WD-40 repeat protein

Overview
NameWD-40 repeat protein
Smed IDSMED30016674
Length (bp)1117
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of WD-40 repeat protein (SMED30016674) t-SNE clustered cells

Violin plots show distribution of expression levels for WD-40 repeat protein (SMED30016674) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of WD-40 repeat protein (SMED30016674) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for WD-40 repeat protein (SMED30016674) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016674

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30016674SMESG000075220.1 SmedASXL_013257SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30016674SMESG000075220.1 dd_Smed_v4_14617_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30016674SMESG000075220.1 dd_Smed_v4_14617_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30016674SMESG000075220.1 dd_Smed_v4_14617_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of WD-40 repeat protein vs. TrEMBL
Match: T1E101 (TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 9.968e-23
Identity = 49/137 (35.77%), Postives = 83/137 (60.58%), Query Frame = 3
Query:  138 DLKCLICRNIVRNAYSGPCECIFCKDCIGLYLSDGEKFCPGTSTKCKSKILNIDKNIYRNDKVNKILSKTLVKCPSYLCNHQGELLEICHHLKVCVRKVTICPYKEFGCECQ-LERGQMPEHLQTNLLQHNQMVVQW 545
            DL C++C  ++R+A    C C +C  CI +YLS    +CPG  T+CK   LN++ +++RN +++  +S+ +VKCP+  CN+  ELL +  HL  C  +   CP    GCE + L + +M +HL   +L+H Q+++ +
Sbjct:   28 DLLCILCNKLMRDACESACGCHYCYTCIRIYLSQNHNYCPGDKTECKEDYLNLEGDVFRNIRLSTRISRIVVKCPNIRCNYTSELLRLKEHLDKCTPESVECPCVTIGCEEEPLLKDEMAKHLTDQVLRHTQLIMSF 164          
BLAST of WD-40 repeat protein vs. TrEMBL
Match: I1ZID8 (TNF receptor associated factor-2 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 7.503e-22
Identity = 61/192 (31.77%), Postives = 105/192 (54.69%), Query Frame = 3
Query:  138 DLKCLICRNIVRNAYSGPCECIFCKDCIGLYLSDGEKFCPGTSTKCKSKILNIDKNIYRNDKVNKILSKTLVKCPSYLCNHQGELLEICHHLKVCVRKVTICPYKEFGC-ECQLERGQMPEHLQTNLLQHNQMVVQWNINKEQQNKTDIKNGFNEINKKILENTNETN-VKQEFNKQNKSIELLTIELSSVK 707
            +LKC +C+N++ NA    C C FC  CI  Y+S G  +CPG +++CK + L I  NI+ + +VN+ ++K  VKCP   C    EL++I  HL++C  K   CP+   GC + ++    +  HLQ    QH+++++           ++++N F  +  K +E   + N +K  F  QN+ + L+  E+  +K
Sbjct:   24 NLKCDLCKNLLVNACQSRCGCRFCSKCIMEYVSRGNLYCPGGTSECKEENLTICSNIHTDYRVNRKIAKMRVKCPEETCKVYCELVDIEEHLRLCTMKSQNCPFFVLGCNQPKMVIQDLTNHLQNGTFQHSKLIIDI--------ISNMRNDFFGLTTKEVELREDINLIKNHFQSQNEIMMLINSEIEIIK 207          
BLAST of WD-40 repeat protein vs. Ensembl Medaka
Match: rnf41 (ring finger protein 41 [Source:NCBI gene;Acc:101155196])

HSP 1 Score: 51.9878 bits (123), Expect = 3.616e-7
Identity = 54/199 (27.14%), Postives = 85/199 (42.71%), Query Frame = 3
Query:  138 DLKCLICRNIVRNAYSGP-CECIFCKDCIGLYLSDGEKFCPGTSTKCKSKILNIDKNIYRNDKVNKILSKTLVKC--PSYLCNHQGELLEICHHLKVCVRKVTICPYKEFGCECQLERGQMPEHLQTNLLQHNQMVVQWNINKEQQNKTDIKNGFNEINKKILENTNETNVKQEFNKQNKSIELLTIELSSVKVKNEDL 725
            DL C IC  ++      P CE  FC  CI  + +  ++ CP   T      L     I RN     +LSK  + C   SY C     L ++  HLK C          E GC  ++ + ++P H   N ++H + VVQ     +QQ K       +E+ K + E+      K +  +Q + I+LL   + ++   N +L
Sbjct:   15 DLLCPICSGVLEEPVQAPHCEHAFCNACITQWFAQ-QQICPVDRTVVTLAHLRPVPRIMRN-----MLSKLQINCDNASYGCTATLRLDQLQSHLKDCEHNPKRPVNCEEGCGLEMPKDELPSH---NCIKHLRSVVQ-----QQQTK------ISELEKNVAEH------KHQLGEQKRDIQLLKAYMRAICSANPNL 187          
BLAST of WD-40 repeat protein vs. Planmine SMEST
Match: SMESG000075220.1 (SMESG000075220.1)

HSP 1 Score: 619.772 bits (1597), Expect = 0.000e+0
Identity = 317/319 (99.37%), Postives = 318/319 (99.69%), Query Frame = 3
Query:   66 MSQYENIWXXXXXXXXXXXXNDSVDLKCLICRNIVRNAYSGPCECIFCKDCIGLYLSDGEKFCPGTSTKCKSKILNIDKNIYRNDKVNKILSKTLVKCPSYLCNHQGELLEICHHLKVCVRKVTICPYKEFGCECQLERGQMPEHLQTNLLQHNQMVVQWNINKEQQNKTDIKNGFNEINKKILENTNETNVKQEFNKQNKSIELLTIELSSVKVKNEDLASTIKEMGETIARQNKKIHEIMQIISGNKSGNSKEIIPSVNNSNFKHTYSVKSKSSTMETEPQKHSNGTIEQSKHLKRSKTAFTRNSEVGPAHRRSYQR 1022
            MSQYENIWKLLSKFSLELEENDSVDLKCLICRNIVRNAYSGPCECIFCKDCIGLYLSDGEKFCPGTSTKCKSKILNIDKNIYRNDKVNKILSKTLVKCPSYLCNHQGELLEICHHLKVCVRKVTICPYKEFGCECQLERGQMPEHLQTNLLQHNQMVVQWNINKEQQNKTDIKNGFNEINKKILENTNETNVKQEFNKQNKSIELLTIELSSVKVKNEDLASTIKEMGETIARQNKKIHEIMQIISGNK+GNSKEIIPSVNNSNFKHTYSVKSKSSTMETEPQKHSNGT EQSKHLKRSKTAFTRNSEVGPAHRRSYQR
Sbjct:    1 MSQYENIWKLLSKFSLELEENDSVDLKCLICRNIVRNAYSGPCECIFCKDCIGLYLSDGEKFCPGTSTKCKSKILNIDKNIYRNDKVNKILSKTLVKCPSYLCNHQGELLEICHHLKVCVRKVTICPYKEFGCECQLERGQMPEHLQTNLLQHNQMVVQWNINKEQQNKTDIKNGFNEINKKILENTNETNVKQEFNKQNKSIELLTIELSSVKVKNEDLASTIKEMGETIARQNKKIHEIMQIISGNKNGNSKEIIPSVNNSNFKHTYSVKSKSSTMETEPQKHSNGTNEQSKHLKRSKTAFTRNSEVGPAHRRSYQR 319          
BLAST of WD-40 repeat protein vs. Planmine SMEST
Match: SMESG000009552.1 (SMESG000009552.1)

HSP 1 Score: 133.265 bits (334), Expect = 7.189e-35
Identity = 74/220 (33.64%), Postives = 120/220 (54.55%), Query Frame = 3
Query:  132 SVDLKCLICRNIVRNAYSGPCECIFCKDCIGLYLSDGEKFCPGTSTKCKSKILNIDKNIYRNDKVNKILSKTLVKCPSYLCNHQGELLEICHHLKVCVRKVTICPYKEFGCECQ-LERGQMPEHLQTNLLQHNQMVVQWNINKEQQNKTDIKNGFNEIN-KKILENTNETNVKQEFNKQNKSIELLTIELSSVKVKNEDLASTIKEMGETIARQNKKIHE 785
            S+D+ C+IC++++++A  GPC C++C  CI  YL D +K CPG +  C    +    NI R++  N+ + K  VKCP+  C  +GEL E+C HLK+C +    CPY++ GC    +   ++ EH+Q + + HN+M++ W +N         +    EI   +IL +    N K++       IE L  +L SVK +N+DL   I +M   I +  K I +
Sbjct:   17 SLDITCVICKDLLKDACQGPCGCLYCLQCINKYLEDNKKCCPGNTPYCTGDEIIFGVNINRDNSANRKIGKLKVKCPNNPCEFRGELREVCDHLKICGKTEVCCPYRDLGCSFTIMSNTELLEHIQLDSILHNKMIISWMMNMRIDMMAQKRLESLEIRVSRILLDVTHVNEKKQL-----VIEQLREQLKSVKNENKDLCKLISQMQAEIFQLKKSISQ 231          
BLAST of WD-40 repeat protein vs. Planmine SMEST
Match: SMESG000012339.1 (SMESG000012339.1)

HSP 1 Score: 128.257 bits (321), Expect = 7.154e-33
Identity = 61/161 (37.89%), Postives = 100/161 (62.11%), Query Frame = 3
Query:   66 MSQYENIWXXXXXXXXXXXXNDSVDLKCLICRNIVRNAYSGPCECIFCKDCIGLYLSDGEKFCPGTSTKCKSKILNIDKNIYRNDKVNKILSKTLVKCPSYLCNHQGELLEICHHLKVCVRKVTICPYKEFGCECQ-LERGQMPEHLQTNLLQHNQMVVQW 545
            M+ Y  +WK++ ++  +++   S+ +KC+IC N++ +A  GPC C++CK CI  YL++  KFCPG    CKS  L+I  NI +++  N  +SK +V CP   CN Q  L+E+ +HL+ C +    CPY E GC    +   ++ +HLQT ++ HN ++V+W
Sbjct:    1 MAHYLFMWKMMEQYQFDIDPQLSIYVKCIICNNLLNDACQGPCGCLYCKKCIDKYLANSMKFCPGNHKDCKSSKLDIFSNIVKDNSANNKVSKLIVICPGEGCNFQSTLIEMSNHLQNCDKLPFWCPYAEIGCTTNTMLTDELVDHLQTEIVAHNNLLVKW 161          
BLAST of WD-40 repeat protein vs. Planmine SMEST
Match: SMESG000012339.1 (SMESG000012339.1)

HSP 1 Score: 125.561 bits (314), Expect = 5.015e-32
Identity = 57/139 (41.01%), Postives = 87/139 (62.59%), Query Frame = 3
Query:  132 SVDLKCLICRNIVRNAYSGPCECIFCKDCIGLYLSDGEKFCPGTSTKCKSKILNIDKNIYRNDKVNKILSKTLVKCPSYLCNHQGELLEICHHLKVCVRKVTICPYKEFGCECQ-LERGQMPEHLQTNLLQHNQMVVQW 545
            S+ +KC+IC N++ +A  GPC C++CK CI  YL++  KFCPG    CKS  L+I  NI +++  N  +SK +V CP   CN Q  L+E+ +HL+ C +    CPY E GC    +   ++ +HLQT ++ HN ++V+W
Sbjct:   14 SIYVKCIICNNLLNDACQGPCGCLYCKKCIDKYLANSMKFCPGNHKDCKSSKLDIFSNIVKDNSANNKVSKLIVICPGEGCNFQSTLIEMSNHLQNCDKLPFWCPYAEIGCTTNTMLTDELVDHLQTEIVAHNNLLVKW 152          
BLAST of WD-40 repeat protein vs. Planmine SMEST
Match: SMESG000012339.1 (SMESG000012339.1)

HSP 1 Score: 125.561 bits (314), Expect = 5.156e-32
Identity = 57/139 (41.01%), Postives = 87/139 (62.59%), Query Frame = 3
Query:  132 SVDLKCLICRNIVRNAYSGPCECIFCKDCIGLYLSDGEKFCPGTSTKCKSKILNIDKNIYRNDKVNKILSKTLVKCPSYLCNHQGELLEICHHLKVCVRKVTICPYKEFGCECQ-LERGQMPEHLQTNLLQHNQMVVQW 545
            S+ +KC+IC N++ +A  GPC C++CK CI  YL++  KFCPG    CKS  L+I  NI +++  N  +SK +V CP   CN Q  L+E+ +HL+ C +    CPY E GC    +   ++ +HLQT ++ HN ++V+W
Sbjct:   17 SIYVKCIICNNLLNDACQGPCGCLYCKKCIDKYLANSMKFCPGNHKDCKSSKLDIFSNIVKDNSANNKVSKLIVICPGEGCNFQSTLIEMSNHLQNCDKLPFWCPYAEIGCTTNTMLTDELVDHLQTEIVAHNNLLVKW 155          
The following BLAST results are available for this feature:
BLAST of WD-40 repeat protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD-40 repeat protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD-40 repeat protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD-40 repeat protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD-40 repeat protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD-40 repeat protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD-40 repeat protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD-40 repeat protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 2
Match NameE-valueIdentityDescription
T1E1019.968e-2335.77TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
I1ZID87.503e-2231.77TNF receptor associated factor-2 (Fragment) OS=Sch... [more]
back to top
BLAST of WD-40 repeat protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD-40 repeat protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD-40 repeat protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD-40 repeat protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD-40 repeat protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rnf413.616e-727.14ring finger protein 41 [Source:NCBI gene;Acc:10115... [more]
back to top
BLAST of WD-40 repeat protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000075220.10.000e+099.37SMESG000075220.1[more]
SMESG000009552.17.189e-3533.64SMESG000009552.1[more]
SMESG000012339.17.154e-3337.89SMESG000012339.1[more]
SMESG000012339.15.015e-3241.01SMESG000012339.1[more]
SMESG000012339.15.156e-3241.01SMESG000012339.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016674 ID=SMED30016674|Name=WD-40 repeat protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1117bp
TAAAGTTCAACAATTTACAACTGATTGGACAGAGTTGCATTTATTATTGT
TATTAAGTGAGCTTGATGTCACAATACGAAAATATTTGGAAATTGTTATC
GAAATTCAGTTTGGAACTTGAGGAAAACGATTCAGTGGATTTGAAATGCT
TGATTTGTCGCAACATAGTGAGGAACGCGTACAGTGGCCCTTGTGAATGT
ATTTTCTGTAAGGATTGCATTGGACTGTACCTTTCGGATGGGGAGAAATT
TTGCCCTGGAACCTCTACTAAGTGTAAATCGAAAATTTTAAATATCGACA
AAAACATTTATAGAAATGACAAAGTCAACAAAATCTTATCAAAAACCCTC
GTCAAGTGTCCATCATATTTATGTAACCATCAAGGTGAATTGCTCGAAAT
ATGCCACCATTTGAAGGTCTGTGTCAGAAAAGTTACTATTTGTCCGTATA
AAGAATTCGGATGCGAATGCCAACTGGAACGAGGACAAATGCCGGAACAT
TTACAGACAAATCTTCTTCAACATAATCAAATGGTCGTCCAATGGAATAT
AAATAAAGAACAGCAAAACAAAACAGATATCAAAAACGGATTTAATGAAA
TTAATAAAAAAATCTTGGAAAATACTAACGAAACGAATGTGAAACAAGAA
TTCAATAAACAAAATAAATCGATCGAATTATTGACAATCGAACTTTCTAG
TGTGAAGGTGAAAAACGAAGACCTCGCGAGCACCATCAAAGAAATGGGAG
AAACTATTGCCAGACAAAATAAGAAAATTCACGAAATAATGCAAATTATT
AGTGGCAATAAAAGTGGAAATAGTAAAGAAATAATTCCTTCAGTAAACAA
TTCCAATTTCAAGCATACTTATTCAGTAAAGTCCAAATCCTCTACCATGG
AAACAGAACCTCAGAAACATTCAAATGGAACTATTGAACAGTCAAAACAT
TTAAAACGAAGTAAAACTGCATTTACCAGAAATTCTGAAGTCGGTCCTGC
TCACAGAAGAAGCTATCAACGTTTCAGTGAATTCATAAACTCTTTCAATT
GATTCATTTTTTTATTAACTAATGCAATATTAATTTAAAGATCACCCTGG
TATTAGTAAATATATAT
back to top

protein sequence of SMED30016674-orf-1

>SMED30016674-orf-1 ID=SMED30016674-orf-1|Name=SMED30016674-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=329bp
MSQYENIWKLLSKFSLELEENDSVDLKCLICRNIVRNAYSGPCECIFCKD
CIGLYLSDGEKFCPGTSTKCKSKILNIDKNIYRNDKVNKILSKTLVKCPS
YLCNHQGELLEICHHLKVCVRKVTICPYKEFGCECQLERGQMPEHLQTNL
LQHNQMVVQWNINKEQQNKTDIKNGFNEINKKILENTNETNVKQEFNKQN
KSIELLTIELSSVKVKNEDLASTIKEMGETIARQNKKIHEIMQIISGNKS
GNSKEIIPSVNNSNFKHTYSVKSKSSTMETEPQKHSNGTIEQSKHLKRSK
TAFTRNSEVGPAHRRSYQRFSEFINSFN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR043211TNF_rcpt-assoc_TRAF
IPR013083Znf_RING/FYVE/PHD
IPR008974TRAF-like
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0004842ubiquitin-protein transferase activity
GO:0008270zinc ion binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006955immune response
GO:0007165signal transduction
GO:0016567protein ubiquitination
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 11..130
e-value: 4.8E-13
score: 51.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 270..313
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 270..287
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 288..302
NoneNo IPR availablePANTHERPTHR10131:SF129TNF RECEPTOR-ASSOCIATED FACTOR 6coord: 26..120
coord: 114..236
NoneNo IPR availableCDDcd16449RING-HCcoord: 28..64
e-value: 1.62957E-6
score: 42.0693
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 25..74
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 26..120
coord: 114..236
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 95..149