRYTLQCVLPLNMFLEKIYVFLWFWVALVSVITMSSFVSWFCRMAFARRRTGFVRKYLKIMNALKDTDRLTSRKFVENYLRVDGVFILRLVSANCGDIVAGDLACELWSIYRHKRLQELEDTKLDAAA 491          
BLAST of Innexin vs. TrEMBL
Match: A0A267EEW5 (Innexin OS=Macrostomum lignano OX=282301 GN=inx PE=3 SV=1)

HSP 1 Score: 383.645 bits (984), Expect = 4.008e-125
Identity = 239/444 (53.83%), Postives = 306/444 (68.92%), Query Frame = 2
Query:  188 MDATFVWKLAKLGRLGSSHLRYDDDFIDRLNYQVTXXXXXXXXXXXXXRQYVGKPIQCWSPQEFTRGWEEYAENYCWVSNTYYSSVTV-RLPPKTDRRVLMIGYYQWAWIFLGVQALLFYLPCIIWRGLYNQSRFNIRRIIQMSASATDIIMPLXXXXXXXXXXXXIKFIAKYLDSCIRRRHLGRCKPEKKLNNNIKPGHQVSSPWCCSHKSGNCXXXXXXXXXXXXXXNAISQVYLMEAFIGTKNILYGVIVLIDLLKGRHWNESGHFPRVTFCDFQAKKLGKNHIYTLQCVLPINMILEKXXXXXXXXXXXXXXXNIFSFINWTGRLLQSRFRVQFIRKHLHIMGALVSSDRPMSRHFVEHYLGADVVFIIRLISTNSCEFVASQLANELWMIYRHRRHAELEDMKFGHGSLSPSQKSKLSGVCFGNSNRCVPLTSGANNDD 1516
            MDATF+WKL+KLGR+GSS LR+DDDF DRLNYQ TG++LFLFIG+IGIRQYVGKPIQCW PQEFTRGWEEYAENYCWV+NTYY+SV    LPP+  R  LMI YYQWA I L VQAL+FYLPC+IWR   N S FN+R+I+QM+  A ++++P        + N +++F+A+Y++ CI R+   R    + +   +K      S  CC  + GN L +LY FIK+LY+LN   Q+Y+ME FIGT    +G  VL+D++ G  W +S +FPRVTFCD QAKK G+N+ YTLQCVLP+NM LEKI++ LWFW VL++I+ + SF+NW  R+  +R R+ FIRK+L IM  L  +D+  SR FVE+YL  D VFI RLI+ N  + VA  LA ELW IYRH+R  EL+D K     L P  +       F   N     T+G N DD
Sbjct:    1 MDATFMWKLSKLGRIGSSKLRFDDDFADRLNYQFTGVILFLFIGLIGIRQYVGKPIQCWIPQEFTRGWEEYAENYCWVANTYYASVQADHLPPQHIRNELMITYYQWAPIVLAVQALMFYLPCLIWRLFMNYSGFNLRKILQMATDA-NVVIP-------EALNKNVRFMARYMEGCIYRQREYR----RGVGVRLKHCLSKCSCLCCGKRYGNFLVVLYFFIKVLYLLNVFGQLYIMEKFIGTTYTFFGFRVLLDIVHGIKWYQSSNFPRVTFCDLQAKKEGQNYHYTLQCVLPLNMFLEKIYVFLWFWHVLVSIVTLTSFVNWFFRMAFARRRLNFIRKYLKIMNVLKDTDKTTSRKFVENYLRVDGVFIFRLIAMNCGDIVAGDLACELWSIYRHKRLQELDDTK-----LEPDHRH----TAFAGMNA----TNGNNGDD 419          
BLAST of Innexin vs. TrEMBL
Match: A0A1I8GCN3 (Innexin OS=Macrostomum lignano OX=282301 GN=inx PE=3 SV=1)

HSP 1 Score: 383.259 bits (983), Expect = 5.794e-125
Identity = 230/408 (56.37%), Postives = 292/408 (71.57%), Query Frame = 2
Query:  188 MDATFVWKLAKLGRLGSSHLRYDDDFIDRLNYQVTXXXXXXXXXXXXXRQYVGKPIQCWSPQEFTRGWEEYAENYCWVSNTYYSSVTVR-LPPKTDRRVLMIGYYQWAWIFLGVQALLFYLPCIIWRGLYNQSRFNIRRIIQMSASATDIIMPLXXXXXXXXXXXXIKFIAKYLDSCIRRRHLGRCKPEKKLNNNIKPGHQVSSPWCCSHKSGNCXXXXXXXXXXXXXXNAISQVYLMEAFIGTKNILYGVIVLIDLLKGRHWNESGHFPRVTFCDFQAKKLGKNHIYTLQCVLPINMILEKXXXXXXXXXXXXXXXNIFSFINWTGRLLQSRFRVQFIRKHLHIMGALVSSDRPMSRHFVEHYLGADVVFIIRLISTNSCEFVASQLANELWMIYRHRRHAELEDMK 1408
            MDATF+WKL+KLGR+GSS LR+DDDF DRLNYQ TG++LFLFIG+IGIRQYVGKPIQCW PQEFTRGWEEYAENYCWV+NTYY+SV    LP +  RR  MI YYQWA I L VQAL+FYLPC+IWR   N S FN+R+I+QM+  A ++++P        + N +I+F+A+Y++ CI R+   R    + +   +K      S  CC  + GN L +LY FIK+LY+LN   Q+Y+ME F+GT    +G  VL DL  G  W +S +FPRVTFCD QAKKLG N+ YTLQCVLP+NM LEKI++ LWFW VL++I+ + SF+NW  R+  +R R+ F+RK+L IM  L  +D+  SR FVE+YL  D VFI RLI+ N  + VA  LA ELW IYRH+R  EL+D K
Sbjct:    1 MDATFMWKLSKLGRIGSSKLRFDDDFADRLNYQFTGVILFLFIGLIGIRQYVGKPIQCWIPQEFTRGWEEYAENYCWVANTYYASVPEEHLPAEHLRRKRMITYYQWAPIVLAVQALMFYLPCLIWRLFMNYSGFNVRKILQMATDA-NVVIP-------EALNKNIRFMARYMEGCIYRQREYR----RGVGVRVKHCLAKCSCLCCGKRYGNFLVVLYFFIKVLYLLNVFGQLYIMEKFVGTTYTFFGFQVLRDLFNGIQWYQSSNFPRVTFCDLQAKKLGVNYHYTLQCVLPLNMFLEKIYVFLWFWHVLVSIVTLGSFVNWFFRMAFARRRLIFVRKYLKIMNVLKDTDKTTSRKFVENYLRIDGVFIFRLIAMNCGDIVAGDLACELWSIYRHKRLQELDDTK 396          
BLAST of Innexin vs. TrEMBL
Match: Q2L6N1 (Innexin OS=Dugesia japonica OX=6161 GN=inx3 PE=2 SV=1)

HSP 1 Score: 378.252 bits (970), Expect = 3.657e-122
Identity = 233/468 (49.79%), Postives = 312/468 (66.67%), Query Frame = 2
Query:  188 MDATFVWKLAKLGRLGSSHLRYDDDFIDRLNYQVTXXXXXXXXXXXXXRQYVGKPIQCWSPQEFTRGWEEYAENYCWVSNTYYSSVTVRLPPKTDRRVLMIGYYQWAWIFLGVQALLFYLPCIIWRGLYNQSRFNIRRIIQMSASATDIIMPLXXXXXXXXXXXXIKFIAKYLDSCIRRRHLGRCKPEKKLNNNIKPGHQVSSPW------CCSHK-SGNCXXXXXXXXXXXXXXNAISQVYLMEAFIGTKNILYGVIVLIDLLKGRHWNESGHFPRVTFCDFQAKKLGKNHIYTLQCVLPINMILEKXXXXXXXXXXXXXXXNIFSFINWTGRLLQSRFRVQFIRKHLHIMGALVSSDRPMSRHFVEHYLGADVVFIIRLISTNSCEFVASQLANELWMIYRHRRHAELEDMKFGHGSLSPSQKSKLSGVCFGN-SNRCVPLTSGANNDDIV*S*RLSIDANHDFLI 1567
            MDATF W+L+KLGR+GS+ LR+DDDF+DRLNYQ TG+LLF+FIG+IGIRQYVGKPIQCW PQEFTRGWEEY ENYCWVSNTY++S+  R+P K  R   MIGYYQWA I LG+Q+LLFY+PC+IWR +  QS FN+RRI+Q+++ A   ++P            SI FIA+++D+C+ R  +  C   K    +     + S         CC  K  GN L++LY+ IK LY++N I Q+YLME FIGTK   YG+ VL DL++G  W+ SG+FPRVTFCD +AKKLGKNH+Y+LQCVLP+NM LEKI+I LWFW V++ I  + S  +W  R+     R++ IR +L +M  L  +D+  SR F E YL +D  F+I+LI+ N  + VA  L  E+W IYRH+R  E E++KF     S + +S+L  +   N SN      +GA+N+          + NHD ++
Sbjct:   39 MDATFFWRLSKLGRIGSNKLRFDDDFVDRLNYQFTGLLLFMFIGLIGIRQYVGKPIQCWIPQEFTRGWEEYTENYCWVSNTYFASIQNRMPSKDTRNEQMIGYYQWAPILLGLQSLLFYIPCLIWRNVSPQSGFNVRRILQVASDANCSLIP-------EQLQKSISFIARHMDTCLYRHRI--CYEHKHFMRSNGKRSKFSRCLAKLRCICCLGKLQGNFLTVLYISIKFLYLINIIGQLYLMEKFIGTKYTFYGIRVLWDLMRGHEWHHSGNFPRVTFCDLEAKKLGKNHLYSLQCVLPMNMFLEKIYIFLWFWHVIVGIATLCSLFSWIRRIGSPVNRIKMIRNYLRLMNILHDTDKGPSRKFAESYLRSDGCFLIQLIAINIGDLVAGDLICEMWQIYRHKRIQEFEELKF----TSLNVESRLPSLMLNNTSNLNDYDKNGASNN----------NGNHDEIV 483          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000059204.1 (SMESG000059204.1)

HSP 1 Score: 798.89 bits (2062), Expect = 0.000e+0
Identity = 445/445 (100.00%), Postives = 445/445 (100.00%), Query Frame = 2
Query:  188 MDATFVWKLAKLGRLGSSHLRYDDDFIDRLNYQVTXXXXXXXXXXXXXRQYVGKPIQCWSPQEFTRGWEEYAENYCWVSNTYYSSVTVRLPPKTDRRVLMIGYYQWAWIFLGVQALLFYLPCIIWRGLYNQSRFNIRRIIQMSASATDIIMPLXXXXXXXXXXXXIKFIAKYLDSCIRRRHLGRCKPEKKLNNNIKPGHQVSSPWCCSHKSGNCXXXXXXXXXXXXXXNAISQVYLMEAFIGTKNILYGVIVLIDLLKGRHWNESGHFPRVTFCDFQAKKLGKNHIYTLQCVLPINMILEKXXXXXXXXXXXXXXXNIFSFINWTGRLLQSRFRVQFIRKHLHIMGALVSSDRPMSRHFVEHYLGADVVFIIRLISTNSCEFVASQLANELWMIYRHRRHAELEDMKFGHGSLSPSQKSKLSGVCFGNSNRCVPLTSGANNDDIV 1522
            MDATFVWKLAKLGRLGSSHLRYDDDFIDRLNYQVTGILLFLFIGIIGIRQYVGKPIQCWSPQEFTRGWEEYAENYCWVSNTYYSSVTVRLPPKTDRRVLMIGYYQWAWIFLGVQALLFYLPCIIWRGLYNQSRFNIRRIIQMSASATDIIMPLSEKSGNSSSNTSIKFIAKYLDSCIRRRHLGRCKPEKKLNNNIKPGHQVSSPWCCSHKSGNCLSILYLFIKLLYILNAISQVYLMEAFIGTKNILYGVIVLIDLLKGRHWNESGHFPRVTFCDFQAKKLGKNHIYTLQCVLPINMILEKIFIILWFWIVLLAIINIFSFINWTGRLLQSRFRVQFIRKHLHIMGALVSSDRPMSRHFVEHYLGADVVFIIRLISTNSCEFVASQLANELWMIYRHRRHAELEDMKFGHGSLSPSQKSKLSGVCFGNSNRCVPLTSGANNDDIV
Sbjct:    1 MDATFVWKLAKLGRLGSSHLRYDDDFIDRLNYQVTGILLFLFIGIIGIRQYVGKPIQCWSPQEFTRGWEEYAENYCWVSNTYYSSVTVRLPPKTDRRVLMIGYYQWAWIFLGVQALLFYLPCIIWRGLYNQSRFNIRRIIQMSASATDIIMPLSEKSGNSSSNTSIKFIAKYLDSCIRRRHLGRCKPEKKLNNNIKPGHQVSSPWCCSHKSGNCLSILYLFIKLLYILNAISQVYLMEAFIGTKNILYGVIVLIDLLKGRHWNESGHFPRVTFCDFQAKKLGKNHIYTLQCVLPINMILEKIFIILWFWIVLLAIINIFSFINWTGRLLQSRFRVQFIRKHLHIMGALVSSDRPMSRHFVEHYLGADVVFIIRLISTNSCEFVASQLANELWMIYRHRRHAELEDMKFGHGSLSPSQKSKLSGVCFGNSNRCVPLTSGANNDDIV 445          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000045304.1 (SMESG000045304.1)

HSP 1 Score: 400.979 bits (1029), Expect = 1.354e-134
Identity = 231/428 (53.97%), Postives = 304/428 (71.03%), Query Frame = 2
Query:  188 MDATFVWKLAKLGRLGSSHLRYDDDFIDRLNYQVTXXXXXXXXXXXXXRQYVGKPIQCWSPQEFTRGWEEYAENYCWVSNTYYSSVTVRLPPKTDRRVLMIGYYQWAWIFLGVQALLFYLPCIIWRGLYNQSRFNIRRIIQMSASATDIIMPLXXXXXX--XXXXXXIKFIAKYLDSCIRRRHLGRCKPEKKLNNNIKPGHQVSSPW-------------------CCSHKSGNCXXXXXXXXXXXXXXNAISQVYLMEAFIGTKNILYGVIVLIDLLKGRHWNESGHFPRVTFCDFQAKKLGKNHIYTLQCVLPINMILEKXXXXXXXXXXXXXXXNIFSFINWTGRLLQSRFRVQFIRKHLHIMGALVSSDRPMSRHFVEHYLGADVVFIIRLISTNSCEFVASQLANELWMIYRHRRHAELEDMK 1408
            MDATFVWKL KLGRLGS+ LRYDDDF+DRLNYQ TG++LFLFIG++ IRQY+GKPIQCW PQEFTRGWEEYAENYCW++NTY++++  + P K +R+  MIGYYQWA IF+ +QAL+FYLPC+IWRGL ++S FN+RR+IQM++S  +II+           SSN + +F+ +Y+ +CI RR + R +   K  ++ K G   S  +                   CC  ++GN L  LY+ +K LY++N I Q+Y+ME FIG     YG+ +LIDL+KG+HW  SGHFPRVTFCD +AKKLGKN++YTLQCVLP+NM LEKIFI LWFW VLL I+N  S ++W+ ++L  + R++FIRK L I G L  +D   SR FV  YL  DVVFI++LI +N  E + + L  ELW IYRH+R  E +D+K
Sbjct:    1 MDATFVWKLGKLGRLGSNRLRYDDDFVDRLNYQFTGVILFLFIGLVSIRQYIGKPIQCWIPQEFTRGWEEYAENYCWIANTYFATIRGQFPHKINRKERMIGYYQWAPIFMALQALMFYLPCLIWRGLNHKSGFNVRRLIQMASSDPNIILSNFNCEYKPGPSSNAACRFMGRYISNCILRRQV-RSRGLLKSGHSCKKGENESLLFPISNSCCSRCCANHGCFESCCGRRNGNYLISLYITVKFLYLINIIIQLYIMELFIGASYSFYGLRLLIDLIKGKHWYNSGHFPRVTFCDLEAKKLGKNNLYTLQCVLPMNMFLEKIFIFLWFWHVLLGIVNFLSILSWSRQILSLKRRIKFIRKQLRISGVLKDTDLSASRQFVLQYLKPDVVFILKLIGSNIGEIIVTDLTTELWYIYRHKRLNECDDIK 427          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000060499.1 (SMESG000060499.1)

HSP 1 Score: 375.555 bits (963), Expect = 1.306e-124
Identity = 223/434 (51.38%), Postives = 299/434 (68.89%), Query Frame = 2
Query:  197 TFVWKLAKLGRLGSSHLRYDDDFIDRLNYQVTXXXXXXXXXXXXXRQYVGKPIQCWSPQEFTRGWEEYAENYCWVSNTYYSSVTVRLPPKTDRRVLMIGYYQWAWIFLGVQALLFYLPCIIWRGLYNQSRFNIRRIIQMSASATDIIMPLXXXXXXXXXXXXIKFIAKYLDSCIRRRHLGRCKPEKKLNNNIKPGHQVSSPW------CCSHK-SGNCXXXXXXXXXXXXXXNAISQVYLMEAFIGTKNILYGVIVLIDLLKGRHWNESGHFPRVTFCDFQAKKLGKNHIYTLQCVLPINMILEKXXXXXXXXXXXXXXXNIFSFINWTGRLLQSRFRVQFIRKHLHIMGALVSSDRPMSRHFVEHYLGADVVFIIRLISTNSCEFVASQLANELWMIYRHRRHAELEDMKFGHGSLSPSQKSKLSGVCFGNSN 1477
            TF W+L+KLGR+GS+ LR+DDDF+DRLNYQ TG+LLF+FIG+IGIRQYVGKPIQCW PQEFTRGWEEY ENYCWVSNTY++S+  R+P K  R+  MIGYYQWA I LG+Q+LLFY+PC+IWR +  QS FN+RRI+Q+++ A   ++P            SI FIA+++D+C+ R  +  C   K           +S         CC  K  GN L++LY+ IK+LY++N I Q+YLME FIGTK   YG+ VL DL++G  W+ SG+FPRVTFCD +AKKLGKNH+Y+LQCVLP+NM LEKI+I LWFW V++ I  +FS  +W  R+     R++ IR +L +M  L  +D+  SR F E YL +D  F+I+LI+ N  + VA  L  E+W IYRH+R  E E++KF     S + +S+L  +   N++
Sbjct:   42 TFFWRLSKLGRIGSNKLRFDDDFVDRLNYQFTGLLLFMFIGLIGIRQYVGKPIQCWIPQEFTRGWEEYTENYCWVSNTYFASIQNRMPSKDARKEQMIGYYQWAPILLGLQSLLFYIPCLIWRNVSPQSGFNVRRILQVASDANCSLIP-------EQLQKSISFIARHMDTCLYRHRI--CYEHKHFMRTNGKRSTISRCLAKLRCICCLGKLQGNFLTVLYISIKILYLINIIGQLYLMEKFIGTKYAFYGIRVLWDLMRGHEWHYSGNFPRVTFCDLEAKKLGKNHLYSLQCVLPMNMFLEKIYIFLWFWHVIVGIATLFSLFSWIKRIGSPVNRIKMIRNYLRLMNILHDTDKGPSRKFAESYLRSDGCFLIQLIAINIGDLVAGDLICEMWQIYRHKRIQEFEELKFT----SLNVESRLPSLMLNNTS 462          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000048374.1 (SMESG000048374.1)

HSP 1 Score: 353.599 bits (906), Expect = 1.005e-116
Identity = 211/455 (46.37%), Postives = 296/455 (65.05%), Query Frame = 2
Query:  188 MDATFVWKLAKLGRLGSSHLRYDDDFIDRLNYQVTXXXXXXXXXXXXXRQYVGKPIQCWSPQEFTRGWEEYAENYCWVSNTYYSSVTVRLPPKTDRRVLMIGYYQWAWIFLGVQALLFYLPCIIWRGLYNQSRFNIRRIIQMSASATDIIMPLXXXXXXXXXXXXIKFIAKYLDSCIRRRHLGRCKPEKKLNN---NIKPGHQVSSPWCCSHKSGNCXXXXXXXXXXXXXXNAISQVYLMEAFIGTKNILYGVIVLIDLLKGRHWNESGHFPRVTFCDFQAKKLGKNHIYTLQCVLPINMILEKXXXXXXXXXXXXXXXNIFSFINWTGRLLQSRFRVQFIRKHLHIMGALVSSDRPMSRHFVEHYLGADVVFIIRLISTNSCEFVASQLANELWMIYRHRRHAELEDMKFGHGSLSPSQKSKLSGVCFGNSNRCVPLTSGANN-------DDIV 1522
            MDAT VWK+AKLGR+GSSHLR+DDD++DRLNYQ+T  L FLFIG++G+R Y+GKPIQCW+PQEF + WE+Y+EN+CWVSNT+Y+ +   LP + D+   +IGYYQW  I L VQAL+FY+PC+IWR L N S FN+RRIIQM+     ++  +        ++ +IKFIA+Y+D+CI R +    + +  ++    N +      S  CC    G  L  LY  +K+LY++N + Q+YLM+ F+GT +  +GV VL+DL+ G  WN SG+FPRVTFC+ Q KKLG+N+IY LQCVLP+NM LEKI+I LWF+ V+L II   SF +W  R+   + R +FIRK+L I+ A+  +D   +  F E+ L  D VFII L++ N    VA  L  ELW IYRH+   + +++++        ++S + GV   + N     +   NN       DDIV
Sbjct:    1 MDATLVWKIAKLGRVGSSHLRFDDDWVDRLNYQITCFLHFLFIGVLGLRSYIGKPIQCWAPQEFNKAWEDYSENFCWVSNTFYAPINNNLPLRMDKTSKLIGYYQWTPIVLAVQALMFYIPCLIWRLLMNYSGFNVRRIIQMAGDTNSLVPDI--------NSKNIKFIARYIDTCIDRNYRDCKRNQISVDGKQLNYRKKCNCFSRHCCHTNHGRFLFFLYGIVKVLYVINVLLQMYLMKRFLGTDSNFFGVKVLVDLINGFEWNHSGNFPRVTFCEVQTKKLGENNIYNLQCVLPLNMFLEKIYIFLWFYYVILGIITTASFCSWLLRMGYVKSRWKFIRKYLKILNAMRETDNTATLKFTENNLRPDGVFIIYLVTINVGHIVAGDLTVELWNIYRHKSWQDNDNVRYLD---MDCRRSVVPGVALHHYNTSRLDSVNTNNHEKSNNHDDIV 444          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000055266.1 (SMESG000055266.1)

HSP 1 Score: 315.849 bits (808), Expect = 2.429e-102
Identity = 191/403 (47.39%), Postives = 259/403 (64.27%), Query Frame = 2
Query:  332 RQYVGKPIQCWSPQEFTRGWEEYAENYCWVSNTYYSSVTVRLPPKTDRRVLMIGYYQWAWIFLGVQALLFYLPCIIWRGLYNQSRFNIRRIIQMSASATDIIMPLXXXXXXXXXXXXIKFIAKYLDSCIRRRHL---GRCKPEKKLNNNIKPGHQVSSPWCCSHKSGNCXXXXXXXXXXXXXXNAISQVYLMEAFIGTKNILYGVIVLIDLLKGRHWNESGHFPRVTFCDFQAKKLGKNHIYTLQCVLPINMILEKXXXXXXXXXXXXXXXNIFSFINWTGRLLQSRFRVQFIRKHLHIMGALVSSDRPMSRHFVEHYLGADVVFIIRLISTNSCEFVASQLANELWMIYRHRRHAELEDMKFGHGSLSPSQKSKLSGVCFGNSNR--CVPLTSGAN-NDDIV 1522
            +Q  GKPIQCW PQEFTRGWEEYAE+YCW+S+TY++ V  RLP  TDR+ + I YYQWA I L VQALLF++PC+IWR L  QS FN++RI+Q++  A  II              SIKFIA ++D C++R+ +   G     K+L + +  G       CC+  SGN LS +Y+ IK+LY+LN + Q+YLM+ FIGT    YG+ VL DL+ G  W +SGHFPR+TFCDF+ KKLGKNHIYTLQCVLP+NM LEKIFI+LWFW V++  I   S ++W  +L+  + + +FIR +L +M  +  S+    ++F+  YL  D +FI+ LIS N  + VA+ +  ELW +YR +RH E E  K          ++ LSG  F N N+  C  +    + NDDIV
Sbjct:   39 QQDDGKPIQCWIPQEFTRGWEEYAESYCWISDTYFNPVDRRLPKLTDRQDVKISYYQWASIVLAVQALLFFIPCMIWRLLILQSGFNLQRIMQVAKDANAII--------PDHLQKSIKFIAIHMDKCLKRKKIYGTGYKAKFKRLLSYVNGG-------CCARNSGNYLSFVYIIIKVLYLLNVVGQLYLMQRFIGTSYSFYGIQVLYDLVTGIEWRKSGHFPRITFCDFKTKKLGKNHIYTLQCVLPLNMFLEKIFILLWFWNVIIGCITAVSLLSWLNKLMNRKHKFRFIRDYLKLMELVKKSEESWRKNFIFDYLRTDGLFIMHLISINVGDIVAADVVCELWNLYRSQRHNECEPFK-------SYDETNLSGYKFINVNKEICAEIPGKIDTNDDIV 419          
The following BLAST results are available for this feature:
BLAST of Innexin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
inx-16.834e-7237.26Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
inx-11.519e-7039.01Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
inx-11.519e-7039.01Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
unc-95.623e-6637.34Innexin unc-9 [Source:UniProtKB/Swiss-Prot;Acc:O0... [more]
unc-73.754e-6334.91Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q0... [more]
back to top
BLAST of Innexin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Inx29.712e-733.05gene:FBgn0027108 transcript:FBtr0301860[more]
Inx29.712e-733.05gene:FBgn0027108 transcript:FBtr0071005[more]
Inx29.712e-733.05gene:FBgn0027108 transcript:FBtr0332314[more]
Inx29.712e-733.05gene:FBgn0027108 transcript:FBtr0071006[more]
zpg1.948e-627.07gene:FBgn0024177 transcript:FBtr0076983[more]
back to top
BLAST of Innexin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O01393|UNC9_CAEEL7.153e-6537.34Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|Q03412|UNC7_CAEEL1.429e-6034.91Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|A8WVX4|INX19_CAEBR6.349e-4832.06Innexin-19 OS=Caenorhabditis briggsae OX=6238 GN=i... [more]
sp|Q19746|INX3_CAEEL3.376e-4734.17Innexin-3 OS=Caenorhabditis elegans OX=6239 GN=inx... [more]
sp|O61715|INX19_CAEEL6.151e-4633.03Innexin-19 OS=Caenorhabditis elegans OX=6239 GN=in... [more]
back to top
BLAST of Innexin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q2L6N00.000e+091.46Innexin OS=Dugesia japonica OX=6161 GN=inx4 PE=2 S... [more]
A0A1I8GJJ51.580e-12554.72Innexin OS=Macrostomum lignano OX=282301 GN=inx PE... [more]
A0A267EEW54.008e-12553.83Innexin OS=Macrostomum lignano OX=282301 GN=inx PE... [more]
A0A1I8GCN35.794e-12556.37Innexin OS=Macrostomum lignano OX=282301 GN=inx PE... [more]
Q2L6N13.657e-12249.79Innexin OS=Dugesia japonica OX=6161 GN=inx3 PE=2 S... [more]
back to top
BLAST of Innexin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000059204.10.000e+0100.00SMESG000059204.1[more]
SMESG000045304.11.354e-13453.97SMESG000045304.1[more]
SMESG000060499.11.306e-12451.38SMESG000060499.1[more]
SMESG000048374.11.005e-11646.37SMESG000048374.1[more]
SMESG000055266.12.429e-10247.39SMESG000055266.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016693 ID=SMED30016693|Name=Innexin|organism=Schmidtea mediterranea sexual|type=transcript|length=1705bp
CAACTTTAGACACACTTGCAAGCAGACGATTAGGGAGTTATTAGCAGCAA
TACTTCATTTATTCTCTGACATAGTAAATCAGAATTAGTTGGAATATATT
GATAAAATTTTTACATCATTTTCATACTATGAGTGCGGTAAAATTGTGTA
ATACAAGTGCTGTCTGATACAATCTGACAGATAGTAGATGGATGCAACAT
TCGTTTGGAAACTTGCTAAGCTCGGTCGTTTGGGGTCAAGTCATTTGAGG
TACGATGACGACTTCATTGATAGATTAAACTACCAAGTCACCGGTATCCT
TCTATTTCTCTTTATTGGTATAATTGGAATCCGGCAGTATGTTGGAAAAC
CCATACAATGCTGGAGTCCCCAGGAGTTTACTCGGGGATGGGAAGAGTAC
GCTGAAAACTACTGTTGGGTTTCAAATACTTACTATTCATCTGTAACGGT
CCGTCTTCCTCCAAAAACCGATCGTCGAGTGCTCATGATAGGTTATTACC
AATGGGCTTGGATATTTCTTGGCGTTCAAGCTCTTCTCTTTTATCTGCCT
TGTATAATATGGAGAGGATTATATAATCAGTCCCGATTTAATATTAGACG
AATTATTCAGATGTCTGCTAGTGCCACTGATATTATCATGCCATTGTCTG
AGAAAAGCGGAAATTCATCATCAAATACAAGCATAAAATTTATTGCAAAA
TACTTAGATAGTTGCATCAGAAGAAGGCATCTTGGAAGATGCAAGCCAGA
GAAAAAACTCAACAACAATATCAAGCCTGGTCATCAAGTTTCATCCCCAT
GGTGCTGCAGTCATAAGTCAGGAAACTGTTTAAGCATCCTATATTTGTTT
ATTAAACTGCTTTATATCCTCAATGCCATTAGTCAAGTGTACCTAATGGA
AGCATTTATTGGTACCAAGAACATATTATATGGAGTGATTGTACTAATAG
ACCTACTCAAAGGGCGTCACTGGAACGAGAGCGGTCATTTTCCACGAGTT
ACATTTTGTGATTTTCAAGCCAAAAAACTTGGTAAAAATCACATATATAC
CTTGCAGTGTGTTCTTCCAATCAACATGATCCTTGAAAAGATTTTCATTA
TTCTTTGGTTCTGGATTGTTTTATTAGCCATCATTAATATATTCAGTTTC
ATTAATTGGACCGGAAGGTTGCTCCAATCACGATTTCGAGTGCAATTTAT
TCGAAAACACCTGCATATCATGGGCGCTCTCGTTTCTTCCGATAGACCAA
TGAGTAGGCATTTTGTGGAACATTATCTTGGCGCCGATGTTGTGTTCATT
ATTCGTTTGATTTCTACAAACAGTTGTGAATTTGTAGCAAGTCAATTGGC
AAATGAATTGTGGATGATTTATAGACATCGCAGGCACGCAGAACTGGAAG
ATATGAAGTTTGGACATGGATCTTTGAGTCCAAGTCAGAAGTCAAAATTA
AGTGGAGTTTGTTTCGGCAACAGCAACCGATGTGTACCACTTACAAGCGG
AGCTAACAACGACGACATTGTCTGATCTTAAAGACTTTCTATTGATGCTA
ATCACGATTTTCTTATCTTTTCTTAATTTACTGTTCGACGAAACTGTGTA
GATTTTAGTGCAAAATGGTTTTATAATACTAGCATGTTTCAGAGCGATAT
GATTTTAGTGTAATAAGATTTAAATTTTTATGCATTTTACTAAACATAAT
AGATG
back to top

protein sequence of SMED30016693-orf-1

>SMED30016693-orf-1 ID=SMED30016693-orf-1|Name=SMED30016693-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=446bp
MDATFVWKLAKLGRLGSSHLRYDDDFIDRLNYQVTGILLFLFIGIIGIRQ
YVGKPIQCWSPQEFTRGWEEYAENYCWVSNTYYSSVTVRLPPKTDRRVLM
IGYYQWAWIFLGVQALLFYLPCIIWRGLYNQSRFNIRRIIQMSASATDII
MPLSEKSGNSSSNTSIKFIAKYLDSCIRRRHLGRCKPEKKLNNNIKPGHQ
VSSPWCCSHKSGNCLSILYLFIKLLYILNAISQVYLMEAFIGTKNILYGV
IVLIDLLKGRHWNESGHFPRVTFCDFQAKKLGKNHIYTLQCVLPINMILE
KIFIILWFWIVLLAIINIFSFINWTGRLLQSRFRVQFIRKHLHIMGALVS
SDRPMSRHFVEHYLGADVVFIIRLISTNSCEFVASQLANELWMIYRHRRH
AELEDMKFGHGSLSPSQKSKLSGVCFGNSNRCVPLTSGANNDDIV*
back to top
Aliases
The feature 'Innexin' has the following synonyms
Synonym
Dj-inx4
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000025nervous system
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR000990Innexin
Vocabulary: cellular component
TermDefinition
GO:0005921gap junction
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030054cell junction
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000990InnexinPRINTSPR01262INNEXINcoord: 267..276
score: 73.6
coord: 75..84
score: 53.6
coord: 291..307
score: 61.88
coord: 103..125
score: 52.7
coord: 219..233
score: 45.33
coord: 47..58
score: 52.67
IPR000990InnexinPFAMPF00876Innexincoord: 24..395
e-value: 1.6E-118
score: 396.1
IPR000990InnexinPANTHERPTHR11893INNEXINcoord: 20..404
IPR000990InnexinPROSITEPS51013PANNEXINcoord: 19..401
score: 34.238
NoneNo IPR availableTMHMMTMhelixcoord: 106..128
NoneNo IPR availableTMHMMTMhelixcoord: 30..52
NoneNo IPR availableTMHMMTMhelixcoord: 215..237
NoneNo IPR availableTMHMMTMhelixcoord: 302..324