Porphobilinogen deaminase

Overview
NamePorphobilinogen deaminase
Smed IDSMED30016690
Length (bp)3678
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Porphobilinogen deaminase (SMED30016690) t-SNE clustered cells

Violin plots show distribution of expression levels for Porphobilinogen deaminase (SMED30016690) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Porphobilinogen deaminase (SMED30016690) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Porphobilinogen deaminase (SMED30016690) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016690

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30016690SMESG000003171.1 Contig674GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pigment cellSMED30016690SMESG000071507.1 SMESG000003171.1 SMED30016690smed_20140614PMID:27551436
Wang et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
parenchymaSMED30016690SMESG000071507.1 SMESG000003171.1 SMED30016690smed_20140614PMID:27551436
Wang et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30016690SMESG000071507.1 dd_Smed_v4_3133_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
enteric muscle cellSMED30016690SMESG000071507.1 dd_Smed_v4_3133_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30016690SMESG000071507.1 dd_Smed_v6_3133_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30016690SMESG000003171.1 dd_Smed_v4_5260_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Porphobilinogen deaminase vs. Ensembl Human
Match: HMBS (hydroxymethylbilane synthase [Source:HGNC Symbol;Acc:HGNC:4982])

HSP 1 Score: 269.626 bits (688), Expect = 2.328e-80
Identity = 135/289 (46.71%), Postives = 191/289 (66.09%), Query Frame = 3
Query: 2499 NSSMKRIVKVGSRMSLLAKTQTQMVIDLLENRNPDMEFQLVTMDKIGDKLLNLKLSQTVDTSLFTKELELALMANEVDFVVHSLKDVPTVISKQFVIGSISARESCDDAVVLRLNSEYQNLESLPEGSMIGTSSARRIAQLKRKYPHLKFSSMRGNLTTRLMKLDDPEKAFQMNKGDNQKFEAIILAKAGLERLAWDHRISEVLSYEDTFYAVGQGALACECRRNDIDIRKILADINDETSMLTCIAERSFICELKVGYSAPFGVRSTLKENRLVLQGCLLNGEGTESV 3365
            NS   R+++VG+R S LA+ QT  V+  L+   P ++F+++ M   GDK+L+  LS+  + SLFTKELE AL  NEVD VVHSLKD+PTV+   F IG+I  RE+  DAVV       + LE+LPE S++GTSS RR AQL+RK+PHL+F S+RGNL TRL KLD           + Q+F AIILA AGL+R+ W +R+ ++L  E+  YAVGQGAL  E R  D DI  ++  ++D  ++L CIAER+F+  L+ G S P  V + +K+ +L L G + + +G++S+
Sbjct:   14 NSPKMRVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMSTTGDKILDTALSKIGEKSLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRLRKLD-----------EQQEFSAIILATAGLQRMGWHNRVGQILHPEECMYAVGQGALGVEVRAKDQDILDLVGVLHDPETLLRCIAERAFLRHLEGGCSVPVAVHTAMKDGQLYLTGGVWSLDGSDSI 291          
BLAST of Porphobilinogen deaminase vs. Ensembl Human
Match: HMBS (hydroxymethylbilane synthase [Source:HGNC Symbol;Acc:HGNC:4982])

HSP 1 Score: 266.159 bits (679), Expect = 2.573e-79
Identity = 133/284 (46.83%), Postives = 189/284 (66.55%), Query Frame = 3
Query: 2514 RIVKVGSRMSLLAKTQTQMVIDLLENRNPDMEFQLVTMDKIGDKLLNLKLSQTVDTSLFTKELELALMANEVDFVVHSLKDVPTVISKQFVIGSISARESCDDAVVLRLNSEYQNLESLPEGSMIGTSSARRIAQLKRKYPHLKFSSMRGNLTTRLMKLDDPEKAFQMNKGDNQKFEAIILAKAGLERLAWDHRISEVLSYEDTFYAVGQGALACECRRNDIDIRKILADINDETSMLTCIAERSFICELKVGYSAPFGVRSTLKENRLVLQGCLLNGEGTESV 3365
            R+++VG+R S LA+ QT  V+  L+   P ++F+++ M   GDK+L+  LS+  + SLFTKELE AL  NEVD VVHSLKD+PTV+   F IG+I  RE+  DAVV       + LE+LPE S++GTSS RR AQL+RK+PHL+F S+RGNL TRL KLD           + Q+F AIILA AGL+R+ W +R+ ++L  E+  YAVGQGAL  E R  D DI  ++  ++D  ++L CIAER+F+  L+ G S P  V + +K+ +L L G + + +G++S+
Sbjct:    2 RVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMSTTGDKILDTALSKIGEKSLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRLRKLD-----------EQQEFSAIILATAGLQRMGWHNRVGQILHPEECMYAVGQGALGVEVRAKDQDILDLVGVLHDPETLLRCIAERAFLRHLEGGCSVPVAVHTAMKDGQLYLTGGVWSLDGSDSI 274          
BLAST of Porphobilinogen deaminase vs. Ensembl Human
Match: HMBS (hydroxymethylbilane synthase [Source:HGNC Symbol;Acc:HGNC:4982])

HSP 1 Score: 266.159 bits (679), Expect = 2.573e-79
Identity = 133/284 (46.83%), Postives = 189/284 (66.55%), Query Frame = 3
Query: 2514 RIVKVGSRMSLLAKTQTQMVIDLLENRNPDMEFQLVTMDKIGDKLLNLKLSQTVDTSLFTKELELALMANEVDFVVHSLKDVPTVISKQFVIGSISARESCDDAVVLRLNSEYQNLESLPEGSMIGTSSARRIAQLKRKYPHLKFSSMRGNLTTRLMKLDDPEKAFQMNKGDNQKFEAIILAKAGLERLAWDHRISEVLSYEDTFYAVGQGALACECRRNDIDIRKILADINDETSMLTCIAERSFICELKVGYSAPFGVRSTLKENRLVLQGCLLNGEGTESV 3365
            R+++VG+R S LA+ QT  V+  L+   P ++F+++ M   GDK+L+  LS+  + SLFTKELE AL  NEVD VVHSLKD+PTV+   F IG+I  RE+  DAVV       + LE+LPE S++GTSS RR AQL+RK+PHL+F S+RGNL TRL KLD           + Q+F AIILA AGL+R+ W +R+ ++L  E+  YAVGQGAL  E R  D DI  ++  ++D  ++L CIAER+F+  L+ G S P  V + +K+ +L L G + + +G++S+
Sbjct:    2 RVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMSTTGDKILDTALSKIGEKSLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRLRKLD-----------EQQEFSAIILATAGLQRMGWHNRVGQILHPEECMYAVGQGALGVEVRAKDQDILDLVGVLHDPETLLRCIAERAFLRHLEGGCSVPVAVHTAMKDGQLYLTGGVWSLDGSDSI 274          
BLAST of Porphobilinogen deaminase vs. Ensembl Human
Match: HMBS (hydroxymethylbilane synthase [Source:HGNC Symbol;Acc:HGNC:4982])

HSP 1 Score: 266.159 bits (679), Expect = 2.573e-79
Identity = 133/284 (46.83%), Postives = 189/284 (66.55%), Query Frame = 3
Query: 2514 RIVKVGSRMSLLAKTQTQMVIDLLENRNPDMEFQLVTMDKIGDKLLNLKLSQTVDTSLFTKELELALMANEVDFVVHSLKDVPTVISKQFVIGSISARESCDDAVVLRLNSEYQNLESLPEGSMIGTSSARRIAQLKRKYPHLKFSSMRGNLTTRLMKLDDPEKAFQMNKGDNQKFEAIILAKAGLERLAWDHRISEVLSYEDTFYAVGQGALACECRRNDIDIRKILADINDETSMLTCIAERSFICELKVGYSAPFGVRSTLKENRLVLQGCLLNGEGTESV 3365
            R+++VG+R S LA+ QT  V+  L+   P ++F+++ M   GDK+L+  LS+  + SLFTKELE AL  NEVD VVHSLKD+PTV+   F IG+I  RE+  DAVV       + LE+LPE S++GTSS RR AQL+RK+PHL+F S+RGNL TRL KLD           + Q+F AIILA AGL+R+ W +R+ ++L  E+  YAVGQGAL  E R  D DI  ++  ++D  ++L CIAER+F+  L+ G S P  V + +K+ +L L G + + +G++S+
Sbjct:    2 RVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMSTTGDKILDTALSKIGEKSLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRLRKLD-----------EQQEFSAIILATAGLQRMGWHNRVGQILHPEECMYAVGQGALGVEVRAKDQDILDLVGVLHDPETLLRCIAERAFLRHLEGGCSVPVAVHTAMKDGQLYLTGGVWSLDGSDSI 274          
BLAST of Porphobilinogen deaminase vs. Ensembl Human
Match: HMBS (hydroxymethylbilane synthase [Source:HGNC Symbol;Acc:HGNC:4982])

HSP 1 Score: 258.07 bits (658), Expect = 2.951e-76
Identity = 134/289 (46.37%), Postives = 188/289 (65.05%), Query Frame = 3
Query: 2499 NSSMKRIVKVGSRMSLLAKTQTQMVIDLLENRNPDMEFQLVTMDKIGDKLLNLKLSQTVDTSLFTKELELALMANEVDFVVHSLKDVPTVISKQFVIGSISARESCDDAVVLRLNSEYQNLESLPEGSMIGTSSARRIAQLKRKYPHLKFSSMRGNLTTRLMKLDDPEKAFQMNKGDNQKFEAIILAKAGLERLAWDHRISEVLSYEDTFYAVGQGALACECRRNDIDIRKILADINDETSMLTCIAERSFICELKVGYSAPFGVRSTLKENRLVLQGCLLNGEGTESV 3365
            NS   R+++VG+R S LA+ QT  V+  L+   P ++F+      I DK+L+  LS+  + SLFTKELE AL  NEVD VVHSLKD+PTV+   F IG+I  RE+  DAVV       + LE+LPE S++GTSS RR AQL+RK+PHL+F S+RGNL TRL KLD           + Q+F AIILA AGL+R+ W +R+ ++L  E+  YAVGQGAL  E R  D DI  ++  ++D  ++L CIAER+F+  L+ G S P  V + +K+ +L L G + + +G++S+
Sbjct:   14 NSPKMRVIRVGTRKSQLARIQTDSVVATLKASYPGLQFE------IRDKILDTALSKIGEKSLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRLRKLD-----------EQQEFSAIILATAGLQRMGWHNRVGQILHPEECMYAVGQGALGVEVRAKDQDILDLVGVLHDPETLLRCIAERAFLRHLEGGCSVPVAVHTAMKDGQLYLTGGVWSLDGSDSI 285          
BLAST of Porphobilinogen deaminase vs. Ensembl Celegans
Match: rnf-145 (RiNg Finger protein [Source:UniProtKB/TrEMBL;Acc:Q95Y82])

HSP 1 Score: 87.0409 bits (214), Expect = 5.308e-17
Identity = 54/211 (25.59%), Postives = 103/211 (48.82%), Query Frame = 1
Query: 1387 KHIVCLILSLVVFLLPVVICFNIYSFFYFDFWLITIMGSFLMTSVHMLSSFITYCLYLDNARKLRTNRSILPDKCNIDDVISLLNFAVQSIELCIAIGLVILLIARAFSGVWNWVSIVLLFVHFYFNIYERIRNGWVNYHRRKSVMKIIDRMYSVCDVEEISRFEDVCAICFGELSSEDYNGPVKRTVCRHFFHKECLKKWLLIKHSCPMC 2019
            +H  C+ ++L++ ++P      + +    D +   I+ +    +   +   + Y + +         +S  P +  IDD+   ++ A + IEL  A  +++    +     +++ +  +L  H   NIY+R+ +       R + +K I+R+ S  DV ++   EDVCAICF E+  E      + T C+H+FH  CL+KWL +K  CP+C
Sbjct:  433 RHARCICIALLLVVIPFFTTKTMLALLPIDIYTAIIIANSATVTARAIGVILKYIVLIVE------TKSEEPWE-GIDDLTYYIDCANKGIELLAAKVVMVFGCMQVVKVGFSFATFAILLFHVIVNIYKRLEHTVSFIKNRNAAVKNINRL-SKADVVQLREREDVCAICFIEMKEE-----ARITPCKHYFHGPCLRKWLAVKMVCPLC 630          
BLAST of Porphobilinogen deaminase vs. Ensembl Celegans
Match: sel-11 (E3 ubiquitin-protein ligase hrd-1 [Source:UniProtKB/Swiss-Prot;Acc:Q20798])

HSP 1 Score: 50.8322 bits (120), Expect = 5.858e-6
Identity = 25/109 (22.94%), Postives = 54/109 (49.54%), Query Frame = 1
Query: 1717 VWNWVSIVLLFVHFY--FNI---YERIR---NGWVNYHRRKSVMKIIDRMYSVCDVEEISRFEDVCAICFGELSSEDYNGPVKRTVCRHFFHKECLKKWLLIKHSCPMC 2019
            ++ + ++V+L VH +  F++   Y+ +R     +++    +  +  ++  + V   E+++  +  C IC  E++    +   KR  C H FH  CL+ W   + +CP C
Sbjct:  227 LYGFFAVVMLRVHTFPLFSVRPFYQSVRALHKAFLDVILSRRAINAMNSQFPVVSAEDLAAMDATCIICREEMT---VDASPKRLPCSHVFHAHCLRSWFQRQQTCPTC 332          
BLAST of Porphobilinogen deaminase vs. Ensembl Celegans
Match: toe-4 (Target Of ERK kinase MPK-1 [Source:UniProtKB/TrEMBL;Acc:Q9XUM8])

HSP 1 Score: 50.447 bits (119), Expect = 7.284e-6
Identity = 23/56 (41.07%), Postives = 30/56 (53.57%), Query Frame = 1
Query: 1879 EDVCAICFGELSSEDYNGPVKRTVCRHFFHKECLKKWLLIKHSCPMCSREFTESET 2046
            ED C +C   LSS +    +++  C H FH EC+ KWL I   CPMC  E    E+
Sbjct:  430 EDTCTVC---LSSFEDGESIQKLRCNHVFHPECIYKWLDINKRCPMCREEIDRPES 482          
BLAST of Porphobilinogen deaminase vs. Ensembl Fly
Match: l(3)02640 (gene:FBgn0010786 transcript:FBtr0072679)

HSP 1 Score: 233.802 bits (595), Expect = 8.227e-65
Identity = 128/273 (46.89%), Postives = 168/273 (61.54%), Query Frame = 3
Query: 2502 SSMKRIVKVGSRMSLLAKTQTQMVIDLLENRNPDMEFQLVTMDKIGDKLLNLKLSQTVDTSLFTKELELALMANEVDFVVHSLKDVPTVISKQFVIGSISARESCDDAVVLRLNSEYQNLESLPEGSMIGTSSARRIAQLKRKYPHLKFSSMRGNLTTRLMKLDDPEKAFQMNKGDNQKFEAIILAKAGLERLAWDHRISEVLSYEDTFYAVGQGALACECRRNDIDIRKILADINDETSMLTCIAERSFICELKVGYSAPFGVRSTLKENRL 3320
            S+ +++++VGSR S LA  QT+ VI  L+   P  +F++ TM   GD++LN+ L +  + SLFT++LE AL    VDFVVHSLKD+PT +     IG++  RE   DA+VLR N +   + SLP+GS+IGTSS RR AQ++R YPHL    +RGNL TRL KLD            + KF  IILA+AGL R+ W  RIS+VL   D  YAVGQGALA ECR ND  +  +L  +    +    +AERSF+  L  G SAP  V S LK   L
Sbjct:    2 SAQEKVIRVGSRKSELALIQTKHVIGRLQKLYPKQKFEIHTMSTFGDRVLNVSLPKIGEKSLFTRDLEDALRNGGVDFVVHSLKDLPTALPTGMAIGAVLEREDARDALVLRENFKGHTIASLPKGSVIGTSSLRRTAQIRRMYPHLTVCDIRGNLNTRLAKLD----------AADSKFSGIILAQAGLVRMGWMSRISQVLEPTDLLYAVGQGALAVECRANDDQVLAMLQKLMCLNTTCRILAERSFLKTLGGGCSAPVAVWSNLKGEPL 264          
BLAST of Porphobilinogen deaminase vs. Ensembl Fly
Match: Trc8 (gene:FBgn0039668 transcript:FBtr0085432)

HSP 1 Score: 100.138 bits (248), Expect = 6.548e-21
Identity = 64/216 (29.63%), Postives = 107/216 (49.54%), Query Frame = 1
Query: 1387 KHIVCLILSLVVFLLPVVICFNIYSFFYFDFWLITIMGSFLMTSVHMLSSFITYCLYLDNARKLRTNRSILPDKCNIDDVISLLNFAVQSIELCIAI-----GLVILLIARAFSGVWNWVSIVLLFVHFYFNIYERIRNGWVNYHRRKSVMKIIDRMYSVCDVEEISRFEDVCAICFGELSSEDYNGPVKRTVCRHFFHKECLKKWLLIKHSCPMC 2019
            +H+  L +   + +L V + ++++S      WL+ +    +   V +L S  TY L+L +AR     R    +K  +DD +  +     S+E C  I     G  IL+   A +     +  +++ +H YFNI+   R GW  + +R+S +  I  +      + +  F+DVCAIC+ E+ S       K T CRHFFH  CL+KWL ++  CP+C
Sbjct:  457 RHVRALSVCAFLVVLSVSLLYHLWSQQSISTWLLAVTAFSVEVVVKVLVSLATYTLFLLDAR-----RQFFWEK--LDDYLYYVRAFGNSVEFCFGILLFINGAWILIFESAQNATGGGIRAIMMCIHAYFNIWCEARAGWSVFMKRRSAVHKISALPEATPAQ-LQAFDDVCAICYQEMYS------AKITRCRHFFHGVCLRKWLYVQDRCPLC 658          
BLAST of Porphobilinogen deaminase vs. Ensembl Fly
Match: Trc8 (gene:FBgn0039668 transcript:FBtr0333188)

HSP 1 Score: 97.0561 bits (240), Expect = 5.585e-20
Identity = 65/215 (30.23%), Postives = 108/215 (50.23%), Query Frame = 1
Query: 1387 KHIVCLILSLVVFLLPVVICFNIYSFFYFDFWLITIMGSFLMTSVHMLSSFITYCLYLDNARKLRTNRSILPDKCNIDDVISLLNFAVQSIELCIAIGLVI----LLIARAFSGVWNWVSIVLLFVHFYFNIYERIRNGWVNYHRRKSVMKIIDRMYSVCDVEEISRFEDVCAICFGELSSEDYNGPVKRTVCRHFFHKECLKKWLLIKHSCPMC 2019
            +H+  L +   + +L V + ++++S      WL+ +    +   V +L S  TY L+L +AR     R    +K  +DD +  +     S+E C  I L I    +LI  +  G+      +++ +H YFNI+   R GW  + +R+S +  I  +      + +  F+DVCAIC+ E+ S       K T CRHFFH  CL+KWL ++  CP+C
Sbjct:  457 RHVRALSVCAFLVVLSVSLLYHLWSQQSISTWLLAVTAFSVEVVVKVLVSLATYTLFLLDAR-----RQFFWEK--LDDYLYYVRAFGNSVEFCFGILLFINGAWILIFESGGGI----RAIMMCIHAYFNIWCEARAGWSVFMKRRSAVHKISALPEATPAQ-LQAFDDVCAICYQEMYS------AKITRCRHFFHGVCLRKWLYVQDRCPLC 653          
BLAST of Porphobilinogen deaminase vs. Ensembl Fly
Match: Trc8 (gene:FBgn0039668 transcript:FBtr0085430)

HSP 1 Score: 97.0561 bits (240), Expect = 5.585e-20
Identity = 65/215 (30.23%), Postives = 108/215 (50.23%), Query Frame = 1
Query: 1387 KHIVCLILSLVVFLLPVVICFNIYSFFYFDFWLITIMGSFLMTSVHMLSSFITYCLYLDNARKLRTNRSILPDKCNIDDVISLLNFAVQSIELCIAIGLVI----LLIARAFSGVWNWVSIVLLFVHFYFNIYERIRNGWVNYHRRKSVMKIIDRMYSVCDVEEISRFEDVCAICFGELSSEDYNGPVKRTVCRHFFHKECLKKWLLIKHSCPMC 2019
            +H+  L +   + +L V + ++++S      WL+ +    +   V +L S  TY L+L +AR     R    +K  +DD +  +     S+E C  I L I    +LI  +  G+      +++ +H YFNI+   R GW  + +R+S +  I  +      + +  F+DVCAIC+ E+ S       K T CRHFFH  CL+KWL ++  CP+C
Sbjct:  457 RHVRALSVCAFLVVLSVSLLYHLWSQQSISTWLLAVTAFSVEVVVKVLVSLATYTLFLLDAR-----RQFFWEK--LDDYLYYVRAFGNSVEFCFGILLFINGAWILIFESGGGI----RAIMMCIHAYFNIWCEARAGWSVFMKRRSAVHKISALPEATPAQ-LQAFDDVCAICYQEMYS------AKITRCRHFFHGVCLRKWLYVQDRCPLC 653          
BLAST of Porphobilinogen deaminase vs. Ensembl Fly
Match: Trc8 (gene:FBgn0039668 transcript:FBtr0085429)

HSP 1 Score: 97.0561 bits (240), Expect = 5.585e-20
Identity = 65/215 (30.23%), Postives = 108/215 (50.23%), Query Frame = 1
Query: 1387 KHIVCLILSLVVFLLPVVICFNIYSFFYFDFWLITIMGSFLMTSVHMLSSFITYCLYLDNARKLRTNRSILPDKCNIDDVISLLNFAVQSIELCIAIGLVI----LLIARAFSGVWNWVSIVLLFVHFYFNIYERIRNGWVNYHRRKSVMKIIDRMYSVCDVEEISRFEDVCAICFGELSSEDYNGPVKRTVCRHFFHKECLKKWLLIKHSCPMC 2019
            +H+  L +   + +L V + ++++S      WL+ +    +   V +L S  TY L+L +AR     R    +K  +DD +  +     S+E C  I L I    +LI  +  G+      +++ +H YFNI+   R GW  + +R+S +  I  +      + +  F+DVCAIC+ E+ S       K T CRHFFH  CL+KWL ++  CP+C
Sbjct:  457 RHVRALSVCAFLVVLSVSLLYHLWSQQSISTWLLAVTAFSVEVVVKVLVSLATYTLFLLDAR-----RQFFWEK--LDDYLYYVRAFGNSVEFCFGILLFINGAWILIFESGGGI----RAIMMCIHAYFNIWCEARAGWSVFMKRRSAVHKISALPEATPAQ-LQAFDDVCAICYQEMYS------AKITRCRHFFHGVCLRKWLYVQDRCPLC 653          
BLAST of Porphobilinogen deaminase vs. Ensembl Zebrafish
Match: hmbsb (hydroxymethylbilane synthase, b [Source:ZFIN;Acc:ZDB-GENE-050522-491])

HSP 1 Score: 270.011 bits (689), Expect = 1.109e-80
Identity = 138/290 (47.59%), Postives = 198/290 (68.28%), Query Frame = 3
Query: 2496 NNSSMKRIVKVGSRMSLLAKTQTQMVIDLLENRNPDMEFQLVTMDKIGDKLLNLKLSQTVDTSLFTKELELALMANEVDFVVHSLKDVPTVISKQFVIGSISARESCDDAVVLRLNSEYQNLESLPEGSMIGTSSARRIAQLKRKYPHLKFSSMRGNLTTRLMKLDDPEKAFQMNKGDNQKFEAIILAKAGLERLAWDHRISEVLSYEDTFYAVGQGALACECRRNDIDIRKILADINDETSMLTCIAERSFICELKVGYSAPFGVRSTLKENRLVLQGCLLNGEGTESV 3365
            ++  + R+++VG+R S LA+ QT  V++ L+   PD+ F++V M   GDK+L+  LS+  + SLFTKELE AL  NEVD VVHSLKD+PTV+   F IG++  RE+  DAVVL   ++ + L+SL   S+IGTSS RR AQLK+++PHL+F  +RGNL TRL KLD           +N  F AIILA AGL+R+ W++RIS++L  ED  YAVGQGALA E R  D+DI ++++ +ND  + L+CIAER+F+  L+ G S P  V S +K ++L L G + + +G++S+
Sbjct:   10 SDGRVSRVIRVGTRKSQLARIQTDSVVEKLKELYPDVLFEIVAMSTTGDKILDTALSKIGEKSLFTKELENALEKNEVDLVVHSLKDLPTVLPGGFTIGAVLKRENPHDAVVLHPKNKGKRLDSLSNKSVIGTSSLRRAAQLKKRFPHLEFKDIRGNLNTRLKKLD-----------ENNDFSAIILAAAGLKRMGWENRISQILGPEDCMYAVGQGALAVEVRARDLDILEMVSVLNDSDTALSCIAERAFLKHLEGGCSVPVAVHSEVKNSQLYLTGAVYSLDGSDSL 288          
BLAST of Porphobilinogen deaminase vs. Ensembl Zebrafish
Match: hmbsb (hydroxymethylbilane synthase, b [Source:ZFIN;Acc:ZDB-GENE-050522-491])

HSP 1 Score: 259.996 bits (663), Expect = 4.263e-78
Identity = 133/270 (49.26%), Postives = 185/270 (68.52%), Query Frame = 3
Query: 2508 MKRIVKVGSRMSLLAKTQTQMVIDLLENRNPDMEFQLVTMDKIGDKLLNLKLSQTVDTSLFTKELELALMANEVDFVVHSLKDVPTVISKQFVIGSISARESCDDAVVLRLNSEYQNLESLPEGSMIGTSSARRIAQLKRKYPHLKFSSMRGNLTTRLMKLDDPEKAFQMNKGDNQKFEAIILAKAGLERLAWDHRISEVLSYEDTFYAVGQGALACECRRNDIDIRKILADINDETSMLTCIAERSFICELKVGYSAPFGVRSTLKENR 3317
            + R+++VG+R S LA+ QT  V++ L+   PD+ F++V M   GDK+L+  LS+  + SLFTKELE AL  NEVD VVHSLKD+PTV+   F IG++  RE+  DAVVL   ++ + L+SL   S+IGTSS RR AQLK+++PHL+F  +RGNL TRL KLD           +N  F AIILA AGL+R+ W++RIS++L  ED  YAVGQGALA E R  D+DI ++++ +ND  + L+CIAER+F+  L+ G S P  V S +K ++
Sbjct:   28 VSRVIRVGTRKSQLARIQTDSVVEKLKELYPDVLFEIVAMSTTGDKILDTALSKIGEKSLFTKELENALEKNEVDLVVHSLKDLPTVLPGGFTIGAVLKRENPHDAVVLHPKNKGKRLDSLSNKSVIGTSSLRRAAQLKKRFPHLEFKDIRGNLNTRLKKLD-----------ENNDFSAIILAAAGLKRMGWENRISQILGPEDCMYAVGQGALAVEVRARDLDILEMVSVLNDSDTALSCIAERAFLKHLEGGCSVPVAVHSEVKNSQ 286          
BLAST of Porphobilinogen deaminase vs. Ensembl Zebrafish
Match: hmbsa (hydroxymethylbilane synthase a [Source:ZFIN;Acc:ZDB-GENE-040426-1375])

HSP 1 Score: 242.662 bits (618), Expect = 6.569e-71
Identity = 153/362 (42.27%), Postives = 220/362 (60.77%), Query Frame = 3
Query: 2499 NSSMKRIVKVGSRMSLLAKTQTQMVIDLLENRNPDMEFQLVTMDKIGDKLLNLKLSQTVDTSLFTKELELALMANEVDFVVHSLKDVPTVISKQFVIGSISARESCDDAVVLRLNSEYQNLESLPEGSMIGTSSARRIAQLKRKYPHLKFSSMRGNLTTRLMKLDDPEKAFQMNKGDNQKFEAIILAKAGLERLAWDHRISEVLSYEDTFYAVGQGALACECRRNDIDIRKILADINDETSMLTCIAERSFICELKVGYSAPFGVRSTLKENRLVLQGCLLNGEGTESV--IVKSEIDLVEKSNQFLSKTCNRMQAANGDSGVRFTGVEIYGIGSLAYSKMEACVELGLQMAANILLGGGDK 3578
            N    R++++G+R S LA+ QT  V   L+   PD+  ++V M  IGDK+L+  LS+  + SLFTKELE AL  NEVD VVHSLKD+PT +   F IG+I  RE+  DAVVL   +    L+SLPE S+IGTSS RR AQLK+++P L+F ++RGNL TRL KLD+ +            + AIILA AGL+R+ W+ RIS+VL  ED  YAVGQGALA E R  D DI ++++ ++   ++L CI+ER+F+ +L+ G S P  V + +K + L L G + + +G + +   +++ ++L  K N+   ++ N              GV    I S   S +EA  +LGL + AN+LL  G K
Sbjct:   12 NGKASRVIRMGTRKSQLARIQTDSVAGTLKQLYPDVHLEIVAMSTIGDKILDTALSKIGEKSLFTKELENALERNEVDIVVHSLKDLPTSLPPGFTIGAILERENPHDAVVLHPKNAGLTLDSLPEKSVIGTSSLRRAAQLKKRFPQLEFENIRGNLNTRLKKLDEKD-----------DYAAIILAAAGLKRMGWESRISQVLGPEDCMYAVGQGALAVEVRAQDKDILEMVSVLHHPDTVLRCISERAFLKQLEGGCSVPVAVHTEVKGSMLYLTGAVYSLDGADCLKDTMQTCVELDNKVNESTQRSAN-------------VGVTACNISS---SALEAAEKLGLDL-ANVLLNKGAK 345          
BLAST of Porphobilinogen deaminase vs. Ensembl Zebrafish
Match: hmbsa (hydroxymethylbilane synthase a [Source:ZFIN;Acc:ZDB-GENE-040426-1375])

HSP 1 Score: 242.276 bits (617), Expect = 7.687e-71
Identity = 153/362 (42.27%), Postives = 220/362 (60.77%), Query Frame = 3
Query: 2499 NSSMKRIVKVGSRMSLLAKTQTQMVIDLLENRNPDMEFQLVTMDKIGDKLLNLKLSQTVDTSLFTKELELALMANEVDFVVHSLKDVPTVISKQFVIGSISARESCDDAVVLRLNSEYQNLESLPEGSMIGTSSARRIAQLKRKYPHLKFSSMRGNLTTRLMKLDDPEKAFQMNKGDNQKFEAIILAKAGLERLAWDHRISEVLSYEDTFYAVGQGALACECRRNDIDIRKILADINDETSMLTCIAERSFICELKVGYSAPFGVRSTLKENRLVLQGCLLNGEGTESV--IVKSEIDLVEKSNQFLSKTCNRMQAANGDSGVRFTGVEIYGIGSLAYSKMEACVELGLQMAANILLGGGDK 3578
            N    R++++G+R S LA+ QT  V   L+   PD+  ++V M  IGDK+L+  LS+  + SLFTKELE AL  NEVD VVHSLKD+PT +   F IG+I  RE+  DAVVL   +    L+SLPE S+IGTSS RR AQLK+++P L+F ++RGNL TRL KLD+ +            + AIILA AGL+R+ W+ RIS+VL  ED  YAVGQGALA E R  D DI ++++ ++   ++L CI+ER+F+ +L+ G S P  V + +K + L L G + + +G + +   +++ ++L  K N+   ++ N              GV    I S   S +EA  +LGL + AN+LL  G K
Sbjct:   15 NGKASRVIRMGTRKSQLARIQTDSVAGTLKQLYPDVHLEIVAMSTIGDKILDTALSKIGEKSLFTKELENALERNEVDIVVHSLKDLPTSLPPGFTIGAILERENPHDAVVLHPKNAGLTLDSLPEKSVIGTSSLRRAAQLKKRFPQLEFENIRGNLNTRLKKLDEKD-----------DYAAIILAAAGLKRMGWESRISQVLGPEDCMYAVGQGALAVEVRAQDKDILEMVSVLHHPDTVLRCISERAFLKQLEGGCSVPVAVHTEVKGSMLYLTGAVYSLDGADCLKDTMQTCVELDNKVNESTQRSAN-------------VGVTACNISS---SALEAAEKLGLDL-ANVLLNKGAK 348          
BLAST of Porphobilinogen deaminase vs. Ensembl Zebrafish
Match: hmbsb (hydroxymethylbilane synthase, b [Source:ZFIN;Acc:ZDB-GENE-050522-491])

HSP 1 Score: 228.409 bits (581), Expect = 1.235e-67
Identity = 117/230 (50.87%), Postives = 158/230 (68.70%), Query Frame = 3
Query: 2496 NNSSMKRIVKVGSRMSLLAKTQTQMVIDLLENRNPDMEFQLVTMDKIGDKLLNLKLSQTVDTSLFTKELELALMANEVDFVVHSLKDVPTVISKQFVIGSISARESCDDAVVLRLNSEYQNLESLPEGSMIGTSSARRIAQLKRKYPHLKFSSMRGNLTTRLMKLDDPEKAFQMNKGDNQKFEAIILAKAGLERLAWDHRISEVLSYEDTFYAVGQGALACECRRNDIDI 3185
            ++  + R+++VG+R S LA+ QT  V++ L+   PD+ F++V M   GDK+L+  LS+  + SLFTKELE AL  NEVD VVHSLKD+PTV+   F IG++  RE+  DAVVL   ++ + L+SL   S+IGTSS RR AQLK+++PHL+F  +RGNL TRL KLD           +N  F AIILA AGL+R+ W++RIS++L  ED  YAVGQGALA E R  D+DI
Sbjct:   12 SDGRVSRVIRVGTRKSQLARIQTDSVVEKLKELYPDVLFEIVAMSTTGDKILDTALSKIGEKSLFTKELENALEKNEVDLVVHSLKDLPTVLPGGFTIGAVLKRENPHDAVVLHPKNKGKRLDSLSNKSVIGTSSLRRAAQLKKRFPHLEFKDIRGNLNTRLKKLD-----------ENNDFSAIILAAAGLKRMGWENRISQILGPEDCMYAVGQGALAVEVRARDLDI 230          
BLAST of Porphobilinogen deaminase vs. Ensembl Xenopus
Match: neurl1b (neuralized E3 ubiquitin protein ligase 1B [Source:Xenbase;Acc:XB-GENE-6469687])

HSP 1 Score: 262.692 bits (670), Expect = 4.874e-78
Identity = 149/356 (41.85%), Postives = 212/356 (59.55%), Query Frame = 3
Query: 2511 KRIVKVGSRMSLLAKTQTQMVIDLLENRNPDMEFQLVTMDKIGDKLLNLKLSQTVDTSLFTKELELALMANEVDFVVHSLKDVPTVISKQFVIGSISARESCDDAVVLRLNSEYQNLESLPEGSMIGTSSARRIAQLKRKYPHLKFSSMRGNLTTRLMKLDDPEKAFQMNKGDNQKFEAIILAKAGLERLAWDHRISEVLSYEDTFYAVGQGALACECRRNDIDIRKILADINDETSMLTCIAERSFICELKVGYSAPFGVRSTLKENRLVLQGCLLNGEGTESVIVKSEIDLVEKSNQFLSKTCNRMQAANGDSGVRFTGVEIYGIGSLAYSKMEACVELGLQMAANILLGGGDK 3578
            K +++VG+R S LA+ QT  V+++L  R P   F +V M   GDK+L+  LS+  + SLFTKELE AL  NEVD VVHSLKD+PT +   F IG++  RE+  DAVV         L +LPE S+IGTSS RR AQLK+K+PHL+F  +RGNL TR+ KLD+ E            F AIILA AGL R+ W++RI ++L+ ++  YAVGQGALA E R  D DI  +++ + D  ++L CIAER+F+  L+ G S P  V + +K+++L L G + + +G++S        L E     ++     ++  N D  V+  G+   G+   A    E C+  GL   A++LL  G K
Sbjct:    8 KHVIRVGTRKSQLARIQTDSVVEMLSKRFPSTHFDIVAMSTTGDKILDTALSKIGEKSLFTKELENALERNEVDLVVHSLKDLPTSLPPGFTIGAVCKRENPYDAVVFHPKRYGNTLSTLPEKSVIGTSSLRRAAQLKKKFPHLEFKDIRGNLNTRMKKLDEKE-----------DFSAIILAAAGLRRMGWENRIGQILTSDECLYAVGQGALAIEVRAKDQDILSMVSALQDPETVLRCIAERAFMKRLEGGCSVPVAVNTVVKDSQLYLTGAVYSLDGSDS--------LKETMQSCINFPQQEVEGPNDD--VQHVGITALGVSHQALESAE-CLGTGL---ADLLLSKGAK 338          
BLAST of Porphobilinogen deaminase vs. Ensembl Xenopus
Match: neurl1b (neuralized E3 ubiquitin protein ligase 1B [Source:Xenbase;Acc:XB-GENE-6469687])

HSP 1 Score: 262.692 bits (670), Expect = 6.800e-78
Identity = 149/356 (41.85%), Postives = 212/356 (59.55%), Query Frame = 3
Query: 2511 KRIVKVGSRMSLLAKTQTQMVIDLLENRNPDMEFQLVTMDKIGDKLLNLKLSQTVDTSLFTKELELALMANEVDFVVHSLKDVPTVISKQFVIGSISARESCDDAVVLRLNSEYQNLESLPEGSMIGTSSARRIAQLKRKYPHLKFSSMRGNLTTRLMKLDDPEKAFQMNKGDNQKFEAIILAKAGLERLAWDHRISEVLSYEDTFYAVGQGALACECRRNDIDIRKILADINDETSMLTCIAERSFICELKVGYSAPFGVRSTLKENRLVLQGCLLNGEGTESVIVKSEIDLVEKSNQFLSKTCNRMQAANGDSGVRFTGVEIYGIGSLAYSKMEACVELGLQMAANILLGGGDK 3578
            K +++VG+R S LA+ QT  V+++L  R P   F +V M   GDK+L+  LS+  + SLFTKELE AL  NEVD VVHSLKD+PT +   F IG++  RE+  DAVV         L +LPE S+IGTSS RR AQLK+K+PHL+F  +RGNL TR+ KLD+ E            F AIILA AGL R+ W++RI ++L+ ++  YAVGQGALA E R  D DI  +++ + D  ++L CIAER+F+  L+ G S P  V + +K+++L L G + + +G++S        L E     ++     ++  N D  V+  G+   G+   A    E C+  GL   A++LL  G K
Sbjct:   15 KHVIRVGTRKSQLARIQTDSVVEMLSKRFPSTHFDIVAMSTTGDKILDTALSKIGEKSLFTKELENALERNEVDLVVHSLKDLPTSLPPGFTIGAVCKRENPYDAVVFHPKRYGNTLSTLPEKSVIGTSSLRRAAQLKKKFPHLEFKDIRGNLNTRMKKLDEKE-----------DFSAIILAAAGLRRMGWENRIGQILTSDECLYAVGQGALAIEVRAKDQDILSMVSALQDPETVLRCIAERAFMKRLEGGCSVPVAVNTVVKDSQLYLTGAVYSLDGSDS--------LKETMQSCINFPQQEVEGPNDD--VQHVGITALGVSHQALESAE-CLGTGL---ADLLLSKGAK 345          
BLAST of Porphobilinogen deaminase vs. Ensembl Xenopus
Match: neurl1b (neuralized E3 ubiquitin protein ligase 1B [Source:Xenbase;Acc:XB-GENE-6469687])

HSP 1 Score: 228.409 bits (581), Expect = 1.884e-66
Identity = 130/318 (40.88%), Postives = 187/318 (58.81%), Query Frame = 3
Query: 2625 MDKIGDKLLNLKLSQTVDTSLFTKELELALMANEVDFVVHSLKDVPTVISKQFVIGSISARESCDDAVVLRLNSEYQNLESLPEGSMIGTSSARRIAQLKRKYPHLKFSSMRGNLTTRLMKLDDPEKAFQMNKGDNQKFEAIILAKAGLERLAWDHRISEVLSYEDTFYAVGQGALACECRRNDIDIRKILADINDETSMLTCIAERSFICELKVGYSAPFGVRSTLKENRLVLQGCLLNGEGTESVIVKSEIDLVEKSNQFLSKTCNRMQAANGDSGVRFTGVEIYGIGSLAYSKMEACVELGLQMAANILLGGGDK 3578
            M   GDK+L+  LS+  + SLFTKELE AL  NEVD VVHSLKD+PT +   F IG++  RE+  DAVV         L +LPE S+IGTSS RR AQLK+K+PHL+F  +RGNL TR+ KLD+ E            F AIILA AGL R+ W++RI ++L+ ++  YAVGQGALA E R  D DI  +++ + D  ++L CIAER+F+  L+ G S P  V + +K+++L L G + + +G++S+             + + +    ++    +  V+  G+   G+   A    E C+  GL   A++LL  G K
Sbjct:    1 MSTTGDKILDTALSKIGEKSLFTKELENALERNEVDLVVHSLKDLPTSLPPGFTIGAVCKRENPYDAVVFHPKRYGNTLSTLPEKSVIGTSSLRRAAQLKKKFPHLEFKDIRGNLNTRMKKLDEKE-----------DFSAIILAAAGLRRMGWENRIGQILTSDECLYAVGQGALAIEVRAKDQDILSMVSALQDPETVLRCIAERAFMKRLEGGCSVPVAVNTVVKDSQLYLTGAVYSLDGSDSL------------KETMQRKLISLEVEGPNDDVQHVGITALGVSHQALESAE-CLGTGL---ADLLLSKGAK 291          
BLAST of Porphobilinogen deaminase vs. Ensembl Xenopus
Match: neurl1b (neuralized E3 ubiquitin protein ligase 1B [Source:Xenbase;Acc:XB-GENE-6469687])

HSP 1 Score: 217.238 bits (552), Expect = 9.697e-63
Identity = 127/301 (42.19%), Postives = 178/301 (59.14%), Query Frame = 3
Query: 2676 DTSLFTKELELALMANEVDFVVHSLKDVPTVISKQFVIGSISARESCDDAVVLRLNSEYQNLESLPEGSMIGTSSARRIAQLKRKYPHLKFSSMRGNLTTRLMKLDDPEKAFQMNKGDNQKFEAIILAKAGLERLAWDHRISEVLSYEDTFYAVGQGALACECRRNDIDIRKILADINDETSMLTCIAERSFICELKVGYSAPFGVRSTLKENRLVLQGCLLNGEGTESVIVKSEIDLVEKSNQFLSKTCNRMQAANGDSGVRFTGVEIYGIGSLAYSKMEACVELGLQMAANILLGGGDK 3578
            + SLFTKELE AL  NEVD VVHSLKD+PT +   F IG++  RE+  DAVV         L +LPE S+IGTSS RR AQLK+K+PHL+F  +RGNL TR+ KLD+ E            F AIILA AGL R+ W++RI ++L+ ++  YAVGQGALA E R  D DI  +++ + D  ++L CIAER+F+  L+ G S P  V + +K+++L L G + + +G++S        L E     ++     ++  N D  V+  G+   G+   A    E C+  GL   A++LL  G K
Sbjct:    4 EKSLFTKELENALERNEVDLVVHSLKDLPTSLPPGFTIGAVCKRENPYDAVVFHPKRYGNTLSTLPEKSVIGTSSLRRAAQLKKKFPHLEFKDIRGNLNTRMKKLDEKE-----------DFSAIILAAAGLRRMGWENRIGQILTSDECLYAVGQGALAIEVRAKDQDILSMVSALQDPETVLRCIAERAFMKRLEGGCSVPVAVNTVVKDSQLYLTGAVYSLDGSDS--------LKETMQSCINFPQQEVEGPNDD--VQHVGITALGVSHQALESAE-CLGTGL---ADLLLSKGAK 279          
BLAST of Porphobilinogen deaminase vs. Ensembl Xenopus
Match: neurl1b (neuralized E3 ubiquitin protein ligase 1B [Source:Xenbase;Acc:XB-GENE-6469687])

HSP 1 Score: 216.083 bits (549), Expect = 2.259e-62
Identity = 126/298 (42.28%), Postives = 176/298 (59.06%), Query Frame = 3
Query: 2685 LFTKELELALMANEVDFVVHSLKDVPTVISKQFVIGSISARESCDDAVVLRLNSEYQNLESLPEGSMIGTSSARRIAQLKRKYPHLKFSSMRGNLTTRLMKLDDPEKAFQMNKGDNQKFEAIILAKAGLERLAWDHRISEVLSYEDTFYAVGQGALACECRRNDIDIRKILADINDETSMLTCIAERSFICELKVGYSAPFGVRSTLKENRLVLQGCLLNGEGTESVIVKSEIDLVEKSNQFLSKTCNRMQAANGDSGVRFTGVEIYGIGSLAYSKMEACVELGLQMAANILLGGGDK 3578
            LFTKELE AL  NEVD VVHSLKD+PT +   F IG++  RE+  DAVV         L +LPE S+IGTSS RR AQLK+K+PHL+F  +RGNL TR+ KLD+ E            F AIILA AGL R+ W++RI ++L+ ++  YAVGQGALA E R  D DI  +++ + D  ++L CIAER+F+  L+ G S P  V + +K+++L L G + + +G++S        L E     ++     ++  N D  V+  G+   G+   A    E C+  GL   A++LL  G K
Sbjct:    2 LFTKELENALERNEVDLVVHSLKDLPTSLPPGFTIGAVCKRENPYDAVVFHPKRYGNTLSTLPEKSVIGTSSLRRAAQLKKKFPHLEFKDIRGNLNTRMKKLDEKE-----------DFSAIILAAAGLRRMGWENRIGQILTSDECLYAVGQGALAIEVRAKDQDILSMVSALQDPETVLRCIAERAFMKRLEGGCSVPVAVNTVVKDSQLYLTGAVYSLDGSDS--------LKETMQSCINFPQQEVEGPNDD--VQHVGITALGVSHQALESAE-CLGTGL---ADLLLSKGAK 274          
BLAST of Porphobilinogen deaminase vs. Ensembl Mouse
Match: Hmbs (hydroxymethylbilane synthase [Source:MGI Symbol;Acc:MGI:96112])

HSP 1 Score: 267.314 bits (682), Expect = 1.129e-79
Identity = 135/289 (46.71%), Postives = 194/289 (67.13%), Query Frame = 3
Query: 2499 NSSMKRIVKVGSRMSLLAKTQTQMVIDLLENRNPDMEFQLVTMDKIGDKLLNLKLSQTVDTSLFTKELELALMANEVDFVVHSLKDVPTVISKQFVIGSISARESCDDAVVLRLNSEYQNLESLPEGSMIGTSSARRIAQLKRKYPHLKFSSMRGNLTTRLMKLDDPEKAFQMNKGDNQKFEAIILAKAGLERLAWDHRISEVLSYEDTFYAVGQGALACECRRNDIDIRKILADINDETSMLTCIAERSFICELKVGYSAPFGVRSTLKENRLVLQGCLLNGEGTESV 3365
            N S  R+++VG+R S LA+ QT  V+ +L+   P ++F+++ M   GDK+L+  LS+  + SLFTKELE AL  NEVD VVHSLKDVPT++   F IG+I  RE+  DAVV       + LE+LPE S +GTSS RR+AQL+RK+PHL+F S+RGNL TRL KLD           + Q+F AI+LA AGL+R+ W +R+ ++L  E+  YAVGQGALA E R  D DI  +++ ++D  ++L CIAER+F+  L+ G S P  V + +K+ +L L G + + +G++S+
Sbjct:   14 NGSKMRVIRVGTRKSQLARIQTDTVVAMLKALYPGIQFEIIAMSTTGDKILDTALSKIGEKSLFTKELENALEKNEVDLVVHSLKDVPTILPPGFTIGAICKRENPCDAVVFHPKFIGKTLETLPEKSAVGTSSLRRVAQLQRKFPHLEFKSIRGNLNTRLRKLD-----------ELQEFSAIVLAVAGLQRMGWQNRVGQILHPEECMYAVGQGALAVEVRAKDQDILDLVSVLHDPETLLRCIAERAFLRHLEGGCSVPVAVHTVMKDGQLYLTGGVWSLDGSDSM 291          
BLAST of Porphobilinogen deaminase vs. Ensembl Mouse
Match: Hmbs (hydroxymethylbilane synthase [Source:MGI Symbol;Acc:MGI:96112])

HSP 1 Score: 264.233 bits (674), Expect = 1.021e-78
Identity = 133/284 (46.83%), Postives = 192/284 (67.61%), Query Frame = 3
Query: 2514 RIVKVGSRMSLLAKTQTQMVIDLLENRNPDMEFQLVTMDKIGDKLLNLKLSQTVDTSLFTKELELALMANEVDFVVHSLKDVPTVISKQFVIGSISARESCDDAVVLRLNSEYQNLESLPEGSMIGTSSARRIAQLKRKYPHLKFSSMRGNLTTRLMKLDDPEKAFQMNKGDNQKFEAIILAKAGLERLAWDHRISEVLSYEDTFYAVGQGALACECRRNDIDIRKILADINDETSMLTCIAERSFICELKVGYSAPFGVRSTLKENRLVLQGCLLNGEGTESV 3365
            R+++VG+R S LA+ QT  V+ +L+   P ++F+++ M   GDK+L+  LS+  + SLFTKELE AL  NEVD VVHSLKDVPT++   F IG+I  RE+  DAVV       + LE+LPE S +GTSS RR+AQL+RK+PHL+F S+RGNL TRL KLD           + Q+F AI+LA AGL+R+ W +R+ ++L  E+  YAVGQGALA E R  D DI  +++ ++D  ++L CIAER+F+  L+ G S P  V + +K+ +L L G + + +G++S+
Sbjct:    2 RVIRVGTRKSQLARIQTDTVVAMLKALYPGIQFEIIAMSTTGDKILDTALSKIGEKSLFTKELENALEKNEVDLVVHSLKDVPTILPPGFTIGAICKRENPCDAVVFHPKFIGKTLETLPEKSAVGTSSLRRVAQLQRKFPHLEFKSIRGNLNTRLRKLD-----------ELQEFSAIVLAVAGLQRMGWQNRVGQILHPEECMYAVGQGALAVEVRAKDQDILDLVSVLHDPETLLRCIAERAFLRHLEGGCSVPVAVHTVMKDGQLYLTGGVWSLDGSDSM 274          
BLAST of Porphobilinogen deaminase vs. Ensembl Mouse
Match: Rnf145 (ring finger protein 145 [Source:MGI Symbol;Acc:MGI:1921565])

HSP 1 Score: 118.242 bits (295), Expect = 1.378e-26
Identity = 100/399 (25.06%), Postives = 184/399 (46.12%), Query Frame = 1
Query:  850 GWLEIPSVLWSLFDLSRQFFVFWIGLLITHTIIYQEKFDGKPS-----ILIFAAISESVQTPLGLIGFSVASCYASRMILKLIDWLVHVNQ--FNESNNSHGIAEGFSTLLMMLSLNRSILKVTDTNSDKSINMIDSMEKSSVSPXXXXXXXXXXXXXXXXXXXXXXXXTKLVHLIATASTIQHWHKHIVCLILSLVVFLLPVVICFNIYSFFYFDFWLITIMGSFLMTSVHMLSSFITYCLYL-DNARKLRTNRSILPDKCNIDDVISLLNFAVQSIELCIAIGLVILLIARAFSGVWNWVSIVLLFVHFYFNIYERIRNGWVNY-HRRKSVMKIIDRMYSVCDVEEISRFEDVCAICFGELSSEDYNGPVKRTVCRHFFHKECLKKWLLIKHSCPMC 2019
            G L +   LW+   +   F VFW+ L       Y    D   S      L   +I+E   TP  L+G      + +  +L L  + +   +   N+   + G+ EG +  L++L++   ++++   +    +++I  +  +S+                     S +     + L   AS  +   KH   + L L + + P  + + I  FF+ DFWL+ I+ S ++TS+ +L +   Y L++ +  RK            N+DDVI  +N   + +E  +A+ +V   ++    G W  +  +++F+H Y+N++ R + GW ++  RR +V KI  +   V   E++ +  D+CAIC+ ++ S         T C HFFH  CLKKWL ++ +CP+C
Sbjct:  213 GLLALGMSLWNQLVVPVLFMVFWLVLFALQIYSYFSTRDQPASRERLLFLFLTSIAECCSTPYSLLGLVFTVSFVALGVLTLCKFYLQGYRAFMNDPAMNRGMTEGVT--LLILAVQTGLIELQVVHRAFLLSIILFIVVASI-------------------LQSMLEIADPIVLALGASRDKSLWKHFRAVSLCLFLLVFPAYMAYMICQFFHMDFWLLIIISSSILTSLQVLGTLFIYVLFMVEEFRKEPVE--------NMDDVIYYVNGTYRLLEFVVALCVVAYGVSETIFGEWTVMGSMIIFIHSYYNVWLRAQLGWKSFLLRRDAVNKI--KSLPVATQEQLEKHNDICAICYQDMKSAVI------TPCSHFFHAGCLKKWLYVQDTCPLC 574          
BLAST of Porphobilinogen deaminase vs. Ensembl Mouse
Match: Hmbs (hydroxymethylbilane synthase [Source:MGI Symbol;Acc:MGI:96112])

HSP 1 Score: 95.9005 bits (237), Expect = 1.140e-22
Identity = 45/107 (42.06%), Postives = 73/107 (68.22%), Query Frame = 3
Query: 3045 AIILAKAGLERLAWDHRISEVLSYEDTFYAVGQGALACECRRNDIDIRKILADINDETSMLTCIAERSFICELKVGYSAPFGVRSTLKENRLVLQGCLLNGEGTESV 3365
            AI+LA AGL+R+ W +R+ ++L  E+  YAVGQGALA E R  D DI  +++ ++D  ++L CIAER+F+  L+ G S P  V + +K+ +L L G + + +G++S+
Sbjct:    2 AIVLAVAGLQRMGWQNRVGQILHPEECMYAVGQGALAVEVRAKDQDILDLVSVLHDPETLLRCIAERAFLRHLEGGCSVPVAVHTVMKDGQLYLTGGVWSLDGSDSM 108          
BLAST of Porphobilinogen deaminase vs. Ensembl Mouse
Match: Rnf139 (ring finger protein 139 [Source:MGI Symbol;Acc:MGI:1923091])

HSP 1 Score: 102.834 bits (255), Expect = 1.033e-21
Identity = 67/262 (25.57%), Postives = 134/262 (51.15%), Query Frame = 1
Query: 1360 TASTIQHWHKHIVCLILSLVVFLLPVVICFNIYSFFYFDFWLITIMGSFLMTSVHMLSSFITYCLYLDNARKLRTNRSILPDKCNIDDVISLLNFAVQSIELCIAIGLVILLIARAFSGVWNWVSIV---LLFVHFYFNIYERIRNGWVNYHRRKSVMKIIDRMYSVCDVEEISRFEDVCAICFGELSSEDYNGPVKRTVCRHFFHKECLKKWLLIKHSCPMCSRE-FTESETEINSFMMDNVIINSESDTESVSNNSNDPN 2133
            +AS +  +H+H   L +S  +F+LPV++ + ++  +  + WL  +    +   + ++ S   Y L++ +        ++L +K  +DD +  +      IE       V++    A++ ++   S +   ++ +H YFNIY +++NGW  +  R++ +K I+ +  +     +   +DVCAIC+ E ++       + T C H+FH  CL+KWL I+ +CPMC ++ + E E + NS        N+ ++   ++ N N PN
Sbjct:  379 SASHVSSFHRHFPVLFVSACLFILPVLLSYVLWHHYALNTWLFAVTAFCVELCLKVIVSLTVYTLFMIDGYY-----NVLWEK--LDDYVYFVRSTGNIIEFIFG---VVMFGNGAYTMMFESGSKIRACMMCLHAYFNIYLQVKNGWKTFMNRRTAVKKINSLPEI-KGSHLQEIDDVCAICYHEFTTS-----ARITPCNHYFHALCLRKWLYIQDTCPMCHQKVYIEDEIKDNS--------NASNNNGFIAPNEN-PN 615          
BLAST of Porphobilinogen deaminase vs. UniProt/SwissProt
Match: sp|P19356|HEM3_RAT (Porphobilinogen deaminase OS=Rattus norvegicus OX=10116 GN=Hmbs PE=1 SV=2)

HSP 1 Score: 270.011 bits (689), Expect = 1.022e-79
Identity = 136/289 (47.06%), Postives = 193/289 (66.78%), Query Frame = 3
Query: 2499 NSSMKRIVKVGSRMSLLAKTQTQMVIDLLENRNPDMEFQLVTMDKIGDKLLNLKLSQTVDTSLFTKELELALMANEVDFVVHSLKDVPTVISKQFVIGSISARESCDDAVVLRLNSEYQNLESLPEGSMIGTSSARRIAQLKRKYPHLKFSSMRGNLTTRLMKLDDPEKAFQMNKGDNQKFEAIILAKAGLERLAWDHRISEVLSYEDTFYAVGQGALACECRRNDIDIRKILADINDETSMLTCIAERSFICELKVGYSAPFGVRSTLKENRLVLQGCLLNGEGTESV 3365
            N SM R+++VG+R S LA+ QT  V+ +L+   P ++F+++ M   GDK+L+  LS+  + SLFTKELE AL  NEVD VVHSLKDVPT++   F IG+I  RE+  DAVV       + LE+LPE S +GTSS RR+AQL+RK+PHL+F S+RGNL TRL KLD           +  +F AIILA AGL+R+ W +R+ ++L  E+  YAVGQGALA E R  D DI  ++  ++D  ++L CIAER+F+  L+ G S P  V + +K+ +L L G + + +G++S+
Sbjct:   14 NGSMMRVIRVGTRKSQLARIQTDTVVAMLKTLYPGIQFEIIAMSTTGDKILDTALSKIGEKSLFTKELENALEKNEVDLVVHSLKDVPTILPPGFTIGAICKRENPCDAVVFHPKFIGKTLETLPEKSAVGTSSLRRVAQLQRKFPHLEFKSIRGNLNTRLRKLD-----------EQLEFSAIILAVAGLQRMGWQNRVGQILHPEECMYAVGQGALAVEVRAKDQDILDLVGVLHDPETLLRCIAERAFLRHLEGGCSVPVAVHTVMKDGQLYLTGGVWSLDGSDSM 291          
BLAST of Porphobilinogen deaminase vs. UniProt/SwissProt
Match: sp|P08397|HEM3_HUMAN (Porphobilinogen deaminase OS=Homo sapiens OX=9606 GN=HMBS PE=1 SV=2)

HSP 1 Score: 269.626 bits (688), Expect = 1.118e-79
Identity = 135/289 (46.71%), Postives = 191/289 (66.09%), Query Frame = 3
Query: 2499 NSSMKRIVKVGSRMSLLAKTQTQMVIDLLENRNPDMEFQLVTMDKIGDKLLNLKLSQTVDTSLFTKELELALMANEVDFVVHSLKDVPTVISKQFVIGSISARESCDDAVVLRLNSEYQNLESLPEGSMIGTSSARRIAQLKRKYPHLKFSSMRGNLTTRLMKLDDPEKAFQMNKGDNQKFEAIILAKAGLERLAWDHRISEVLSYEDTFYAVGQGALACECRRNDIDIRKILADINDETSMLTCIAERSFICELKVGYSAPFGVRSTLKENRLVLQGCLLNGEGTESV 3365
            NS   R+++VG+R S LA+ QT  V+  L+   P ++F+++ M   GDK+L+  LS+  + SLFTKELE AL  NEVD VVHSLKD+PTV+   F IG+I  RE+  DAVV       + LE+LPE S++GTSS RR AQL+RK+PHL+F S+RGNL TRL KLD           + Q+F AIILA AGL+R+ W +R+ ++L  E+  YAVGQGAL  E R  D DI  ++  ++D  ++L CIAER+F+  L+ G S P  V + +K+ +L L G + + +G++S+
Sbjct:   14 NSPKMRVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMSTTGDKILDTALSKIGEKSLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRLRKLD-----------EQQEFSAIILATAGLQRMGWHNRVGQILHPEECMYAVGQGALGVEVRAKDQDILDLVGVLHDPETLLRCIAERAFLRHLEGGCSVPVAVHTAMKDGQLYLTGGVWSLDGSDSI 291          
BLAST of Porphobilinogen deaminase vs. UniProt/SwissProt
Match: sp|P22907|HEM3_MOUSE (Porphobilinogen deaminase OS=Mus musculus OX=10090 GN=Hmbs PE=1 SV=2)

HSP 1 Score: 267.314 bits (682), Expect = 7.897e-79
Identity = 135/289 (46.71%), Postives = 194/289 (67.13%), Query Frame = 3
Query: 2499 NSSMKRIVKVGSRMSLLAKTQTQMVIDLLENRNPDMEFQLVTMDKIGDKLLNLKLSQTVDTSLFTKELELALMANEVDFVVHSLKDVPTVISKQFVIGSISARESCDDAVVLRLNSEYQNLESLPEGSMIGTSSARRIAQLKRKYPHLKFSSMRGNLTTRLMKLDDPEKAFQMNKGDNQKFEAIILAKAGLERLAWDHRISEVLSYEDTFYAVGQGALACECRRNDIDIRKILADINDETSMLTCIAERSFICELKVGYSAPFGVRSTLKENRLVLQGCLLNGEGTESV 3365
            N S  R+++VG+R S LA+ QT  V+ +L+   P ++F+++ M   GDK+L+  LS+  + SLFTKELE AL  NEVD VVHSLKDVPT++   F IG+I  RE+  DAVV       + LE+LPE S +GTSS RR+AQL+RK+PHL+F S+RGNL TRL KLD           + Q+F AI+LA AGL+R+ W +R+ ++L  E+  YAVGQGALA E R  D DI  +++ ++D  ++L CIAER+F+  L+ G S P  V + +K+ +L L G + + +G++S+
Sbjct:   14 NGSKMRVIRVGTRKSQLARIQTDTVVAMLKALYPGIQFEIIAMSTTGDKILDTALSKIGEKSLFTKELENALEKNEVDLVVHSLKDVPTILPPGFTIGAICKRENPCDAVVFHPKFIGKTLETLPEKSAVGTSSLRRVAQLQRKFPHLEFKSIRGNLNTRLRKLD-----------ELQEFSAIVLAVAGLQRMGWQNRVGQILHPEECMYAVGQGALAVEVRAKDQDILDLVSVLHDPETLLRCIAERAFLRHLEGGCSVPVAVHTVMKDGQLYLTGGVWSLDGSDSM 291          
BLAST of Porphobilinogen deaminase vs. UniProt/SwissProt
Match: sp|Q2KIN5|HEM3_BOVIN (Porphobilinogen deaminase OS=Bos taurus OX=9913 GN=HMBS PE=2 SV=1)

HSP 1 Score: 263.077 bits (671), Expect = 2.632e-77
Identity = 134/284 (47.18%), Postives = 187/284 (65.85%), Query Frame = 3
Query: 2514 RIVKVGSRMSLLAKTQTQMVIDLLENRNPDMEFQLVTMDKIGDKLLNLKLSQTVDTSLFTKELELALMANEVDFVVHSLKDVPTVISKQFVIGSISARESCDDAVVLRLNSEYQNLESLPEGSMIGTSSARRIAQLKRKYPHLKFSSMRGNLTTRLMKLDDPEKAFQMNKGDNQKFEAIILAKAGLERLAWDHRISEVLSYEDTFYAVGQGALACECRRNDIDIRKILADINDETSMLTCIAERSFICELKVGYSAPFGVRSTLKENRLVLQGCLLNGEGTESV 3365
            R+++VG+R S LA+ QT  V+  L+   P ++F+++ M   GDK+L+  LS+  + SLFTKELE AL  NEVD VVHSLKD+PTV+   F IG++  RES  DAVV       + LE+LPE S++GTSS RR AQL+RK+PHL+F S+RGNL TRL KLD           + Q+F AIILA AGL+R+ W +R+ ++L  E+  YAVGQGAL  E R  D DI  ++  ++D  ++L CIAERSF+  L+ G S P  V + +K+ +L L G + +  G E++
Sbjct:   19 RVIRVGTRKSQLARIQTDSVVATLKALYPGLQFEIIAMSTTGDKILDTALSKIGEKSLFTKELEHALERNEVDLVVHSLKDLPTVLPPGFTIGAVCKRESPYDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFKSIRGNLNTRLRKLD-----------ELQEFSAIILATAGLQRMGWQNRVGQILHPEECMYAVGQGALGVEVRAKDQDILDLVGVLHDPETLLRCIAERSFLRHLEGGCSVPVAVHTAIKDGQLYLTGGVWSLNGAETM 291          
BLAST of Porphobilinogen deaminase vs. UniProt/SwissProt
Match: sp|Q8YVU6|HEM3_NOSS1 (Porphobilinogen deaminase OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=hemC PE=3 SV=2)

HSP 1 Score: 233.802 bits (595), Expect = 2.268e-67
Identity = 118/284 (41.55%), Postives = 180/284 (63.38%), Query Frame = 3
Query: 2502 SSMKRIVKVGSRMSLLAKTQTQMVIDLLENRNPDMEFQLVTMDKIGDKLLNLKLSQTVDTSLFTKELELALMANEVDFVVHSLKDVPTVISKQFVIGSISARESCDDAVVLRLNSEYQNLESLPEGSMIGTSSARRIAQLKRKYPHLKFSSMRGNLTTRLMKLDDPEKAFQMNKGDNQKFEAIILAKAGLERLAWDHRISEVLSYEDTFYAVGQGALACECRRNDIDIRKILADINDETSMLTCIAERSFICELKVGYSAPFGVRSTLKENRLVLQGCLLNGEG 3353
            SS +R +++GSR S LA  QT  V + L+N  PD+ F++ TM   GDK+L++ L++  D  LFTKELE+ ++  E+DF VHSLKD+PT + +   + +I+ RE+  DA+V+  N + + +++LP G++IGTSS RR+AQL+ ++PHL F  +RGNL TRL KLD  E            ++ +ILA AGL+RL    R+ ++L  E + +AVGQGAL  ECR +D ++  +L  I    +   C+AERSF+  L+ G   P GV + +  N L+L G + + +G
Sbjct:    6 SSARRTIRIGSRKSQLALVQTYWVREQLQNSFPDINFEVHTMSTQGDKILDVALAKIGDKGLFTKELEVGMINEEIDFAVHSLKDLPTNLPEGLALAAITERENPADALVVHENFKDKQIDTLPAGAVIGTSSLRRLAQLRNQFPHLTFKDVRGNLNTRLAKLDAGE------------YDGLILAAAGLQRLGMGDRVHQILPKEISLHAVGQGALGIECRADDAELITVLKAIEHPETRDRCLAERSFLRSLEGGCQVPIGVNTEINGNELILTGVVASVDG 277          
BLAST of Porphobilinogen deaminase vs. TrEMBL
Match: A0A2R4LGK7 (Porphobilinogen deaminase OS=Dugesia japonica OX=6161 GN=PBGD PE=2 SV=1)

HSP 1 Score: 467.618 bits (1202), Expect = 1.058e-150
Identity = 230/371 (61.99%), Postives = 289/371 (77.90%), Query Frame = 3
Query: 2493 MNNSSMKRIVKVGSRMSLLAKTQTQMVIDLLENRNPDMEFQLVTMDKIGDKLLNLKLSQTVDTSLFTKELELALMANEVDFVVHSLKDVPTVISKQFVIGSISARESCDDAVVLRLNSEYQNLESLPEGSMIGTSSARRIAQLKRKYPHLKFSSMRGNLTTRLMKLDDPEKAFQMNKGDNQKFEAIILAKAGLERLAWDHRISEVLSYEDTFYAVGQGALACECRRNDIDIRKILADINDETSMLTCIAERSFICELKVGYSAPFGVRSTLKENRLVLQGCLLNGEGTESVIVKSEIDL--VEKSNQFLSKTCNRM-QAANGDSGVRFTGVEIYGIGSLAYSKMEACVELGLQMAANILLGGGDKILKEFK 3596
            M N + KRIV+VGSR S LA TQT M+IDLL  +N D+EF+LV MD IGD +LN+ L +  ++SLFTKELELAL+A+EVDFVVHSLKDVPT IS +F+IGS+S RE+CDDAVV ++NSEY++L SLP GS++GTSS RR AQLK+K+P L+F S+RGNL TRL+KLDDPEKAF+M KGDNQK++AIILAKAGLERL W +RISE LSY+DT YAVGQGALACECR NDI+ RK+LA INDE S+LTCI ER+F+ +L  G S P GVR+ LKEN+L+ QGCL++ +G+ ++  K EI+L    KS+    K  ++  Q  NG S + FTG++IYGI S    K+E C  LG+ +A +IL  GGDKIL E K
Sbjct:    1 MENGNEKRIVRVGSRTSTLAVTQTNMIIDLLREKNNDVEFKLVIMDTIGDTILNMNLYKIGNSSLFTKELELALLADEVDFVVHSLKDVPTSISNEFIIGSVSMRETCDDAVVFKINSEYKSLSSLPNGSIVGTSSVRRTAQLKKKFPQLEFVSIRGNLNTRLLKLDDPEKAFKMRKGDNQKYDAIILAKAGLERLNWAYRISETLSYDDTLYAVGQGALACECRYNDIETRKLLATINDEYSILTCIVERTFLHKLDGGCSTPIGVRTYLKENQLIFQGCLMSLDGSNTITNKIEIELPNTTKSSSEAPKNGHKSNQKMNGVSHLNFTGIDIYGIDSQTKIKIETCAILGVNLANSILFQGGDKILNEIK 371          
BLAST of Porphobilinogen deaminase vs. TrEMBL
Match: A0A183PT84 (Uncharacterized protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS17571 PE=4 SV=1)

HSP 1 Score: 296.204 bits (757), Expect = 2.713e-86
Identity = 171/389 (43.96%), Postives = 241/389 (61.95%), Query Frame = 3
Query: 2493 MNNSSMKRIVKVGSRMSLLAKTQTQMVIDLLENRNPDMEFQLVTMDKIGDKLLNLKLSQTVDTSLFTKELELALMANEVDFVVHSLKDVPTVISKQFVIGSISARESCDDAVVLRLNSEYQNLESLPEGSMIGTSSARRIAQLKRKYPHLKFSSMRGNLTTRLMKLDDPEKAFQMN---KGDNQKFEAIILAKAGLERLAWDHRISEVLSYEDTFYAVGQGALACECRRNDIDIRKILADINDETSMLTCIAERSFICELKVGYSAPFGVRS------TLKENRLVLQGCLLNGEGTESVIVKSEIDLVEKS--NQFLSKTCNRMQAANG----------DSGVRFTGVEIYGIGSLAYSKMEACVELGLQMAANILLGGGDKILKEFK 3596
            M   S + +V+VGSR S LA  QT M ++LL+ +NP + F++V M  +GDK+L++ LS+  D SLFTKELE AL++ EVD VVHSLKDVP+++    V+G + AR S DD V++  +   + L  LP GS IGTS+ RR+A L RKYPHLKF S+RGNL TRL KLD P  A + N      +Q ++AIILAKAG+ER+ W HRI +VL+  D+FYAV QGALACECR+ D  I  +L+ I+DE++ LT IAERS + +L  G S P GVRS       L  ++L L   +L+ +G +SV   + +   +K   N  +  +C  +Q ++G          D+   F GV +     ++  +M     LG  +A ++LL G D+IL E +
Sbjct:    1 MLGPSPRTVVRVGSRRSNLALLQTGMAVNLLQKQNPHVLFEVVEMATVGDKILDVSLSKIGDKSLFTKELENALLSGEVDLVVHSLKDVPSILPSGLVLGCVFARASPDDVVLMAPHYRGRKLSDLPIGSTIGTSAVRRVATLTRKYPHLKFVSIRGNLNTRLAKLDTP-PAPKDNCCLTNPSQSYDAIILAKAGVERMGWSHRIDQVLT--DSFYAVSQGALACECRQIDNFIMNLLSGIHDESAALTTIAERSLMRQLDGGCSIPIGVRSDLVLKGDLNYSQLTLHANILSVDGGKSVERSASVVFPDKVPINDCVESSCKLVQKSSGYDDDELKAALDAASIFMGVLVTPSSEISRLRMAIAQSLGCVVAQSLLLSGADEILYEIR 386          
BLAST of Porphobilinogen deaminase vs. TrEMBL
Match: A0A094ZR90 (Porphobilinogen deaminase OS=Schistosoma haematobium OX=6185 GN=MS3_04981 PE=4 SV=1)

HSP 1 Score: 290.426 bits (742), Expect = 6.877e-84
Identity = 174/410 (42.44%), Postives = 246/410 (60.00%), Query Frame = 3
Query: 2493 MNNSSMKRIVKVGSRMSLLAKTQTQMVIDLLENRNPDMEFQLVTMDKIGDKLLNLKLSQTVDTSLFTKELELALMANEVDFVVHSLKDVPTVISKQFVIGSISARESCDDAVVLRLNSEYQNLESLPEGSMIGTSSARRIAQLKRKYPHLKFSSMRGNLTTRLMKLDDPEKAFQMN---KGDNQKFEAIILAKAGLERLAWDHRISEVLSYEDTFYAVGQGALACECRRNDIDIRKILADINDETSMLTCIAERSFICELKVGYSAPFGVRS------TLKENRLVLQGCLLNGEGTESV----------------IVKSEIDLVEKSNQF-----------------LSKTCNRMQAANGDSGVRFTGVEIYGIGSLAYSKMEACVELGLQMAANILLGGGDKILKEFK 3596
            M   S + +V+VGSR S LA  QT+M ++LL+ +NP + F++V M  +GDK+L++ LS+  D SLFTKELE AL++ EVD VVHSLKDVP+++    V+G + AR S DD V++  +   + L  LP GS IGTS+ RR+A L RKYPHLKF S+RGNL TRL KLD P  A + N      +Q ++AIILAKAG+ER+ W HRI +VL+  D+FYAV QGALACECR+ D  I  +L+ I+DE++ LT IAERS + +L  G S P GVRS       L  ++L L   +L+ +G +SV                 ++S   LV+KS+ +                  S T + ++AA   + + F GV +     ++  +M     LG  +A ++LL G D+IL E +
Sbjct:    1 MLGPSPRTVVRVGSRRSNLALLQTEMAVNLLQKQNPHILFEVVEMATVGDKILDVSLSKIGDKSLFTKELENALLSGEVDLVVHSLKDVPSILPSGLVLGCVFARASPDDVVLMAPHYRGRKLSDLPIGSTIGTSAVRRVATLTRKYPHLKFVSIRGNLNTRLAKLDTP-PASKDNCCLTNPSQSYDAIILAKAGVERMGWSHRIDQVLT--DSFYAVSQGALACECRQIDNFIMNLLSGIHDESAALTTIAERSLMRQLDGGCSIPIGVRSDLVLKGDLNYSQLTLHANILSVDGGKSVERSASVVFPDKMPINDCMESSCKLVQKSSGYDDVSTNTPIIESRGKSLTSPTKDELKAALNAASI-FMGVLVTPSSEISRLRMAIAQSLGCVVAQSLLLSGADEILYEIR 406          
BLAST of Porphobilinogen deaminase vs. TrEMBL
Match: A0A430QIA4 (Hydroxymethylbilane synthase OS=Schistosoma bovis OX=6184 GN=DC041_0002550 PE=4 SV=1)

HSP 1 Score: 289.271 bits (739), Expect = 1.548e-83
Identity = 174/410 (42.44%), Postives = 246/410 (60.00%), Query Frame = 3
Query: 2493 MNNSSMKRIVKVGSRMSLLAKTQTQMVIDLLENRNPDMEFQLVTMDKIGDKLLNLKLSQTVDTSLFTKELELALMANEVDFVVHSLKDVPTVISKQFVIGSISARESCDDAVVLRLNSEYQNLESLPEGSMIGTSSARRIAQLKRKYPHLKFSSMRGNLTTRLMKLDDPEKAFQMN---KGDNQKFEAIILAKAGLERLAWDHRISEVLSYEDTFYAVGQGALACECRRNDIDIRKILADINDETSMLTCIAERSFICELKVGYSAPFGVRS------TLKENRLVLQGCLLNGEGTESV----------------IVKSEIDLVEKSNQF-----------------LSKTCNRMQAANGDSGVRFTGVEIYGIGSLAYSKMEACVELGLQMAANILLGGGDKILKEFK 3596
            M   S + +V+VGSR S LA  QT+M ++LL+ +NP + F++V M  +GDK+L++ LS+  D SLFTKELE AL++ EVD VVHSLKDVP+++    V+G + AR S DD V++  +   + L  LP GS IGTS+ RR+A L RKYPHLKF S+RGNL TRL KLD P  A + N      +Q ++AIILAKAG+ER+ W +RI +VL+  D+FYAV QGALACECR+ D  +  +L+ I+DE++ LT IAERS + +L  G S P GVRS       L  ++L L   +L+ +G +SV                 V+S   LV+KS+ +                  S T + ++AA  D+   F GV +     ++  +M     LG  +A ++LL G D+IL E +
Sbjct:    1 MLGPSPRTVVRVGSRRSNLALLQTEMAVNLLQKQNPHVLFEVVEMATVGDKILDVSLSKIGDKSLFTKELENALLSGEVDLVVHSLKDVPSILPSGLVLGCVFARASPDDVVLMAPHYRGRKLSDLPIGSTIGTSAVRRVATLTRKYPHLKFVSIRGNLNTRLAKLDTP-PASKDNCCLTNPSQSYDAIILAKAGVERMGWSYRIDQVLT--DSFYAVSQGALACECRQIDNFVMNLLSGIHDESAALTTIAERSLMRQLDGGCSIPIGVRSDLVLKGDLNYSQLTLHANILSVDGGKSVERSASVVFPDKMPINDCVESNCKLVQKSSGYDDVSTNTPIIESRGTSPTSPTKDELKAAL-DAASIFMGVLVTPSSEISRLRMAIAQSLGCVVAQSLLLSGADEILYEIR 406          
BLAST of Porphobilinogen deaminase vs. TrEMBL
Match: G4VRL5 (Putative porphobilinogen deaminase OS=Schistosoma mansoni OX=6183 GN=Smp_095130 PE=4 SV=1)

HSP 1 Score: 284.648 bits (727), Expect = 6.088e-82
Identity = 171/409 (41.81%), Postives = 240/409 (58.68%), Query Frame = 3
Query: 2493 MNNSSMKRIVKVGSRMSLLAKTQTQMVIDLLENRNPDMEFQLVTMDKIGDKLLNLKLSQTVDTSLFTKELELALMANEVDFVVHSLKDVPTVISKQFVIGSISARESCDDAVVLRLNSEYQNLESLPEGSMIGTSSARRIAQLKRKYPHLKFSSMRGNLTTRLMKLDDPEKAFQ--MNKGDNQKFEAIILAKAGLERLAWDHRISEVLSYEDTFYAVGQGALACECRRNDIDIRKILADINDETSMLTCIAERSFICELKVGYSAPFGVRS------TLKENRLVLQGCLLNGEGTESV----------------IVKSEIDLVEKSNQF-----------------LSKTCNRMQAANGDSGVRFTGVEIYGIGSLAYSKMEACVELGLQMAANILLGGGDKILKEFK 3596
            M  SS + +V+VGSR S LA  QT M ++LL+ +NP + F++V M  +GDK+L++ LS+  D SLFTKELE AL++ EVD VVHSLKDVP+ +    V+G + AR S +D V++  +   + L  LP GS +GTS+ RR+A L RKYPHLKF S+RGNL TRL KLD P  +     +   +  ++AIILAKAG+ER+ W HRI +VL+  D+FYAV QGALACECR  D  I  +L+ I+DE++ LT IAERS + +L  G S P GVRS       L   +L L   +L+ +G +S+                 V+S   LV+KS  +                  S T + ++AA  D+   F GV +     ++  +M     LG  +A ++LL G D+IL E +
Sbjct:    1 MLGSSPRNVVRVGSRRSNLALLQTGMAVNLLQKQNPHILFEVVEMATVGDKILDVSLSKIGDKSLFTKELENALLSGEVDLVVHSLKDVPSTLPSGLVLGCVFARVSPEDVVLMAPHYRGRKLSDLPIGSTVGTSAVRRVATLTRKYPHLKFVSIRGNLNTRLAKLDTPPASKDNCCSGNPSPSYDAIILAKAGVERMGWSHRIDQVLT--DSFYAVSQGALACECRLVDNFIMDLLSHIHDESAALTTIAERSLMRQLDGGCSIPIGVRSDLVLKGDLNYYQLTLHANILSVDGGKSIERSASVVFPDKMPINDCVESSCKLVQKSGSYDDVSTNTPIIKNKGTSLTSPTKDELKAAL-DATSIFMGVIVTPSSEMSRLRMAIAQSLGCTVAKSLLLSGADEILYEIR 406          
BLAST of Porphobilinogen deaminase vs. Ensembl Cavefish
Match: hmbsb (porphobilinogen deaminase-like [Source:NCBI gene;Acc:103033329])

HSP 1 Score: 265.388 bits (677), Expect = 5.089e-79
Identity = 151/357 (42.30%), Postives = 220/357 (61.62%), Query Frame = 3
Query: 2508 MKRIVKVGSRMSLLAKTQTQMVIDLLENRNPDMEFQLVTMDKIGDKLLNLKLSQTVDTSLFTKELELALMANEVDFVVHSLKDVPTVISKQFVIGSISARESCDDAVVLRLNSEYQNLESLPEGSMIGTSSARRIAQLKRKYPHLKFSSMRGNLTTRLMKLDDPEKAFQMNKGDNQKFEAIILAKAGLERLAWDHRISEVLSYEDTFYAVGQGALACECRRNDIDIRKILADINDETSMLTCIAERSFICELKVGYSAPFGVRSTLKENRLVLQGCLLNGEGTESVIVKSEIDLVEKSNQFLSKTCNRMQAANGDSGVRFTGVEIYGIGSLAYSKMEACVELGLQMAANILLGGGDK 3578
            + R++++G+R S LA+ QT  V + L+   PD+  ++V M   GDK+L+  LS+  + SLFTKELE AL  NEVD VVHSLKD+PT++   F IG++  RES  DAVVL   +  ++L+ LP  S+IGTSS RR AQLK+++PHL+F  +RGNL TRL KLD           +N  F AIILA AGL R+ WD RIS++L  ED  YAVGQGALA E R +D DI ++++ ++D  ++L CIAER+F+  L+ G S P  V + +K ++L L G + + +G++S         ++ + Q    + N+ +    D  V+  GV    +   A    +A  +LG+ + AN+LL  G K
Sbjct:   20 VSRVIRIGTRKSQLARIQTDSVAEKLKELYPDVLLEIVAMSTTGDKILDTALSKIGEKSLFTKELENALERNEVDLVVHSLKDLPTILPVGFTIGAVLKRESPYDAVVLHPKNAGKSLDLLPNKSVIGTSSLRRAAQLKKRFPHLEFKDIRGNLNTRLKKLD-----------ENSDFSAIILAAAGLRRMGWDSRISQILGPEDCMYAVGQGALAIEVRASDQDILEMVSVLHDPDTVLRCIAERAFLRHLEGGCSVPVAVHTEVKNSQLYLTGAVYSLDGSDS---------LKDTMQTTVSSDNQEEQEKVDEKVQRVGVTALKVSGAA---QDAAEKLGVDL-ANLLLSKGAK 352          
BLAST of Porphobilinogen deaminase vs. Ensembl Cavefish
Match: hmbsb (porphobilinogen deaminase-like [Source:NCBI gene;Acc:103033329])

HSP 1 Score: 264.233 bits (674), Expect = 3.975e-78
Identity = 151/357 (42.30%), Postives = 220/357 (61.62%), Query Frame = 3
Query: 2508 MKRIVKVGSRMSLLAKTQTQMVIDLLENRNPDMEFQLVTMDKIGDKLLNLKLSQTVDTSLFTKELELALMANEVDFVVHSLKDVPTVISKQFVIGSISARESCDDAVVLRLNSEYQNLESLPEGSMIGTSSARRIAQLKRKYPHLKFSSMRGNLTTRLMKLDDPEKAFQMNKGDNQKFEAIILAKAGLERLAWDHRISEVLSYEDTFYAVGQGALACECRRNDIDIRKILADINDETSMLTCIAERSFICELKVGYSAPFGVRSTLKENRLVLQGCLLNGEGTESVIVKSEIDLVEKSNQFLSKTCNRMQAANGDSGVRFTGVEIYGIGSLAYSKMEACVELGLQMAANILLGGGDK 3578
            + R++++G+R S LA+ QT  V + L+   PD+  ++V M   GDK+L+  LS+  + SLFTKELE AL  NEVD VVHSLKD+PT++   F IG++  RES  DAVVL   +  ++L+ LP  S+IGTSS RR AQLK+++PHL+F  +RGNL TRL KLD           +N  F AIILA AGL R+ WD RIS++L  ED  YAVGQGALA E R +D DI ++++ ++D  ++L CIAER+F+  L+ G S P  V + +K ++L L G + + +G++S         ++ + Q    + N+ +    D  V+  GV    +   A    +A  +LG+ + AN+LL  G K
Sbjct:   59 VSRVIRIGTRKSQLARIQTDSVAEKLKELYPDVLLEIVAMSTTGDKILDTALSKIGEKSLFTKELENALERNEVDLVVHSLKDLPTILPVGFTIGAVLKRESPYDAVVLHPKNAGKSLDLLPNKSVIGTSSLRRAAQLKKRFPHLEFKDIRGNLNTRLKKLD-----------ENSDFSAIILAAAGLRRMGWDSRISQILGPEDCMYAVGQGALAIEVRASDQDILEMVSVLHDPDTVLRCIAERAFLRHLEGGCSVPVAVHTEVKNSQLYLTGAVYSLDGSDS---------LKDTMQTTVSSDNQEEQEKVDEKVQRVGVTALKVSGAA---QDAAEKLGVDL-ANLLLSKGAK 391          
BLAST of Porphobilinogen deaminase vs. Ensembl Cavefish
Match: hmbsb (porphobilinogen deaminase-like [Source:NCBI gene;Acc:103033329])

HSP 1 Score: 264.233 bits (674), Expect = 3.975e-78
Identity = 151/357 (42.30%), Postives = 220/357 (61.62%), Query Frame = 3
Query: 2508 MKRIVKVGSRMSLLAKTQTQMVIDLLENRNPDMEFQLVTMDKIGDKLLNLKLSQTVDTSLFTKELELALMANEVDFVVHSLKDVPTVISKQFVIGSISARESCDDAVVLRLNSEYQNLESLPEGSMIGTSSARRIAQLKRKYPHLKFSSMRGNLTTRLMKLDDPEKAFQMNKGDNQKFEAIILAKAGLERLAWDHRISEVLSYEDTFYAVGQGALACECRRNDIDIRKILADINDETSMLTCIAERSFICELKVGYSAPFGVRSTLKENRLVLQGCLLNGEGTESVIVKSEIDLVEKSNQFLSKTCNRMQAANGDSGVRFTGVEIYGIGSLAYSKMEACVELGLQMAANILLGGGDK 3578
            + R++++G+R S LA+ QT  V + L+   PD+  ++V M   GDK+L+  LS+  + SLFTKELE AL  NEVD VVHSLKD+PT++   F IG++  RES  DAVVL   +  ++L+ LP  S+IGTSS RR AQLK+++PHL+F  +RGNL TRL KLD           +N  F AIILA AGL R+ WD RIS++L  ED  YAVGQGALA E R +D DI ++++ ++D  ++L CIAER+F+  L+ G S P  V + +K ++L L G + + +G++S         ++ + Q    + N+ +    D  V+  GV    +   A    +A  +LG+ + AN+LL  G K
Sbjct:   59 VSRVIRIGTRKSQLARIQTDSVAEKLKELYPDVLLEIVAMSTTGDKILDTALSKIGEKSLFTKELENALERNEVDLVVHSLKDLPTILPVGFTIGAVLKRESPYDAVVLHPKNAGKSLDLLPNKSVIGTSSLRRAAQLKKRFPHLEFKDIRGNLNTRLKKLD-----------ENSDFSAIILAAAGLRRMGWDSRISQILGPEDCMYAVGQGALAIEVRASDQDILEMVSVLHDPDTVLRCIAERAFLRHLEGGCSVPVAVHTEVKNSQLYLTGAVYSLDGSDS---------LKDTMQTTVSSDNQEEQEKVDEKVQRVGVTALKVSGAA---QDAAEKLGVDL-ANLLLSKGAK 391          
BLAST of Porphobilinogen deaminase vs. Ensembl Cavefish
Match: hmbsa (hydroxymethylbilane synthase [Source:NCBI gene;Acc:103032521])

HSP 1 Score: 236.884 bits (603), Expect = 6.197e-69
Identity = 142/329 (43.16%), Postives = 207/329 (62.92%), Query Frame = 3
Query: 2499 NSSMKRIVKVGSRMSLLAKTQTQMVIDLLENRNPDMEFQLVTMDKIGDKLLNLKLSQTVDTSLFTKELELALMANEVDFVVHSLKDVPTVISKQFVIGSISARESCDDAVVLRLNSEYQNLESLPEGSMIGTSSARRIAQLKRKYPHLKFSSMRGNLTTRLMKLDDPEKAFQMNKGDNQKFEAIILAKAGLERLAWDHRISEVLSYEDTFYAVGQGALACECRRNDIDIRKILADINDETSMLTCIAERSFICELKVGYSAPFGVRSTLKENRLVLQGCLLNGEGTESV--IVKSEIDLVEKSNQFLSKTCNRMQAANGDSGVRFTGVE 3479
            N  + R++++G+R S LA+ QT  V + L+    D++ ++V M  IGDK+L+  LS+  + SLFTKELE AL  NEVD VVHSLKD+PT +   F IG++  RE+  DAVVL   +    L+SLPE S+IGTSS RR AQLK+++P L+F ++RGNL TRL KLD+ E            F AIILA AGL+R+ W+ RIS+VL  ED  YAVGQGALA E R  D DI ++++ ++   ++L CIAER+F+ +L+ G S P  V + +K++ L L G + + +G + +   +++ I+L  K ++   +  N    AN  S    +  E
Sbjct:   12 NGKVTRVIRMGTRKSQLARIQTDSVAEKLKELYADLQLEIVAMSTIGDKILDTALSKIGEKSLFTKELENALERNEVDLVVHSLKDLPTSLPPGFTIGAVLERENPHDAVVLHPKNAGLTLDSLPEKSVIGTSSLRRAAQLKKRFPQLEFENIRGNLNTRLKKLDEKE-----------DFAAIILAAAGLKRMGWESRISQVLGPEDCMYAVGQGALAIEVRARDRDILEMVSILHHPDTVLRCIAERAFLKQLEGGCSVPVAVYTEVKDSVLYLTGAVYSLDGADCLKDTMQTNIELDNKVSESTEEHVNVAITANNISVTALSAAE 329          
BLAST of Porphobilinogen deaminase vs. Ensembl Cavefish
Match: hmbsa (hydroxymethylbilane synthase [Source:NCBI gene;Acc:103032521])

HSP 1 Score: 229.18 bits (583), Expect = 1.403e-66
Identity = 140/320 (43.75%), Postives = 201/320 (62.81%), Query Frame = 3
Query: 2526 VGSRMSLLAKTQTQMVIDLLENRNPDMEFQLVTMDKIGDKLLNLKLSQTVDTSLFTKELELALMANEVDFVVHSLKDVPTVISKQFVIGSISARESCDDAVVLRLNSEYQNLESLPEGSMIGTSSARRIAQLKRKYPHLKFSSMRGNLTTRLMKLDDPEKAFQMNKGDNQKFEAIILAKAGLERLAWDHRISEVLSYEDTFYAVGQGALACECRRNDIDIRKILADINDETSMLTCIAERSFICELKVGYSAPFGVRSTLKENRLVLQGCLLNGEGTESV--IVKSEIDLVEKSNQFLSKTCNRMQAANGDSGVRFTGVE 3479
            +G+R S LA+ QT  V + L+    D++ ++V M  IGDK+L+  LS+  + SLFTKELE AL  NEVD VVHSLKD+PT +   F IG++  RE+  DAVVL   +    L+SLPE S+IGTSS RR AQLK+++P L+F ++RGNL TRL KLD+ E            F AIILA AGL+R+ W+ RIS+VL  ED  YAVGQGALA E R  D DI ++++ ++   ++L CIAER+F+ +L+ G S P  V + +K++ L L G + + +G + +   +++ I+L  K ++   +  N    AN  S    +  E
Sbjct:    1 MGTRKSQLARIQTDSVAEKLKELYADLQLEIVAMSTIGDKILDTALSKIGEKSLFTKELENALERNEVDLVVHSLKDLPTSLPPGFTIGAVLERENPHDAVVLHPKNAGLTLDSLPEKSVIGTSSLRRAAQLKKRFPQLEFENIRGNLNTRLKKLDEKE-----------DFAAIILAAAGLKRMGWESRISQVLGPEDCMYAVGQGALAIEVRARDRDILEMVSILHHPDTVLRCIAERAFLKQLEGGCSVPVAVYTEVKDSVLYLTGAVYSLDGADCLKDTMQTNIELDNKVSESTEEHVNVAITANNISVTALSAAE 309          
BLAST of Porphobilinogen deaminase vs. Ensembl Sea Lamprey
Match: hmbsa (hydroxymethylbilane synthase a [Source:ZFIN;Acc:ZDB-GENE-040426-1375])

HSP 1 Score: 177.948 bits (450), Expect = 5.419e-51
Identity = 93/211 (44.08%), Postives = 130/211 (61.61%), Query Frame = 3
Query: 2727 VDFVVHSLKDVPTVISKQFVIGSISARESCDDAVVLRLNSEYQNLESLPEGSMIGTSSARRIAQLKRKYPHLKFSSMRGNLTTRLMKLDDPEKAFQMNKGDNQKFEAIILAKAGLERLAWDHRISEVLSYEDTFYAVGQGALACECRRNDIDIRKILADINDETSMLTCIAERSFICELKVGYSAPFGVRSTLKENRLVLQGCLLNGEGTE 3359
            VD VVHSLKD+PT +   F +G+I  RE+  DA+VL        LESLP+ S+IGTSS RR AQLKR +PHL F  +RGNL TRL KLD           +  ++ A++LA AGL R+ WD RIS+++      YAVGQGALA E R  D  + ++L+ ++   ++L C+AER+F+  L+ G S P  V S ++   L L G + + +G +
Sbjct:    1 VDLVVHSLKDLPTTLPPGFTVGAILQRENPQDALVLTPQLAGHTLESLPDKSVIGTSSLRRAAQLKRNFPHLAFKDVRGNLNTRLRKLD-----------ELGEYSALVLAAAGLSRMGWDDRISQIIDPGVCLYAVGQGALAVEVRAEDRHVLELLSFLHHRDTVLRCVAERAFLRTLEGGCSVPVAVHSHMEGKELSLTGAVYSLDGAD 200          
BLAST of Porphobilinogen deaminase vs. Ensembl Sea Lamprey
Match: rnf145b (ring finger protein 145b [Source:NCBI gene;Acc:327056])

HSP 1 Score: 123.25 bits (308), Expect = 1.255e-29
Identity = 102/399 (25.56%), Postives = 185/399 (46.37%), Query Frame = 1
Query:  850 GWLEIPSVLWSLFDLSRQFFVFWIGLLITHTIIY-----QEKFDGKPSILIFAAISESVQTPLGLIGFSVASCYASRMILKLIDWLVHVNQ-FNESNNSH-GIAEGFSTLLMMLSLNRSILKVTDTNSDKSINMIDSMEKSSVSPXXXXXXXXXXXXXXXXXXXXXXXXTKLVHLIATASTIQHWHKHIVCLILSLVVFLLPVVICFNIYSFFYFDFWLITIMGSFLMTSVHMLSSFITYCLYLDNARKLRTNRSILPDKCNIDDVISLLNFAVQSIELCIAIGLVILLIARAFSGVWNWVSIVLLFVHFYFNIYERIRNGWVNYHRRKSVMKIIDRMYSVCDVEEISRFEDVCAICFGELSSEDYNGPVKRTVCRHFFHKECLKKWLLIKHSCPMCSR 2025
            GWL +   LW    +   F VFW+ L   H   Y     Q     +  +L+  +++E   +P  L+G +    Y +  +L L  + +   Q F   N  H G+ EG + LL+ +      L+V       +I +   +  +  S                       ++  +V  +  +     W KH   + L L +FL P+ + ++I  FF  DFWL+ I+ S ++TS+ +  +   Y L+L      R   ++       DD+I + N + +++E  +A+G+V    A    G W+W+ + +L VH Y+N++ R ++GW ++ RR+  +  I+ M  +    ++   +DVC+IC+ ++ S         T C H+FH  CL+KWL ++ +CPMC +
Sbjct:  120 GWLALGMSLWHSLVVPMLFMVFWLVLFSLHIYSYVTTRGQAVVRERLLLLLLTSLAECCGSPYSLLGLTFTVSYLALGVLTLGKFYLQGYQAFANDNVMHRGVTEGATLLLLAVQTGLMELQVLQRAFLLTIILFIVVASTLQS--------------------MLEIADPIVLALGASKNRSVW-KHFRAISLCLFLFLFPLYMTYSICRFFTLDFWLLIIVSSSILTSLQVACTLFIYLLFLYEEVVERPLAAL-------DDIIYIANGSCRALEFVVAVGVVGYGTAETLLGEWSWLGVFILAVHAYYNVWRRAQHGWRSFLRRREAVSRINAM-PIATEPQLRALQDVCSICYQDMES------AVLTPCGHYFHAGCLRKWLYLQETCPMCHQ 483          
BLAST of Porphobilinogen deaminase vs. Ensembl Sea Lamprey
Match: zmp:0000000662 (zmp:0000000662 [Source:ZFIN;Acc:ZDB-GENE-130530-665])

HSP 1 Score: 101.293 bits (251), Expect = 2.852e-22
Identity = 85/390 (21.79%), Postives = 171/390 (43.85%), Query Frame = 1
Query:  874 LWSLFDLSRQFFVFWIGLLITHTIIYQEKFDGKPS--ILIFAAISESVQTPLGLIGFSVASCYASRMILKLIDWLVHVNQ--FNESNNSHGIAEGFSTLLMMLSLNRSILKVTDTNSDKSINMIDSMEKSSVSPXXXXXXXXXXXXXXXXXXXXXXXXTKLVHLIATASTIQHWHKHIVCLILSLVVFLLPVVICFNIYSFFYFDFWLITIMGSFLMTSVHMLSSFITYCLYLDNARKLRTNRSILPDKCNIDDVISLLNFAVQSIELCIAIGLVILLIARAFSGVWNWVSIVLLFVHFYFNIYERIRNGWVNYHRRKSVMKIIDRMYSVCDVEEISRFEDVCAICFGELSSEDYNGPVKRTVCRHFFHKECLKKWLLIKHSCPMCSREF 2031
            +W    +   F  FW+   +T T +     D K    +LI  ++++   +P  L+G +    + ++ +L L    +H       +     GI+EG   + +M+++   +L++   +    +++I  +  +S                     ++  +S  ++  +A A     W KH   L + L + L P+ + + I      D WLI I  S ++T++  +SS + Y L+          R   P+   +DDV+  L    + +E   ++GLV+  +     G W+W  + ++  + Y+N+++R   GW +   R+     +  M      + +++  DVC +C+     +D    V  T C H +H  CL+KW  ++ +CPMC R+ 
Sbjct:  217 MWQQLSVPSLFLTFWLVQFMTQTSL--PPLDSKEDNLVLILTSVAKCCGSPYLLLGLTSVVSHVAQSLLSLCRLYLHGFSVLLQQDAVYRGISEG--VMFLMMAMCTGLLELQLVHRAFLLSIILFVVLAST------------------LQSALEISEPVLLNLAAARDKNRW-KHFRALSMCLFLCLFPMFLMWRINLLLPMDSWLILI-SSTVLTALQAMSSIVIYLLF-----SFEEQRDWPPE--FMDDVVYYLQGFCRGLEFLASLGLVVFSLLEWTGGGWSWSGVTVVLAYAYYNLWQRAHAGWRSLKLRRMAGSRVAAMQRASP-QLLAQHGDVCPVCY-----QDMKVAVL-TPCGHMYHPSCLRKWFYVQDTCPMCHRKL 568          
BLAST of Porphobilinogen deaminase vs. Ensembl Sea Lamprey
Match: si:ch1073-392o20.1 (ring finger protein 122 [Source:HGNC Symbol;Acc:HGNC:21147])

HSP 1 Score: 50.8322 bits (120), Expect = 1.770e-8
Identity = 19/49 (38.78%), Postives = 31/49 (63.27%), Query Frame = 1
Query: 1879 EDVCAICFGELSSEDYNGPVKRTVCRHFFHKECLKKWLLIKHSCPMCSR 2025
            E  CA+C  +   +D    +    C+H FH++CL KWL I+++CPMC++
Sbjct:   14 EQTCAVCLEDFREKD---ELAVCPCKHAFHRKCLVKWLEIRNACPMCNK 59          
BLAST of Porphobilinogen deaminase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003380.1 (pep scaffold:Pmarinus_7.0:GL476517:4028:13530:1 gene:ENSPMAG00000003092.1 transcript:ENSPMAT00000003380.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.9878 bits (123), Expect = 2.596e-8
Identity = 20/46 (43.48%), Postives = 29/46 (63.04%), Query Frame = 1
Query: 1882 DVCAICFGELSSEDYNGPVKRTVCRHFFHKECLKKWLLIKHSCPMC 2019
            + CA+C  + + +D  G      CRH FH++CL +WL I+ SCPMC
Sbjct:   31 ETCAVCLEDFTLKDKLGICP---CRHAFHRKCLVRWLEIRKSCPMC 73          
BLAST of Porphobilinogen deaminase vs. Ensembl Yeast
Match: HEM3 (Porphobilinogen deaminase; catalyzes the conversion of 4-porphobilinogen to hydroxymethylbilane, the third step in heme biosynthesis; localizes to the cytoplasm and nucleus; expression is regulated by Hap2p-Hap3p, but not by levels of heme; human homolog HMBS can complement yeast mutant and allow growth of haploid null after sporulation of a heterozygous diploid [Source:SGD;Acc:S000002364])

HSP 1 Score: 219.935 bits (559), Expect = 2.145e-64
Identity = 122/313 (38.98%), Postives = 193/313 (61.66%), Query Frame = 3
Query: 2520 VKVGSRMSLLAKTQTQMVIDLLENRNPDMEFQLVTMDKIGDKLLNLKLSQTVDTSLFTKELELALMANE----VDFVVHSLKDVPTVISKQFVIGSISARESCDDAVVLRLNSEYQNLESLPEGSMIGTSSARRIAQLKRKYPHLKFSSMRGNLTTRLMKLDDPEKAFQMNKGDNQKFEAIILAKAGLERLAWDHRISEVLSYEDTFYAVGQGALACECRRNDIDIRKILADINDETSMLTCIAERSFICELKVGYSAPFGVRSTLKE--NRLVLQGCLLNGEGTESVIVKSEIDLVEKSNQFLSKTCNRMQA 3440
            + +G R S LA  Q+  V+ L+E + PD + ++ T+  +GD++    L      +L+TKELE  L  ++    +D +VHSLKD+PT++ + F +G I+ R    D +V+   S Y++L+ LP+G ++GTSS RR AQLKRKYPHLKF S+RGN+ TRL KLDDP+  +Q           IILA AGL R+  ++RI++    +  ++AVGQGAL  E R+ D  + KIL +I D  + + C++ER+ +  L+ G S P GV S   E   +L+L+  +++ EGTE+  V+ EI+++ ++ +  S  C ++ A
Sbjct:    6 LHIGGRKSKLAVIQSNHVLKLIEEKYPDYDCKVFTLQTLGDQIQFKPLYSFGGKALWTKELEDHLYHDDPSKKLDLIVHSLKDMPTLLPEGFELGGITKRVDPTDCLVMPFYSAYKSLDDLPDGGIVGTSSVRRSAQLKRKYPHLKFESVRGNIQTRLQKLDDPKSPYQ----------CIILASAGLMRMGLENRITQRFHSDTMYHAVGQGALGIEIRKGDTKMMKILDEICDLNATICCLSERALMRTLEGGCSVPIGVESKYNEETKKLLLKAIVVDVEGTEA--VEDEIEMLIENVKEDSMACGKILA 306          
BLAST of Porphobilinogen deaminase vs. Ensembl Nematostella
Match: EDO49103 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGS7])

HSP 1 Score: 122.865 bits (307), Expect = 5.955e-30
Identity = 101/401 (25.19%), Postives = 185/401 (46.13%), Query Frame = 1
Query:  850 GWLEIPSVLWSLFDLSR-QFFVFWIGLLITHTIIYQEKFDGKPSILIFAAISESVQTPLGLIGFSVASCYASRMILKLIDWLVHVN--QFNESNNSHGIAEGFSTLLMMLSLNRSILKVTDTNSDKSINMIDSMEKSSVSPXXXXXXXXXXXXXXXXXXXXXXXXTKLVHLIATASTIQHWHKHIVCLILSLVVFLLPVVICFNIYSFFYFDFWLITIMGSFLMTSVHMLSSFITYCLYLDNARKLRTNRSILPDKCNIDDVISLLNFAVQSIELCIAIGLVILLIARAFSGVWNWVSIVLLFVHFYFNIYERIRNGWVNYHRRKSVMKIIDRMYSVCDVEEISRFEDVCAICFGELSSEDYNGPVKRTVCRHFFHKECLKKWLLIKHSCPMCSREFTESE 2043
            GW+ +  + W+  ++SR   F++WI   +  ++  Q  +        FA+  ES  T   L+  S+     SR IL      +     Q NE+ +  G+ EG +  ++ L +               +    S E S VS       +++ ++ S+L   +  ++  ++ ++      +    H   L++SL + +LP  + + I S F    WL  I+ + L+T V ++ +   Y L++ N  K R+         N+DD +  +N   +  E  +A+G+V        +  W+ V   ++ +H YFN+Y R   GW N+  R S ++ +  + S  + E++    D+C IC+ ++ S       K T C HFFH +CLKKWL +K+ CP+C  + T S+
Sbjct:   15 GWIPLFRLHWNRVEMSRVMVFLWWIKFALRVSMQKQINW-----FWFFASFGESCTTLPNLLAASIVVSEISRSILYHTQLCLKAQPYQINETLHGFGVNEGIAFFILNLQIG--------------LVQGGSKEHSLVS------CLVMFVTLSLLIQDAFDITEPILGMLGVTYAGKFTMAHCRALLVSLTILILPCYLVYVICSTFAAGTWLFVIISNSLVTVVQLIGALSIYGLFVLNVHKERSWE-------NLDDYVYYINAVSKVFEFLVALGVVAYSTWSTVTRDWSLVGTGIICIHAYFNVYSRALEGWNNFLCRLSAVRKVKSLQSATE-EQLRLHNDICPICYEDMKS------AKVTKCLHFFHGKCLKKWLYVKNKCPLCHTDITPSD 376          
BLAST of Porphobilinogen deaminase vs. Ensembl Nematostella
Match: EDO34524 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP29])

HSP 1 Score: 51.2174 bits (121), Expect = 1.972e-6
Identity = 28/96 (29.17%), Postives = 42/96 (43.75%), Query Frame = 1
Query: 1753 HFYFNIYERIRNGWVNYHRR-KSVMKIIDRMYSVCDVEEISRFEDVCAICFGELSSEDYNGPVKRTVCRHFFHKECLKKWLLIKHSCPMCSREFTE 2037
            H ++ I +R+       HR    + K  +  +     EE+ +  D CAIC+      D  G  ++  C H FH  CL+ WL    SCP C +   E
Sbjct:  215 HLFYEIKKRLAR-----HRNFVRIQKCTETRFPEATTEELLQNNDDCAICW------DNMGKARKLPCNHLFHSSCLRAWLENDTSCPTCRKSLAE 299          
BLAST of Porphobilinogen deaminase vs. Ensembl Medaka
Match: hmbsb (hydroxymethylbilane synthase [Source:NCBI gene;Acc:101164176])

HSP 1 Score: 248.054 bits (632), Expect = 5.558e-73
Identity = 138/286 (48.25%), Postives = 190/286 (66.43%), Query Frame = 3
Query: 2508 MKRIVKVGSRMSLLAKTQTQMVIDLLENRNPDMEFQLVTMDKIGDKLLNLKLSQTVDTSLFTKELELALMANEVDFVVHSLKDVPTVISKQFVIGSISARESCDDAVVLRLNSEYQNLESLPEGSMIGTSSARRIAQLKRKYPHLKFSSMRGNLTTRLMKLDDPEKAFQMNKGDNQKFEAIILAKAGLERLAWDHRISEVLSYEDTFYAVGQGALACECRRNDIDIRKILADINDETSMLTCIAERSFICELKVGYSAPFGVRSTLKENRLVLQGCLLNGEGTESV 3365
            + R++++G+R S LA+ QT  V   L+   PD+  ++V M  IGDK+L+  LS+  + SLFTKELE AL  NEVD VVHSLKD+PT +   F IG++  RE+  DAVVL   +  + L SLP+ S++GTSS RR AQLKR++PHL+F  +RGNL TRL KLDD E            F AIILA AGL+R+ W+ RIS VL  ED  YAVGQGALA E R  D DI  +++ ++D  ++L CIAER+F+  L+ G S P  V + +K+++L L G + + +G+ES+
Sbjct:   14 VSRVIRIGTRKSQLARIQTDSVAAKLQELYPDVRLEIVAMSTIGDKILDTALSKIGEKSLFTKELENALERNEVDLVVHSLKDLPTSLPAGFTIGAVLRRENPHDAVVLHPKNAGKTLASLPKNSVVGTSSLRRAAQLKRRFPHLEFKDIRGNLNTRLKKLDDKE-----------DFAAIILAAAGLKRMGWEDRISAVLQPEDCMYAVGQGALAVEVRAKDTDILDMVSVLHDPDTVLRCIAERAFLKRLEGGCSVPVAVHTYIKDSQLYLTGAVYSLDGSESL 288          
BLAST of Porphobilinogen deaminase vs. Ensembl Medaka
Match: hmbsb (hydroxymethylbilane synthase [Source:NCBI gene;Acc:101164176])

HSP 1 Score: 247.669 bits (631), Expect = 9.822e-73
Identity = 138/286 (48.25%), Postives = 190/286 (66.43%), Query Frame = 3
Query: 2508 MKRIVKVGSRMSLLAKTQTQMVIDLLENRNPDMEFQLVTMDKIGDKLLNLKLSQTVDTSLFTKELELALMANEVDFVVHSLKDVPTVISKQFVIGSISARESCDDAVVLRLNSEYQNLESLPEGSMIGTSSARRIAQLKRKYPHLKFSSMRGNLTTRLMKLDDPEKAFQMNKGDNQKFEAIILAKAGLERLAWDHRISEVLSYEDTFYAVGQGALACECRRNDIDIRKILADINDETSMLTCIAERSFICELKVGYSAPFGVRSTLKENRLVLQGCLLNGEGTESV 3365
            + R++++G+R S LA+ QT  V   L+   PD+  ++V M  IGDK+L+  LS+  + SLFTKELE AL  NEVD VVHSLKD+PT +   F IG++  RE+  DAVVL   +  + L SLP+ S++GTSS RR AQLKR++PHL+F  +RGNL TRL KLDD E            F AIILA AGL+R+ W+ RIS VL  ED  YAVGQGALA E R  D DI  +++ ++D  ++L CIAER+F+  L+ G S P  V + +K+++L L G + + +G+ES+
Sbjct:   16 VSRVIRIGTRKSQLARIQTDSVAAKLQELYPDVRLEIVAMSTIGDKILDTALSKIGEKSLFTKELENALERNEVDLVVHSLKDLPTSLPAGFTIGAVLRRENPHDAVVLHPKNAGKTLASLPKNSVVGTSSLRRAAQLKRRFPHLEFKDIRGNLNTRLKKLDDKE-----------DFAAIILAAAGLKRMGWEDRISAVLQPEDCMYAVGQGALAVEVRAKDTDILDMVSVLHDPDTVLRCIAERAFLKRLEGGCSVPVAVHTYIKDSQLYLTGAVYSLDGSESL 290          
BLAST of Porphobilinogen deaminase vs. Ensembl Medaka
Match: hmbsb (hydroxymethylbilane synthase [Source:NCBI gene;Acc:101164176])

HSP 1 Score: 247.669 bits (631), Expect = 9.822e-73
Identity = 138/286 (48.25%), Postives = 190/286 (66.43%), Query Frame = 3
Query: 2508 MKRIVKVGSRMSLLAKTQTQMVIDLLENRNPDMEFQLVTMDKIGDKLLNLKLSQTVDTSLFTKELELALMANEVDFVVHSLKDVPTVISKQFVIGSISARESCDDAVVLRLNSEYQNLESLPEGSMIGTSSARRIAQLKRKYPHLKFSSMRGNLTTRLMKLDDPEKAFQMNKGDNQKFEAIILAKAGLERLAWDHRISEVLSYEDTFYAVGQGALACECRRNDIDIRKILADINDETSMLTCIAERSFICELKVGYSAPFGVRSTLKENRLVLQGCLLNGEGTESV 3365
            + R++++G+R S LA+ QT  V   L+   PD+  ++V M  IGDK+L+  LS+  + SLFTKELE AL  NEVD VVHSLKD+PT +   F IG++  RE+  DAVVL   +  + L SLP+ S++GTSS RR AQLKR++PHL+F  +RGNL TRL KLDD E            F AIILA AGL+R+ W+ RIS VL  ED  YAVGQGALA E R  D DI  +++ ++D  ++L CIAER+F+  L+ G S P  V + +K+++L L G + + +G+ES+
Sbjct:   16 VSRVIRIGTRKSQLARIQTDSVAAKLQELYPDVRLEIVAMSTIGDKILDTALSKIGEKSLFTKELENALERNEVDLVVHSLKDLPTSLPAGFTIGAVLRRENPHDAVVLHPKNAGKTLASLPKNSVVGTSSLRRAAQLKRRFPHLEFKDIRGNLNTRLKKLDDKE-----------DFAAIILAAAGLKRMGWEDRISAVLQPEDCMYAVGQGALAVEVRAKDTDILDMVSVLHDPDTVLRCIAERAFLKRLEGGCSVPVAVHTYIKDSQLYLTGAVYSLDGSESL 290          
BLAST of Porphobilinogen deaminase vs. Ensembl Medaka
Match: hmbsb (hydroxymethylbilane synthase [Source:NCBI gene;Acc:101164176])

HSP 1 Score: 228.409 bits (581), Expect = 4.269e-66
Identity = 141/325 (43.38%), Postives = 200/325 (61.54%), Query Frame = 3
Query: 2508 MKRIVKVGSRMSLLAKTQTQMVIDLLENRNPDMEFQLVTMDKIGDKLLNLKLSQTVDTSLFTKELELALMANEVDFVVHSLKDVPTVISKQFVIGSISARESCDDAVVLRLNSEYQNLESLPEGSMIGTSSARRIAQLKRKYPHLKFSSMRGNLTTRLMKLDDPEKAFQMNKGDNQKFEAIILAKAGLERLAWDHRISEVLSYEDTFYAVGQGALACECRRNDIDIRKILADINDETSMLTCIAERSFICELKVGYSAPFGVRSTLKENRLVLQGCLLNGEGTESVIVKSEIDLVEKSNQFLSKTCNRMQAANGDSGVRFTGVEI 3482
            + R++++G+R S LA+ QT  V   L+   PD+  ++    ++G       LS T + SLFTKELE AL  NEVD VVHSLKD+PT +   F IG++  RE+  DAVVL   +  + L SLP+ S++GTSS RR AQLKR++PHL+F  +RGNL TRL KLDD E            F AIILA AGL+R+ W+ RIS VL  ED  YAVGQGALA E R  D DI  +++ ++D  ++L CIAER+F+  L+ G S P  V + +K+++L L G + + +G+ES+    +   V++  Q +  T  ++ A   D   R  GV++
Sbjct:   16 VSRVIRIGTRKSQLARIQTDSVAAKLQELYPDVRLEIGETFRLG--FCQTTLS-TCNKSLFTKELENALERNEVDLVVHSLKDLPTSLPAGFTIGAVLRRENPHDAVVLHPKNAGKTLASLPKNSVVGTSSLRRAAQLKRRFPHLEFKDIRGNLNTRLKKLDDKE-----------DFAAIILAAAGLKRMGWEDRISAVLQPEDCMYAVGQGALAVEVRAKDTDILDMVSVLHDPDTVLRCIAERAFLKRLEGGCSVPVAVHTYIKDSQLYLTGAVYSLDGSESLKETMQTKEVDERLQRVGVTATKIPADLQDGAERL-GVDL 325          
BLAST of Porphobilinogen deaminase vs. Ensembl Medaka
Match: zmp:0000000662 (RING finger protein 145-like [Source:NCBI gene;Acc:101166429])

HSP 1 Score: 133.265 bits (334), Expect = 2.572e-31
Identity = 112/447 (25.06%), Postives = 208/447 (46.53%), Query Frame = 1
Query:  874 LWSLFDLSRQFFVFWIGLLITH---TIIYQEKFDGKPSI--LIFAAISESVQTPLGLIGFSVASCYASRMILKLIDWLVHVNQF----NESNNSHGIAEGFSTLLM--------MLSLNRS-----ILKVTDTNSDKSINMIDSMEKSSVSPXXXXXXXXXXXXXXXXXXXXXXXXTKLVHLIATASTIQHWHKHIVCLILSLVVFLLPVVICFNIYSFFYFDFWLITIMGSFLMTSVHMLSSFITYCLYLDNARKLRTNRSILPDKCNIDDVISLLNFAVQSIELCIAIGLVILLIARAFSGVWNWVSIVLLFVHFYFNIYERIRNGWVNYHRRKSVMKIIDRMYSVCDVEEISRFEDVCAICFGELSSEDYNGPVKRTVCRHFFHKECLKKWLLIKHSCPMCSREFT-------ESETEINSFMMDNVIINSESDTESVSNNSND 2127
            LW+ + +   F +FW  L        ++  E    +  I  L+  ++SE   TP  L+G +    Y +  +L L  +  ++  F    NE+    G+ EG + LL+        M +L R+     IL +  T++ +S+  I                                  T  + L   AS  +   KHI  L L L + + PV + + I  FF+ DFWL+ ++ S ++TS+ +  + + Y L++      R++    P + ++D+VI  ++   + +E  +A+ +V      +  G W+W+   ++ +H YFN++ R ++GW ++  R++  K I  + +  + +++ + +DVC+ICF ++SS         T C HFFH  CL+KWL ++ +CPMC +          ++E+E NS   D+ + N E+  E V  N  +
Sbjct:  218 LWNQYAVPALFSLFWCVLFTVQLCSDVLSVETSAPQSGIIFLLLTSVSECCATPYSLLGLTFVVSYLALGLLNLCKF--YLGGFAAVQNENVMHRGVTEGVTLLLLALQTGLLDMQALQRTFLLCIILFIVTTSTLQSMIEI----------------------------------TDPIILALGASRNRSVWKHIRGLSLCLFLLVFPVFMAYRISQFFHMDFWLLILVSSCMLTSLQVTGTMLIYLLFM--VELFRSD----PIE-SLDEVIYWVHAVSRVLEFLVALSVVAYGTWESLFGEWSWMGASVIIIHSYFNVWLRAQSGWRSFLLRRAAAKKISSLPAASE-QQLQQHDDVCSICFQDMSS------AVVTSCGHFFHGNCLRKWLYVQETCPMCHQPVQPAPSPQRDTESEQNS---DSPVTN-ETPAEEVPANPPE 610          
BLAST of Porphobilinogen deaminase vs. Planmine SMEST
Match: SMESG000003171.1 (SMESG000003171.1)

HSP 1 Score: 1427.92 bits (3695), Expect = 0.000e+0
Identity = 755/758 (99.60%), Postives = 756/758 (99.74%), Query Frame = 1
Query:   76 MRFGWILRVPSMIYFEWVYESLTLNVTKPESYFVQMMQSMFIVPITDKNVFPSVSFILQFFLSIIAYVAFISVAIFNISVVKRLYIYLIGIILFVMGCNQYRLILLRLNGADGFIDSDNPTVNPKLVISNFDNNSYTGPWNIYWVDFIQFIPTSQFKSASLVLILPLIYCPWLIFVQYFDLMSNQVLALSYGIANLPGLCLALNLPVEAQIFTYNFAVTSFLIGIIYKIVSICVVLPKTLSDFLADVFVVINFNHHAAGWLEIPSVLWSLFDLSRQFFVFWIGLLITHTIIYQEKFDGKPSILIFAAISESVQTPLGLIGFSVASCYASRMILKLIDWLVHVNQFNESNNSHGIAEGFSTLLMMLSLNRSILKVTDTNSDKSINMIDSMEKSSVSPXXXXXXXXXXXXXXXXXXXXXXXXTKLVHLIATASTIQHWHKHIVCLILSLVVFLLPVVICFNIYSFFYFDFWLITIMGSFLMTSVHMLSSFITYCLYLDNARKLRTNRSILPDKCNIDDVISLLNFAVQSIELCIAIGLVILLIARAFSGVWNWVSIVLLFVHFYFNIYERIRNGWVNYHRRKSVMKIIDRMYSVCDVEEISRFEDVCAICFGELSSEDYNGPVKRTVCRHFFHKECLKKWLLIKHSCPMCSREFTESETEINSFMMDNVIINSESDTESVSNNSNDPNNYLVXXXXXXXXIYDDKDIDLKVYQDMNEWETRXXXXXXXXXXXXXXVPDDDSEVEPVEGIVIRRSVANPDL 2349
            MRFGWILRVPSMIYFEWVYESLTLNVTKPESYFVQMMQSMFIVPITDKNVFPSVSFILQFFLSIIAYVAFISVAIFNISVVKRLYIYLIGIILFVMGCNQYRLILLRLNGADGFIDSDNPTVNPKLVISNFDNNSYTGPWNIYWVDFIQFIPTSQFKSASLVLILPLIYCPWLIFVQYFDLMSNQVLALSYGIANLPGLCLALNLPVEAQIFTYNFAVTSFLIGIIYKIVSICVVLPKTLSDFLADVFVVINFNHHAAGWLEIPSVLWSLFDLSRQFFVFWIGLLITHTIIYQEKFDGKPSILIFAAISESVQTPLGLIGFSVASCYASRMILKLIDWLVHVNQFNESNNSHGIAEGFSTLLMMLSLNRSILKVT TNSDKSINMIDSMEKSSVSPIGLIMLVMLIISSSILESASEMLSTKLVHLIATASTIQHWHKHIVCLILSLVVFLLPVVICFNIYSFFYFDFWLITIMGSFLMTSVHMLSSFITYCLYLDNARKLRTNRSILPDKCNIDDVISLLNFAVQSIELCIAIGLVILLIARAFSGVWNWVSIVLLFVHFYFNIYERIRNGWVNYHRRKSVMKIIDRMYSVCDVEEISRFEDVCAICF ELSSEDYNGPVKRTVCRHFFHKECLKKWLLIKHSCPMCSREFTESETEINSFM+DNVIINSESDTESVSNNSNDPNNYLVSSTSSESSIYDDKDIDLKVYQDMNEWETRTNSSSITGNESGSSVPDDDSEVEPVEGIVIRRSVANPDL
Sbjct:    1 MRFGWILRVPSMIYFEWVYESLTLNVTKPESYFVQMMQSMFIVPITDKNVFPSVSFILQFFLSIIAYVAFISVAIFNISVVKRLYIYLIGIILFVMGCNQYRLILLRLNGADGFIDSDNPTVNPKLVISNFDNNSYTGPWNIYWVDFIQFIPTSQFKSASLVLILPLIYCPWLIFVQYFDLMSNQVLALSYGIANLPGLCLALNLPVEAQIFTYNFAVTSFLIGIIYKIVSICVVLPKTLSDFLADVFVVINFNHHAAGWLEIPSVLWSLFDLSRQFFVFWIGLLITHTIIYQEKFDGKPSILIFAAISESVQTPLGLIGFSVASCYASRMILKLIDWLVHVNQFNESNNSHGIAEGFSTLLMMLSLNRSILKVTATNSDKSINMIDSMEKSSVSPIGLIMLVMLIISSSILESASEMLSTKLVHLIATASTIQHWHKHIVCLILSLVVFLLPVVICFNIYSFFYFDFWLITIMGSFLMTSVHMLSSFITYCLYLDNARKLRTNRSILPDKCNIDDVISLLNFAVQSIELCIAIGLVILLIARAFSGVWNWVSIVLLFVHFYFNIYERIRNGWVNYHRRKSVMKIIDRMYSVCDVEEISRFEDVCAICFSELSSEDYNGPVKRTVCRHFFHKECLKKWLLIKHSCPMCSREFTESETEINSFMVDNVIINSESDTESVSNNSNDPNNYLVSSTSSESSIYDDKDIDLKVYQDMNEWETRTNSSSITGNESGSSVPDDDSEVEPVEGIVIRRSVANPDL 758          
BLAST of Porphobilinogen deaminase vs. Planmine SMEST
Match: SMESG000003171.1 (SMESG000003171.1)

HSP 1 Score: 1405.96 bits (3638), Expect = 0.000e+0
Identity = 744/747 (99.60%), Postives = 745/747 (99.73%), Query Frame = 1
Query:  109 MIYFEWVYESLTLNVTKPESYFVQMMQSMFIVPITDKNVFPSVSFILQFFLSIIAYVAFISVAIFNISVVKRLYIYLIGIILFVMGCNQYRLILLRLNGADGFIDSDNPTVNPKLVISNFDNNSYTGPWNIYWVDFIQFIPTSQFKSASLVLILPLIYCPWLIFVQYFDLMSNQVLALSYGIANLPGLCLALNLPVEAQIFTYNFAVTSFLIGIIYKIVSICVVLPKTLSDFLADVFVVINFNHHAAGWLEIPSVLWSLFDLSRQFFVFWIGLLITHTIIYQEKFDGKPSILIFAAISESVQTPLGLIGFSVASCYASRMILKLIDWLVHVNQFNESNNSHGIAEGFSTLLMMLSLNRSILKVTDTNSDKSINMIDSMEKSSVSPXXXXXXXXXXXXXXXXXXXXXXXXTKLVHLIATASTIQHWHKHIVCLILSLVVFLLPVVICFNIYSFFYFDFWLITIMGSFLMTSVHMLSSFITYCLYLDNARKLRTNRSILPDKCNIDDVISLLNFAVQSIELCIAIGLVILLIARAFSGVWNWVSIVLLFVHFYFNIYERIRNGWVNYHRRKSVMKIIDRMYSVCDVEEISRFEDVCAICFGELSSEDYNGPVKRTVCRHFFHKECLKKWLLIKHSCPMCSREFTESETEINSFMMDNVIINSESDTESVSNNSNDPNNYLVXXXXXXXXIYDDKDIDLKVYQDMNEWETRXXXXXXXXXXXXXXVPDDDSEVEPVEGIVIRRSVANPDL 2349
            MIYFEWVYESLTLNVTKPESYFVQMMQSMFIVPITDKNVFPSVSFILQFFLSIIAYVAFISVAIFNISVVKRLYIYLIGIILFVMGCNQYRLILLRLNGADGFIDSDNPTVNPKLVISNFDNNSYTGPWNIYWVDFIQFIPTSQFKSASLVLILPLIYCPWLIFVQYFDLMSNQVLALSYGIANLPGLCLALNLPVEAQIFTYNFAVTSFLIGIIYKIVSICVVLPKTLSDFLADVFVVINFNHHAAGWLEIPSVLWSLFDLSRQFFVFWIGLLITHTIIYQEKFDGKPSILIFAAISESVQTPLGLIGFSVASCYASRMILKLIDWLVHVNQFNESNNSHGIAEGFSTLLMMLSLNRSILKVT TNSDKSINMIDSMEKSSVSPIGLIMLVMLIISSSILESASEMLSTKLVHLIATASTIQHWHKHIVCLILSLVVFLLPVVICFNIYSFFYFDFWLITIMGSFLMTSVHMLSSFITYCLYLDNARKLRTNRSILPDKCNIDDVISLLNFAVQSIELCIAIGLVILLIARAFSGVWNWVSIVLLFVHFYFNIYERIRNGWVNYHRRKSVMKIIDRMYSVCDVEEISRFEDVCAICF ELSSEDYNGPVKRTVCRHFFHKECLKKWLLIKHSCPMCSREFTESETEINSFM+DNVIINSESDTESVSNNSNDPNNYLVSSTSSESSIYDDKDIDLKVYQDMNEWETRTNSSSITGNESGSSVPDDDSEVEPVEGIVIRRSVANPDL
Sbjct:    1 MIYFEWVYESLTLNVTKPESYFVQMMQSMFIVPITDKNVFPSVSFILQFFLSIIAYVAFISVAIFNISVVKRLYIYLIGIILFVMGCNQYRLILLRLNGADGFIDSDNPTVNPKLVISNFDNNSYTGPWNIYWVDFIQFIPTSQFKSASLVLILPLIYCPWLIFVQYFDLMSNQVLALSYGIANLPGLCLALNLPVEAQIFTYNFAVTSFLIGIIYKIVSICVVLPKTLSDFLADVFVVINFNHHAAGWLEIPSVLWSLFDLSRQFFVFWIGLLITHTIIYQEKFDGKPSILIFAAISESVQTPLGLIGFSVASCYASRMILKLIDWLVHVNQFNESNNSHGIAEGFSTLLMMLSLNRSILKVTATNSDKSINMIDSMEKSSVSPIGLIMLVMLIISSSILESASEMLSTKLVHLIATASTIQHWHKHIVCLILSLVVFLLPVVICFNIYSFFYFDFWLITIMGSFLMTSVHMLSSFITYCLYLDNARKLRTNRSILPDKCNIDDVISLLNFAVQSIELCIAIGLVILLIARAFSGVWNWVSIVLLFVHFYFNIYERIRNGWVNYHRRKSVMKIIDRMYSVCDVEEISRFEDVCAICFSELSSEDYNGPVKRTVCRHFFHKECLKKWLLIKHSCPMCSREFTESETEINSFMVDNVIINSESDTESVSNNSNDPNNYLVSSTSSESSIYDDKDIDLKVYQDMNEWETRTNSSSITGNESGSSVPDDDSEVEPVEGIVIRRSVANPDL 747          
BLAST of Porphobilinogen deaminase vs. Planmine SMEST
Match: SMESG000071507.1 (SMESG000071507.1)

HSP 1 Score: 773.467 bits (1996), Expect = 0.000e+0
Identity = 376/377 (99.73%), Postives = 377/377 (100.00%), Query Frame = 3
Query: 2493 MNNSSMKRIVKVGSRMSLLAKTQTQMVIDLLENRNPDMEFQLVTMDKIGDKLLNLKLSQTVDTSLFTKELELALMANEVDFVVHSLKDVPTVISKQFVIGSISARESCDDAVVLRLNSEYQNLESLPEGSMIGTSSARRIAQLKRKYPHLKFSSMRGNLTTRLMKLDDPEKAFQMNKGDNQKFEAIILAKAGLERLAWDHRISEVLSYEDTFYAVGQGALACECRRNDIDIRKILADINDETSMLTCIAERSFICELKVGYSAPFGVRSTLKENRLVLQGCLLNGEGTESVIVKSEIDLVEKSNQFLSKTCNRMQAANGDSGVRFTGVEIYGIGSLAYSKMEACVELGLQMAANILLGGGDKILKEFKPIRVKPATN 3623
            MNNSSMKRIVKVGSRMSLLAKTQTQMVIDLLENRNPDMEFQLVTMDKIGDKLLNLKLSQTVDTSLFTKELELALMANEVDFVVHSLKDVPTVISKQFVIGSISARESCDDAVVLRLNSEYQNLESLPEGSMIGTSSARRIAQLKRKYPHLKFSSMRGNLTTRLMKLDDPEKAFQMNKGDNQKFEAIILAKAGLERLAWDHRISEVLSYEDTFYAVGQGALACECRRNDIDIRK+LADINDETSMLTCIAERSFICELKVGYSAPFGVRSTLKENRLVLQGCLLNGEGTESVIVKSEIDLVEKSNQFLSKTCNRMQAANGDSGVRFTGVEIYGIGSLAYSKMEACVELGLQMAANILLGGGDKILKEFKPIRVKPATN
Sbjct:    1 MNNSSMKRIVKVGSRMSLLAKTQTQMVIDLLENRNPDMEFQLVTMDKIGDKLLNLKLSQTVDTSLFTKELELALMANEVDFVVHSLKDVPTVISKQFVIGSISARESCDDAVVLRLNSEYQNLESLPEGSMIGTSSARRIAQLKRKYPHLKFSSMRGNLTTRLMKLDDPEKAFQMNKGDNQKFEAIILAKAGLERLAWDHRISEVLSYEDTFYAVGQGALACECRRNDIDIRKLLADINDETSMLTCIAERSFICELKVGYSAPFGVRSTLKENRLVLQGCLLNGEGTESVIVKSEIDLVEKSNQFLSKTCNRMQAANGDSGVRFTGVEIYGIGSLAYSKMEACVELGLQMAANILLGGGDKILKEFKPIRVKPATN 377          
BLAST of Porphobilinogen deaminase vs. Planmine SMEST
Match: SMESG000024741.1 (SMESG000024741.1)

HSP 1 Score: 553.518 bits (1425), Expect = 0.000e+0
Identity = 276/380 (72.63%), Postives = 322/380 (84.74%), Query Frame = 3
Query: 2493 MNNSSMKRIVKVGSRMSLLAKTQTQMVIDLLENRNPDMEFQLVTMDKIGDKLLNLKLSQTVDTSLFTKELELALMANEVDFVVHSLKDVPTVISKQFVIGSISARESCDDAVVLRLNSEYQNLESLPEGSMIGTSSARRIAQLKRKYPHLKFSSMRGNLTTRLMKLDDPEKAFQMNKGDNQKFEAIILAKAGLERLAWDHRISEVLSYEDTFYAVGQGALACECRRNDIDIRKILADINDETSMLTCIAERSFICELKVGYSAPFGVRSTLKENRLVLQGCLLNGEGTESVIVKSEIDLVEKSN---QFLSKTCNRMQAANGDSGVRFTGVEIYGIGSLAYSKMEACVELGLQMAANILLGGGDKILKEFKPIRVKPATN 3623
            M +   KRIV+VGSR SLLA TQT M+IDLL+N+NPD+EF+L+TMD +GDK+LN KL Q  DT+LFTKELELAL+ NEVDFVVHSLKDVPT++SKQFVIGSIS RESCDDAVVL+LNS+Y+NLESLPEGS+IGTSS RRI+QLKRKYPHLKFSS+RGNL TRL+KLDDPEKAFQMNKGDNQK+EAIILAKAGLERL W+HRISEVLSYEDTFYAVGQGALACECRRNDI++RKILA INDE SMLTC+AER+F+ EL+ G S P GVRST KEN+ +L+GCLLN EG+ESV VK EIDL E      Q L+   N+    NGDS   +TG+EIYG+  +AYS+++AC++LGLQ+A N LL GGDKIL E K  R+K  TN
Sbjct:    1 MESELTKRIVRVGSRTSLLAMTQTHMIIDLLKNKNPDIEFRLITMDTMGDKILNTKLYQIGDTALFTKELELALLENEVDFVVHSLKDVPTIMSKQFVIGSISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHLKFSSIRGNLNTRLLKLDDPEKAFQMNKGDNQKYEAIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAERAFMHELEGGCSTPIGVRSTFKENKFILKGCLLNLEGSESVFVKDEIDLPEYEKRLVQSLTNGHNKTSMINGDSDTTYTGIEIYGLNPVAYSRIKACIKLGLQLATNTLLNGGDKILNEIKFNRLKSGTN 380          
BLAST of Porphobilinogen deaminase vs. Planmine SMEST
Match: SMESG000024670.1 (SMESG000024670.1)

HSP 1 Score: 307.76 bits (787), Expect = 1.125e-93
Identity = 179/389 (46.02%), Postives = 239/389 (61.44%), Query Frame = 3
Query: 2505 SMKRIVKVGSRMSLLAKTQTQMVIDLLENRNPDMEFQLVTMDKIGDKLLNLKLSQTVDTSLFTKELELALMANEVDFVVHSLKDVPTVISKQFVIGSISARESCDDAVVLRLNSEYQNLESLPEGSMIGTSSARRIAQLKRKYPHLKFSSMRGNLTTRLMKLDDPEKAFQMNKGDNQKFEAIILAKAGLERLAWDHRISEVLSYEDTFYAVGQGALACECRRNDIDIRKILADINDETSMLTCIAERSFICELKVGYSAPFGVRSTL-KENRLVLQGCLLNGEGTESVIVKSEIDLVEKSNQ-FL----------------SKTCNRMQAANG-----------DSGVRFTGVEIYGIGSLAYSKMEACVELGLQMAANILLGGGDKIL 3584
            S +R +++GSR S LA  QT ++++LL   + +++F++VTMD IGD +L+ +LS+  D SLFTKELELALMA EVDFVVHSLKDVPT +S +FVIG I  RES +DAVV++ NS Y+ LE LP  S++GTSS RRIAQLK +Y HLKFSS+RGNL TRL KLD          GD   + A+ILAKAGLER+    RIS+VLS+E + YAVGQGALACECR +D+   K+L+ I+D+ S +T IAERS +  L  G S P  VRS + K+  L L+  ++N +GTE +  +    L E+  Q FL                SK     Q+  G           D    F G  ++ I  +   +M     LG ++A  +L  G  +IL
Sbjct:    8 SNRRTIRIGSRTSELALKQTHLIMNLLSKAHSEIDFKVVTMDTIGDIILDKELSKIGDKSLFTKELELALMAKEVDFVVHSLKDVPTALSDEFVIGCICLRESPEDAVVMKKNSIYKTLEELPTDSVVGTSSVRRIAQLKNRYSHLKFSSVRGNLNTRLKKLDAISIEEISGTGDVPSYSALILAKAGLERIGLSFRISQVLSHEGSLYAVGQGALACECRADDLSTLKLLSSIHDDESGITSIAERSLMRYLDGGCSTPIAVRSKVNKDGSLTLRAAVMNTDGTECISDEMTTRLPEEHIQEFLEKINSSESETEDNCPPSKKMKTNQSNYGEITEKEILLGKDPNSIFLGTRVFPICEIGRMRMAISQRLGAEVARRLLAAGAKQIL 396          
The following BLAST results are available for this feature:
BLAST of Porphobilinogen deaminase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HMBS2.328e-8046.71hydroxymethylbilane synthase [Source:HGNC Symbol;A... [more]
HMBS2.573e-7946.83hydroxymethylbilane synthase [Source:HGNC Symbol;A... [more]
HMBS2.573e-7946.83hydroxymethylbilane synthase [Source:HGNC Symbol;A... [more]
HMBS2.573e-7946.83hydroxymethylbilane synthase [Source:HGNC Symbol;A... [more]
HMBS2.951e-7646.37hydroxymethylbilane synthase [Source:HGNC Symbol;A... [more]
back to top
BLAST of Porphobilinogen deaminase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rnf-1455.308e-1725.59RiNg Finger protein [Source:UniProtKB/TrEMBL;Acc:... [more]
sel-115.858e-622.94E3 ubiquitin-protein ligase hrd-1 [Source:UniProt... [more]
toe-47.284e-641.07Target Of ERK kinase MPK-1 [Source:UniProtKB/TrEM... [more]
back to top
BLAST of Porphobilinogen deaminase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
l(3)026408.227e-6546.89gene:FBgn0010786 transcript:FBtr0072679[more]
Trc86.548e-2129.63gene:FBgn0039668 transcript:FBtr0085432[more]
Trc85.585e-2030.23gene:FBgn0039668 transcript:FBtr0333188[more]
Trc85.585e-2030.23gene:FBgn0039668 transcript:FBtr0085430[more]
Trc85.585e-2030.23gene:FBgn0039668 transcript:FBtr0085429[more]
back to top
BLAST of Porphobilinogen deaminase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hmbsb1.109e-8047.59hydroxymethylbilane synthase, b [Source:ZFIN;Acc:Z... [more]
hmbsb4.263e-7849.26hydroxymethylbilane synthase, b [Source:ZFIN;Acc:Z... [more]
hmbsa6.569e-7142.27hydroxymethylbilane synthase a [Source:ZFIN;Acc:ZD... [more]
hmbsa7.687e-7142.27hydroxymethylbilane synthase a [Source:ZFIN;Acc:ZD... [more]
hmbsb1.235e-6750.87hydroxymethylbilane synthase, b [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Porphobilinogen deaminase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
neurl1b4.874e-7841.85neuralized E3 ubiquitin protein ligase 1B [Source:... [more]
neurl1b6.800e-7841.85neuralized E3 ubiquitin protein ligase 1B [Source:... [more]
neurl1b1.884e-6640.88neuralized E3 ubiquitin protein ligase 1B [Source:... [more]
neurl1b9.697e-6342.19neuralized E3 ubiquitin protein ligase 1B [Source:... [more]
neurl1b2.259e-6242.28neuralized E3 ubiquitin protein ligase 1B [Source:... [more]
back to top
BLAST of Porphobilinogen deaminase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hmbs1.129e-7946.71hydroxymethylbilane synthase [Source:MGI Symbol;Ac... [more]
Hmbs1.021e-7846.83hydroxymethylbilane synthase [Source:MGI Symbol;Ac... [more]
Rnf1451.378e-2625.06ring finger protein 145 [Source:MGI Symbol;Acc:MGI... [more]
Hmbs1.140e-2242.06hydroxymethylbilane synthase [Source:MGI Symbol;Ac... [more]
Rnf1391.033e-2125.57ring finger protein 139 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Porphobilinogen deaminase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P19356|HEM3_RAT1.022e-7947.06Porphobilinogen deaminase OS=Rattus norvegicus OX=... [more]
sp|P08397|HEM3_HUMAN1.118e-7946.71Porphobilinogen deaminase OS=Homo sapiens OX=9606 ... [more]
sp|P22907|HEM3_MOUSE7.897e-7946.71Porphobilinogen deaminase OS=Mus musculus OX=10090... [more]
sp|Q2KIN5|HEM3_BOVIN2.632e-7747.18Porphobilinogen deaminase OS=Bos taurus OX=9913 GN... [more]
sp|Q8YVU6|HEM3_NOSS12.268e-6741.55Porphobilinogen deaminase OS=Nostoc sp. (strain PC... [more]
back to top
BLAST of Porphobilinogen deaminase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2R4LGK71.058e-15061.99Porphobilinogen deaminase OS=Dugesia japonica OX=6... [more]
A0A183PT842.713e-8643.96Uncharacterized protein OS=Schistosoma mattheei OX... [more]
A0A094ZR906.877e-8442.44Porphobilinogen deaminase OS=Schistosoma haematobi... [more]
A0A430QIA41.548e-8342.44Hydroxymethylbilane synthase OS=Schistosoma bovis ... [more]
G4VRL56.088e-8241.81Putative porphobilinogen deaminase OS=Schistosoma ... [more]
back to top
BLAST of Porphobilinogen deaminase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hmbsb5.089e-7942.30porphobilinogen deaminase-like [Source:NCBI gene;A... [more]
hmbsb3.975e-7842.30porphobilinogen deaminase-like [Source:NCBI gene;A... [more]
hmbsb3.975e-7842.30porphobilinogen deaminase-like [Source:NCBI gene;A... [more]
hmbsa6.197e-6943.16hydroxymethylbilane synthase [Source:NCBI gene;Acc... [more]
hmbsa1.403e-6643.75hydroxymethylbilane synthase [Source:NCBI gene;Acc... [more]
back to top
BLAST of Porphobilinogen deaminase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hmbsa5.419e-5144.08hydroxymethylbilane synthase a [Source:ZFIN;Acc:ZD... [more]
rnf145b1.255e-2925.56ring finger protein 145b [Source:NCBI gene;Acc:327... [more]
zmp:00000006622.852e-2221.79zmp:0000000662 [Source:ZFIN;Acc:ZDB-GENE-130530-66... [more]
si:ch1073-392o20.11.770e-838.78ring finger protein 122 [Source:HGNC Symbol;Acc:HG... [more]
ENSPMAT00000003380.12.596e-843.48pep scaffold:Pmarinus_7.0:GL476517:4028:13530:1 ge... [more]
back to top
BLAST of Porphobilinogen deaminase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
HEM32.145e-6438.98Porphobilinogen deaminase; catalyzes the conversio... [more]
back to top
BLAST of Porphobilinogen deaminase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO491035.955e-3025.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO345241.972e-629.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Porphobilinogen deaminase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hmbsb5.558e-7348.25hydroxymethylbilane synthase [Source:NCBI gene;Acc... [more]
hmbsb9.822e-7348.25hydroxymethylbilane synthase [Source:NCBI gene;Acc... [more]
hmbsb9.822e-7348.25hydroxymethylbilane synthase [Source:NCBI gene;Acc... [more]
hmbsb4.269e-6643.38hydroxymethylbilane synthase [Source:NCBI gene;Acc... [more]
zmp:00000006622.572e-3125.06RING finger protein 145-like [Source:NCBI gene;Acc... [more]
back to top
BLAST of Porphobilinogen deaminase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000003171.10.000e+099.60SMESG000003171.1[more]
SMESG000003171.10.000e+099.60SMESG000003171.1[more]
SMESG000071507.10.000e+099.73SMESG000071507.1[more]
SMESG000024741.10.000e+072.63SMESG000024741.1[more]
SMESG000024670.11.125e-9346.02SMESG000024670.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016690 ID=SMED30016690|Name=Porphobilinogen deaminase|organism=Schmidtea mediterranea sexual|type=transcript|length=3678bp
GTTGAACTGAATCGTAATTTAAAATAAAATTAGAAAATTATTATTATTTT
TTTATAAATATTTCTTACTAAAAGTATGCGATTTGGATGGATTTTACGAG
TACCGTCAATGATTTATTTTGAATGGGTATATGAAAGTTTAACATTAAAT
GTTACTAAACCAGAGAGTTATTTTGTACAAATGATGCAGTCGATGTTTAT
AGTTCCAATTACAGATAAGAATGTTTTCCCATCGGTATCTTTCATACTGC
AATTTTTTCTTTCAATTATCGCTTACGTGGCATTCATATCAGTGGCTATT
TTCAACATCAGTGTCGTTAAGAGACTGTATATTTATTTAATCGGAATTAT
CCTATTCGTGATGGGTTGCAATCAATATCGATTGATTTTGCTGAGATTGA
ATGGAGCAGATGGGTTTATCGACTCTGATAATCCGACTGTCAATCCGAAA
TTAGTGATTTCCAATTTCGATAACAATTCATACACTGGCCCATGGAATAT
ATATTGGGTGGACTTTATACAGTTTATTCCGACTTCCCAATTTAAAAGTG
CCTCGCTTGTATTGATTTTACCTCTGATTTATTGTCCGTGGTTGATATTT
GTTCAATATTTCGATTTAATGTCCAATCAAGTTTTGGCTTTATCCTATGG
TATTGCTAATCTTCCAGGATTATGTTTAGCTCTCAATTTACCAGTCGAAG
CCCAAATTTTCACCTACAATTTCGCTGTGACCAGCTTTCTAATCGGAATA
ATTTACAAAATCGTCAGTATTTGTGTGGTTCTGCCGAAAACTTTATCTGA
TTTTTTAGCAGATGTTTTTGTAGTCATAAATTTCAATCATCACGCTGCCG
GTTGGTTGGAAATTCCATCAGTTTTATGGTCGCTTTTTGATTTGTCGAGA
CAATTTTTTGTGTTTTGGATTGGTCTATTGATTACACACACAATCATCTA
CCAGGAGAAATTCGATGGCAAGCCATCGATTTTGATTTTCGCAGCAATCA
GTGAATCAGTTCAAACTCCATTGGGTTTAATTGGGTTTTCTGTTGCCAGT
TGTTACGCTTCGAGAATGATTTTGAAACTGATTGATTGGCTAGTCCATGT
CAATCAATTCAATGAAAGCAATAACTCACACGGAATCGCCGAAGGTTTCT
CAACTCTTCTTATGATGCTCTCTTTGAATCGATCAATTCTCAAAGTAACA
GACACAAATTCCGATAAATCAATAAACATGATCGATTCCATGGAGAAATC
AAGTGTTTCTCCAATAGGATTAATCATGCTCGTTATGCTAATCATTTCTT
CATCGATTCTCGAATCTGCCAGTGAAATGCTCTCAACGAAACTTGTTCAT
TTAATCGCCACTGCCTCAACTATTCAACACTGGCATAAACATATTGTTTG
TCTCATTCTCAGCCTGGTGGTGTTTCTTCTACCGGTTGTAATCTGTTTCA
ATATCTACTCTTTCTTTTACTTCGATTTTTGGTTGATTACAATAATGGGC
AGCTTCCTGATGACCAGTGTGCACATGCTCAGCTCCTTTATCACCTACTG
TCTTTATCTGGATAATGCTCGCAAATTGAGAACGAATCGGTCGATTCTTC
CCGATAAATGCAACATTGACGATGTTATTAGTTTGCTGAATTTCGCTGTG
CAATCGATTGAACTATGCATTGCTATCGGACTGGTTATTCTTTTAATAGC
TCGGGCATTTTCTGGAGTTTGGAACTGGGTGAGTATCGTTTTGCTTTTCG
TCCATTTCTATTTCAATATCTACGAACGGATTCGCAATGGATGGGTGAAT
TATCATCGGAGGAAATCTGTGATGAAGATTATTGATCGAATGTATTCTGT
GTGTGATGTTGAGGAGATCAGCCGATTTGAAGATGTTTGCGCGATATGTT
TCGGTGAGCTTTCATCAGAGGATTATAATGGGCCTGTCAAGCGGACAGTT
TGTCGACATTTCTTCCATAAAGAGTGTTTGAAGAAATGGCTATTGATAAA
GCATTCCTGTCCAATGTGTTCGAGGGAGTTTACGGAATCCGAAACGGAAA
TAAACTCCTTCATGATGGATAATGTGATAATCAATTCCGAATCCGATACA
GAATCAGTAAGCAACAATTCAAATGATCCAAACAACTATCTGGTTTCATC
TACGTCGTCAGAATCCTCGATTTACGATGATAAAGACATCGATCTTAAAG
TATATCAGGACATGAATGAATGGGAGACTCGTACTAATAGTAGCAGTATC
ACTGGTAATGAGTCCGGTTCATCTGTGCCTGATGACGATAGCGAAGTCGA
GCCAGTGGAAGGAATTGTTATTAGACGCTCGGTAGCTAACCCTGATTTGT
AGAATACTGCCAAATTTTGTATGATATATATCTGTCTATCCATTACACTG
CCATGTCCTCAAGAGTTTAATTCAATTATTTATTATTTATACATTTATAT
ATATATATATATATATTTGTTTTCATTTAGAAAAATCGTTAGATGAATAA
CAGTTCCATGAAAAGAATAGTCAAAGTCGGCTCACGAATGAGCCTCCTAG
CAAAGACGCAGACCCAAATGGTGATCGACTTGCTTGAGAATAGAAATCCT
GACATGGAATTTCAATTAGTTACAATGGATAAGATTGGGGACAAGTTATT
AAACTTGAAGCTGTCCCAAACCGTAGACACTTCTTTATTTACGAAAGAAT
TAGAGTTGGCGTTAATGGCAAATGAAGTCGACTTCGTAGTTCACTCTCTA
AAAGATGTTCCAACGGTTATATCCAAACAATTTGTCATTGGATCAATTTC
CGCGCGAGAGAGTTGCGATGATGCCGTGGTTCTACGATTGAATTCTGAAT
ATCAAAATCTCGAAAGTCTTCCAGAAGGATCAATGATTGGAACTAGTTCA
GCGAGAAGAATTGCCCAACTGAAAAGAAAATATCCACATTTAAAGTTCTC
ATCGATGCGTGGTAATCTGACTACTCGACTAATGAAATTGGATGATCCGG
AGAAAGCGTTTCAGATGAATAAGGGAGATAATCAGAAGTTTGAAGCTATT
ATTTTAGCCAAAGCAGGACTAGAAAGATTAGCGTGGGATCATAGAATTTC
TGAGGTTTTGTCTTATGAAGATACATTCTATGCCGTCGGTCAAGGAGCAT
TGGCGTGCGAGTGTAGACGTAACGACATTGACATAAGAAAAATACTAGCA
GACATTAATGACGAAACCTCAATGCTCACGTGCATAGCTGAAAGATCATT
TATATGTGAATTAAAAGTTGGCTACAGTGCACCTTTTGGTGTGAGATCAA
CGTTAAAAGAAAATAGATTGGTTTTGCAGGGCTGTTTGTTGAATGGCGAA
GGCACTGAATCGGTCATTGTGAAAAGTGAAATAGATCTAGTTGAGAAAAG
CAATCAGTTTCTTTCAAAGACTTGTAACAGAATGCAGGCGGCAAATGGTG
ATTCTGGTGTAAGGTTTACAGGAGTCGAAATTTATGGAATTGGTTCACTT
GCGTACAGTAAAATGGAAGCCTGTGTTGAGCTTGGACTTCAAATGGCAGC
AAATATTCTTCTCGGTGGAGGAGACAAAATCCTAAAGGAATTCAAACCAA
TTCGGGTTAAACCTGCCACAAATTGAGTGCAAATAATTCCGAATAATTTT
TACACTTCAATAAAGCTTAATAGTTCCG
back to top

protein sequence of SMED30016690-orf-1

>SMED30016690-orf-1 ID=SMED30016690-orf-1|Name=SMED30016690-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=378bp
MNNSSMKRIVKVGSRMSLLAKTQTQMVIDLLENRNPDMEFQLVTMDKIGD
KLLNLKLSQTVDTSLFTKELELALMANEVDFVVHSLKDVPTVISKQFVIG
SISARESCDDAVVLRLNSEYQNLESLPEGSMIGTSSARRIAQLKRKYPHL
KFSSMRGNLTTRLMKLDDPEKAFQMNKGDNQKFEAIILAKAGLERLAWDH
RISEVLSYEDTFYAVGQGALACECRRNDIDIRKILADINDETSMLTCIAE
RSFICELKVGYSAPFGVRSTLKENRLVLQGCLLNGEGTESVIVKSEIDLV
EKSNQFLSKTCNRMQAANGDSGVRFTGVEIYGIGSLAYSKMEACVELGLQ
MAANILLGGGDKILKEFKPIRVKPATN*
back to top

protein sequence of SMED30016690-orf-2

>SMED30016690-orf-2 ID=SMED30016690-orf-2|Name=SMED30016690-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=759bp
MRFGWILRVPSMIYFEWVYESLTLNVTKPESYFVQMMQSMFIVPITDKNV
FPSVSFILQFFLSIIAYVAFISVAIFNISVVKRLYIYLIGIILFVMGCNQ
YRLILLRLNGADGFIDSDNPTVNPKLVISNFDNNSYTGPWNIYWVDFIQF
IPTSQFKSASLVLILPLIYCPWLIFVQYFDLMSNQVLALSYGIANLPGLC
LALNLPVEAQIFTYNFAVTSFLIGIIYKIVSICVVLPKTLSDFLADVFVV
INFNHHAAGWLEIPSVLWSLFDLSRQFFVFWIGLLITHTIIYQEKFDGKP
SILIFAAISESVQTPLGLIGFSVASCYASRMILKLIDWLVHVNQFNESNN
SHGIAEGFSTLLMMLSLNRSILKVTDTNSDKSINMIDSMEKSSVSPIGLI
MLVMLIISSSILESASEMLSTKLVHLIATASTIQHWHKHIVCLILSLVVF
LLPVVICFNIYSFFYFDFWLITIMGSFLMTSVHMLSSFITYCLYLDNARK
LRTNRSILPDKCNIDDVISLLNFAVQSIELCIAIGLVILLIARAFSGVWN
WVSIVLLFVHFYFNIYERIRNGWVNYHRRKSVMKIIDRMYSVCDVEEISR
FEDVCAICFGELSSEDYNGPVKRTVCRHFFHKECLKKWLLIKHSCPMCSR
EFTESETEINSFMMDNVIINSESDTESVSNNSNDPNNYLVSSTSSESSIY
DDKDIDLKVYQDMNEWETRTNSSSITGNESGSSVPDDDSEVEPVEGIVIR
RSVANPDL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0002075pigment cell
PLANA:0002142parenchyma
PLANA:0003104enteric muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001841Znf_RING
IPR013083Znf_RING/FYVE/PHD
IPR025754TRC8_N_dom
IPR000860HemC
IPR022418Porphobilinogen_deaminase_C
IPR022417Porphobilin_deaminase_N
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0004418hydroxymethylbilane synthase activity
Vocabulary: biological process
TermDefinition
GO:0033014tetrapyrrole biosynthetic process
GO:0018160peptidyl-pyrromethane cofactor linkage
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001841Zinc finger, RING-typeSMARTSM00184ring_2coord: 605..648
e-value: 1.8E-6
score: 37.5
IPR001841Zinc finger, RING-typePFAMPF13639zf-RING_2coord: 604..648
e-value: 3.8E-10
score: 39.9
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 605..649
score: 11.634
IPR025754TRC8 N-terminal domainPFAMPF13705TRC8_Ncoord: 6..366
e-value: 5.8E-9
score: 35.4
coord: 400..573
e-value: 2.9E-20
score: 72.7
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 593..666
e-value: 2.0E-14
score: 54.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 717..758
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 717..734
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 673..695
NoneNo IPR availablePANTHERPTHR22763RING ZINC FINGER PROTEINcoord: 191..660
NoneNo IPR availablePANTHERPTHR22763:SF168coord: 191..660
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 585..655
NoneNo IPR availableTMHMMTMhelixcoord: 547..566
NoneNo IPR availableTMHMMTMhelixcoord: 520..542
NoneNo IPR availableTMHMMTMhelixcoord: 84..106
NoneNo IPR availableTMHMMTMhelixcoord: 186..205
NoneNo IPR availableTMHMMTMhelixcoord: 215..237
NoneNo IPR availableTMHMMTMhelixcoord: 302..324
NoneNo IPR availableTMHMMTMhelixcoord: 473..495
NoneNo IPR availableTMHMMTMhelixcoord: 441..463
NoneNo IPR availableTMHMMTMhelixcoord: 55..77
NoneNo IPR availableTMHMMTMhelixcoord: 277..292
NoneNo IPR availableTMHMMTMhelixcoord: 160..179