Cylindromatosis (turban tumor syndrome), b

Overview
NameCylindromatosis (turban tumor syndrome), b
Smed IDSMED30016673
Length (bp)1401
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cylindromatosis (turban tumor syndrome), b (SMED30016673) t-SNE clustered cells

Violin plots show distribution of expression levels for Cylindromatosis (turban tumor syndrome), b (SMED30016673) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cylindromatosis (turban tumor syndrome), b (SMED30016673) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cylindromatosis (turban tumor syndrome), b (SMED30016673) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016673

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 24

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30016673SMESG000056847.1 SMESG000056838.1 SMESG000044770.1 SMESG000007140.1 Contig70uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30016673SMESG000056847.1 SMESG000056838.1 SMESG000044770.1 SMESG000007140.1 Contig70newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30016673SMESG000059757.1 Contig70uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30016673SMESG000059757.1 Contig70newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30016673SMESG000056847.1 SMESG000056843.1 SMESG000056838.1 SMESG000044770.1 SMESG000044762.1 SMESG000007140.1 dd_Smed_v4_1137_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30016673SMESG000056847.1 SMESG000056843.1 SMESG000056838.1 SMESG000044770.1 SMESG000044762.1 SMESG000007140.1 dd_Smed_v4_1137_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30016673SMESG000056847.1 SMESG000056843.1 SMESG000056838.1 SMESG000044770.1 SMESG000044762.1 SMESG000007140.1 dd_Smed_v4_1137_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30016673SMESG000056847.1 SMESG000056843.1 SMESG000056838.1 SMESG000044770.1 SMESG000044762.1 SMESG000007140.1 dd_Smed_v4_1137_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30016673SMESG000056847.1 SMESG000056843.1 SMESG000056838.1 SMESG000044770.1 SMESG000044762.1 SMESG000007140.1 dd_Smed_v4_1137_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30016673SMESG000056847.1 SMESG000056843.1 SMESG000056838.1 SMESG000044770.1 SMESG000044762.1 SMESG000007140.1 dd_Smed_v4_1137_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30016673SMESG000056847.1 SMESG000056843.1 SMESG000056838.1 SMESG000044770.1 SMESG000044762.1 SMESG000007140.1 dd_Smed_v4_1137_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30016673SMESG000056847.1 SMESG000056843.1 SMESG000056838.1 SMESG000044770.1 SMESG000044762.1 SMESG000007140.1 dd_Smed_v4_1137_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30016673SMESG000056847.1 SMESG000056843.1 SMESG000056838.1 SMESG000044770.1 SMESG000044762.1 SMESG000007140.1 dd_Smed_v4_1137_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30016673SMESG000056847.1 SMESG000056843.1 SMESG000056838.1 SMESG000044770.1 SMESG000044762.1 SMESG000007140.1 dd_Smed_v4_1137_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30016673SMESG000056847.1 SMESG000056843.1 SMESG000056838.1 SMESG000044770.1 SMESG000044762.1 SMESG000007140.1 dd_Smed_v4_1137_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30016673SMESG000056847.1 SMESG000056843.1 SMESG000056838.1 SMESG000044770.1 SMESG000044762.1 SMESG000007140.1 dd_Smed_v4_1137_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30016673SMESG000056845.1 SMESG000044775.1 SMESG000007087.1 SMESG000007085.1 SMESG000056847.1 SMESG000056838.1 SMESG000044770.1 SMESG000007140.1 SMESG000044776.1 SMESG000044783.1 SMESG000038659.1 SMESG000030652.1 SMESG000025467.1 SMESG000013956.1 SMESG000056843.1 SMESG000044762.1 dd_Smed_v6_1137_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30016673SMESG000056845.1 SMESG000044775.1 SMESG000007087.1 SMESG000007085.1 SMESG000056847.1 SMESG000056838.1 SMESG000044770.1 SMESG000007140.1 SMESG000044776.1 SMESG000044783.1 SMESG000038659.1 SMESG000030652.1 SMESG000025467.1 SMESG000013956.1 SMESG000056843.1 SMESG000044762.1 dd_Smed_v6_1137_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30016673SMESG000056845.1 SMESG000044775.1 SMESG000007087.1 SMESG000007085.1 SMESG000056847.1 SMESG000056838.1 SMESG000044770.1 SMESG000007140.1 SMESG000044776.1 SMESG000044783.1 SMESG000038659.1 SMESG000030652.1 SMESG000025467.1 SMESG000013956.1 SMESG000056843.1 SMESG000044762.1 dd_Smed_v6_1137_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30016673SMESG000056845.1 SMESG000044775.1 SMESG000007087.1 SMESG000007085.1 SMESG000056847.1 SMESG000056838.1 SMESG000044770.1 SMESG000007140.1 SMESG000044776.1 SMESG000044783.1 SMESG000038659.1 SMESG000030652.1 SMESG000025467.1 SMESG000013956.1 SMESG000056843.1 SMESG000044762.1 dd_Smed_v6_1137_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
GABAergic neuronSMED30016673SMESG000056845.1 SMESG000044775.1 SMESG000007087.1 SMESG000007085.1 SMESG000056847.1 SMESG000056838.1 SMESG000044770.1 SMESG000007140.1 SMESG000044776.1 SMESG000044783.1 SMESG000038659.1 SMESG000030652.1 SMESG000025467.1 SMESG000013956.1 SMESG000056843.1 SMESG000044762.1 dd_Smed_v6_1137_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30016673SMESG000056845.1 SMESG000044775.1 SMESG000007087.1 SMESG000007085.1 SMESG000056847.1 SMESG000056838.1 SMESG000044770.1 SMESG000007140.1 SMESG000044776.1 SMESG000044783.1 SMESG000038659.1 SMESG000030652.1 SMESG000025467.1 SMESG000013956.1 SMESG000056843.1 SMESG000044762.1 dd_Smed_v6_1137_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30016673SMESG000056845.1 SMESG000044775.1 SMESG000007087.1 SMESG000007085.1 SMESG000056847.1 SMESG000056838.1 SMESG000044770.1 SMESG000007140.1 SMESG000044776.1 SMESG000044783.1 SMESG000038659.1 SMESG000030652.1 SMESG000025467.1 SMESG000013956.1 SMESG000056843.1 SMESG000044762.1 dd_Smed_v6_1137_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30016673SMESG000056847.1 SMESG000056843.1 SMESG000056838.1 SMESG000044770.1 SMESG000044762.1 SMESG000007140.1 dd_Smed_v4_1137_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Human
Match: CYLD (CYLD lysine 63 deubiquitinase [Source:HGNC Symbol;Acc:HGNC:2584])

HSP 1 Score: 103.219 bits (256), Expect = 1.118e-22
Identity = 72/261 (27.59%), Postives = 124/261 (47.51%), Query Frame = 1
Query:  574 FMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSIS-NSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 1296
            F Q+F+  ++KV   T +++L+ S + +++ F E P+CLI+Q PR  K    +K   P  E+ I+ +  +  + C IC G A ++C+ C  D+ DI+   +      C+     HP          +  K LPD       +    MEL A++CIE  H+V+FVK                    K++  W FFDSM+ +    N + IP+V+   +  E+L  S E +         G  +R++ D+Y+ +Y + + + Y
Sbjct:  529 FYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECY-DDPDISAGKIKQFCKTCNTQVHLHPKRLNHKYNPVSLPKDLPDWDWRHGCIPCQNMELFAVLCIETSHYVAFVKYG------------------KDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLY 770          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Human
Match: CYLD (CYLD lysine 63 deubiquitinase [Source:HGNC Symbol;Acc:HGNC:2584])

HSP 1 Score: 102.834 bits (255), Expect = 1.482e-22
Identity = 72/261 (27.59%), Postives = 124/261 (47.51%), Query Frame = 1
Query:  574 FMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSIS-NSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 1296
            F Q+F+  ++KV   T +++L+ S + +++ F E P+CLI+Q PR  K    +K   P  E+ I+ +  +  + C IC G A ++C+ C  D+ DI+   +      C+     HP          +  K LPD       +    MEL A++CIE  H+V+FVK                    K++  W FFDSM+ +    N + IP+V+   +  E+L  S E +         G  +R++ D+Y+ +Y + + + Y
Sbjct:  711 FYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECY-DDPDISAGKIKQFCKTCNTQVHLHPKRLNHKYNPVSLPKDLPDWDWRHGCIPCQNMELFAVLCIETSHYVAFVKYG------------------KDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLY 952          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Human
Match: CYLD (CYLD lysine 63 deubiquitinase [Source:HGNC Symbol;Acc:HGNC:2584])

HSP 1 Score: 102.834 bits (255), Expect = 1.482e-22
Identity = 72/261 (27.59%), Postives = 124/261 (47.51%), Query Frame = 1
Query:  574 FMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSIS-NSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 1296
            F Q+F+  ++KV   T +++L+ S + +++ F E P+CLI+Q PR  K    +K   P  E+ I+ +  +  + C IC G A ++C+ C  D+ DI+   +      C+     HP          +  K LPD       +    MEL A++CIE  H+V+FVK                    K++  W FFDSM+ +    N + IP+V+   +  E+L  S E +         G  +R++ D+Y+ +Y + + + Y
Sbjct:  711 FYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECY-DDPDISAGKIKQFCKTCNTQVHLHPKRLNHKYNPVSLPKDLPDWDWRHGCIPCQNMELFAVLCIETSHYVAFVKYG------------------KDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLY 952          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Human
Match: CYLD (CYLD lysine 63 deubiquitinase [Source:HGNC Symbol;Acc:HGNC:2584])

HSP 1 Score: 102.834 bits (255), Expect = 1.482e-22
Identity = 72/261 (27.59%), Postives = 124/261 (47.51%), Query Frame = 1
Query:  574 FMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSIS-NSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 1296
            F Q+F+  ++KV   T +++L+ S + +++ F E P+CLI+Q PR  K    +K   P  E+ I+ +  +  + C IC G A ++C+ C  D+ DI+   +      C+     HP          +  K LPD       +    MEL A++CIE  H+V+FVK                    K++  W FFDSM+ +    N + IP+V+   +  E+L  S E +         G  +R++ D+Y+ +Y + + + Y
Sbjct:  711 FYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECY-DDPDISAGKIKQFCKTCNTQVHLHPKRLNHKYNPVSLPKDLPDWDWRHGCIPCQNMELFAVLCIETSHYVAFVKYG------------------KDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLY 952          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Human
Match: CYLD (CYLD lysine 63 deubiquitinase [Source:HGNC Symbol;Acc:HGNC:2584])

HSP 1 Score: 102.834 bits (255), Expect = 1.512e-22
Identity = 72/261 (27.59%), Postives = 124/261 (47.51%), Query Frame = 1
Query:  574 FMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSIS-NSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 1296
            F Q+F+  ++KV   T +++L+ S + +++ F E P+CLI+Q PR  K    +K   P  E+ I+ +  +  + C IC G A ++C+ C  D+ DI+   +      C+     HP          +  K LPD       +    MEL A++CIE  H+V+FVK                    K++  W FFDSM+ +    N + IP+V+   +  E+L  S E +         G  +R++ D+Y+ +Y + + + Y
Sbjct:  714 FYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECY-DDPDISAGKIKQFCKTCNTQVHLHPKRLNHKYNPVSLPKDLPDWDWRHGCIPCQNMELFAVLCIETSHYVAFVKYG------------------KDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLY 955          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Celegans
Match: cyld-1 (CYLinDromatosis (Human disease gene) homolog [Source:UniProtKB/TrEMBL;Acc:H2L265])

HSP 1 Score: 73.1738 bits (178), Expect = 1.772e-13
Identity = 69/253 (27.27%), Postives = 109/253 (43.08%), Query Frame = 1
Query:  619 TSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTC-LGDELDITCTFLCSQHKCQHPACTKLLPDTVKSKSKVF--------------MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSS-QSISNSYAIPRVSKAIKESEFLN-SSKEKMKESIELYDSGDIK--------------RIIKDSYIFIYHNKS 1284
            TS+ +L+  M    + F + P  LIMQ PR  +    +   LPL  I+I+   +  +  CS C   +E  C TC L   +  +    C   KC H   T LLP+    KS+                M L A++CIE  H+V++V    R ++ Q                W FFDSM+  + +S+ + +P V +    S++L+     ++K++ E    G IK              R++ DSYI  Y + S
Sbjct:  590 TSQHLLERHMRSAQVTFAKAPPVLIMQLPRYGQ-QKVFDKILPLETIDITPFVAGAVPACSKCQACSEVYCPTCFLTRRVFYSEVIFC--RKCFH--HTHLLPEIEDHKSRDLYPPGKPQKKPHSHKMVLSAVLCIETSHYVAYV----RTSSNQ----------------WVFFDSMADREGLSDGFNVPVVRECGNMSDWLSLQGWNRLKDADEC---GQIKAMFGKQSSLDPLVGRLLSDSYICFYEDAS 814          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Celegans
Match: cyld-1 (CYLinDromatosis (Human disease gene) homolog [Source:UniProtKB/TrEMBL;Acc:H2L265])

HSP 1 Score: 73.1738 bits (178), Expect = 1.892e-13
Identity = 69/253 (27.27%), Postives = 109/253 (43.08%), Query Frame = 1
Query:  619 TSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTC-LGDELDITCTFLCSQHKCQHPACTKLLPDTVKSKSKVF--------------MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSS-QSISNSYAIPRVSKAIKESEFLN-SSKEKMKESIELYDSGDIK--------------RIIKDSYIFIYHNKS 1284
            TS+ +L+  M    + F + P  LIMQ PR  +    +   LPL  I+I+   +  +  CS C   +E  C TC L   +  +    C   KC H   T LLP+    KS+                M L A++CIE  H+V++V    R ++ Q                W FFDSM+  + +S+ + +P V +    S++L+     ++K++ E    G IK              R++ DSYI  Y + S
Sbjct:  648 TSQHLLERHMRSAQVTFAKAPPVLIMQLPRYGQ-QKVFDKILPLETIDITPFVAGAVPACSKCQACSEVYCPTCFLTRRVFYSEVIFC--RKCFH--HTHLLPEIEDHKSRDLYPPGKPQKKPHSHKMVLSAVLCIETSHYVAYV----RTSSNQ----------------WVFFDSMADREGLSDGFNVPVVRECGNMSDWLSLQGWNRLKDADEC---GQIKAMFGKQSSLDPLVGRLLSDSYICFYEDAS 872          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Celegans
Match: cyld-1 (CYLinDromatosis (Human disease gene) homolog [Source:UniProtKB/TrEMBL;Acc:H2L265])

HSP 1 Score: 72.7886 bits (177), Expect = 2.940e-13
Identity = 69/253 (27.27%), Postives = 109/253 (43.08%), Query Frame = 1
Query:  619 TSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTC-LGDELDITCTFLCSQHKCQHPACTKLLPDTVKSKSKVF--------------MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSS-QSISNSYAIPRVSKAIKESEFLN-SSKEKMKESIELYDSGDIK--------------RIIKDSYIFIYHNKS 1284
            TS+ +L+  M    + F + P  LIMQ PR  +    +   LPL  I+I+   +  +  CS C   +E  C TC L   +  +    C   KC H   T LLP+    KS+                M L A++CIE  H+V++V    R ++ Q                W FFDSM+  + +S+ + +P V +    S++L+     ++K++ E    G IK              R++ DSYI  Y + S
Sbjct:  900 TSQHLLERHMRSAQVTFAKAPPVLIMQLPRYGQ-QKVFDKILPLETIDITPFVAGAVPACSKCQACSEVYCPTCFLTRRVFYSEVIFC--RKCFH--HTHLLPEIEDHKSRDLYPPGKPQKKPHSHKMVLSAVLCIETSHYVAYV----RTSSNQ----------------WVFFDSMADREGLSDGFNVPVVRECGNMSDWLSLQGWNRLKDADEC---GQIKAMFGKQSSLDPLVGRLLSDSYICFYEDAS 1124          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Fly
Match: CYLD (gene:FBgn0032210 transcript:FBtr0080072)

HSP 1 Score: 97.8265 bits (242), Expect = 2.012e-21
Identity = 72/276 (26.09%), Postives = 120/276 (43.48%), Query Frame = 1
Query:  565 NSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGD---ELDITCTFLCSQHKCQHPACTKLLPDTVKSKS----------------------KVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQ-SISNSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGD------IKRIIKDSYIFIYHNKSKTCY 1296
            +S F QLF+  D+K+   + +++ + S   +DI   E+P+C I+Q PR  K    Y   LP   ++++ I  N  + CS+C   AE++C+ C G       + CT  C       P C K     +K  +                      +++MEL A++CIE  H+V+FVK                      +  W FFDSM+ +    N Y IP ++   + +++L+   E+   SI    + D       KRI  D+Y+ +Y +     Y
Sbjct:  302 DSYFYQLFVEKDEKLTLPSVQQLFEQSFHSSDIKLKEVPSCFIIQMPRFGKNYKMYPRILPSQVLDVTDIIENSPRQCSLCGKLAEYECRDCFGSLQAGSGLECTAFC-------PKCLKTFHSHIKRTNHVSKKIYSPKEFKIMAEHMVVPRLYMELFAVVCIETSHYVAFVKSGS-----------------GPDAPWCFFDSMADRKGEQNGYNIPEITCVPELTQWLS---EEGARSINETSTNDKVLPEHAKRIFCDAYMCLYQSTDIMMY 550          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Fly
Match: CYLD (gene:FBgn0032210 transcript:FBtr0080070)

HSP 1 Score: 97.4413 bits (241), Expect = 2.944e-21
Identity = 72/276 (26.09%), Postives = 120/276 (43.48%), Query Frame = 1
Query:  565 NSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGD---ELDITCTFLCSQHKCQHPACTKLLPDTVKSKS----------------------KVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQ-SISNSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGD------IKRIIKDSYIFIYHNKSKTCY 1296
            +S F QLF+  D+K+   + +++ + S   +DI   E+P+C I+Q PR  K    Y   LP   ++++ I  N  + CS+C   AE++C+ C G       + CT  C       P C K     +K  +                      +++MEL A++CIE  H+V+FVK                      +  W FFDSM+ +    N Y IP ++   + +++L+   E+   SI    + D       KRI  D+Y+ +Y +     Y
Sbjct:  390 DSYFYQLFVEKDEKLTLPSVQQLFEQSFHSSDIKLKEVPSCFIIQMPRFGKNYKMYPRILPSQVLDVTDIIENSPRQCSLCGKLAEYECRDCFGSLQAGSGLECTAFC-------PKCLKTFHSHIKRTNHVSKKIYSPKEFKIMAEHMVVPRLYMELFAVVCIETSHYVAFVKSGS-----------------GPDAPWCFFDSMADRKGEQNGYNIPEITCVPELTQWLS---EEGARSINETSTNDKVLPEHAKRIFCDAYMCLYQSTDIMMY 638          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Fly
Match: CYLD (gene:FBgn0032210 transcript:FBtr0080071)

HSP 1 Score: 97.4413 bits (241), Expect = 2.944e-21
Identity = 72/276 (26.09%), Postives = 120/276 (43.48%), Query Frame = 1
Query:  565 NSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGD---ELDITCTFLCSQHKCQHPACTKLLPDTVKSKS----------------------KVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQ-SISNSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGD------IKRIIKDSYIFIYHNKSKTCY 1296
            +S F QLF+  D+K+   + +++ + S   +DI   E+P+C I+Q PR  K    Y   LP   ++++ I  N  + CS+C   AE++C+ C G       + CT  C       P C K     +K  +                      +++MEL A++CIE  H+V+FVK                      +  W FFDSM+ +    N Y IP ++   + +++L+   E+   SI    + D       KRI  D+Y+ +Y +     Y
Sbjct:  390 DSYFYQLFVEKDEKLTLPSVQQLFEQSFHSSDIKLKEVPSCFIIQMPRFGKNYKMYPRILPSQVLDVTDIIENSPRQCSLCGKLAEYECRDCFGSLQAGSGLECTAFC-------PKCLKTFHSHIKRTNHVSKKIYSPKEFKIMAEHMVVPRLYMELFAVVCIETSHYVAFVKSGS-----------------GPDAPWCFFDSMADRKGEQNGYNIPEITCVPELTQWLS---EEGARSINETSTNDKVLPEHAKRIFCDAYMCLYQSTDIMMY 638          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Zebrafish
Match: cylda (cylindromatosis (turban tumor syndrome), a [Source:ZFIN;Acc:ZDB-GENE-061108-2])

HSP 1 Score: 102.064 bits (253), Expect = 1.484e-22
Identity = 72/261 (27.59%), Postives = 123/261 (47.13%), Query Frame = 1
Query:  574 FMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSIS-NSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 1296
            F Q+F+    KV   TS+++L+ S + +D+ F E P+CLI+Q PR  K    +    P  E++I+ +  +  + C IC G A ++C+ C  D  DIT   +      C+     HP          +  K L ++V  +       MEL A++CIE  H+V+FVK                      +  W FFDSM+ +    N + IP+VS+  +  E+L  + E++         G  +R++ D+Y+ +Y + + + Y
Sbjct:  670 FYQIFMDKKDKVMVPTSQQLLEWSFINSDLKFAEAPSCLIIQMPRFGKDFKMFNKIFPSLELDITDLLDDTPRECRICGGLALYECRECYED-YDITPGKIKQFCEKCNTQVHLHPRRKIHRYVKLSVPKELHESVWRQGSYPHQQMELFAVLCIETSHYVAFVKYG------------------SADSAWLFFDSMADRDGGQNGFNIPQVSRCPEVGEYLKMTPEELHALDPKNIQGYARRLLCDAYMCMYQSPTMSLY 911          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Zebrafish
Match: cylda (cylindromatosis (turban tumor syndrome), a [Source:ZFIN;Acc:ZDB-GENE-061108-2])

HSP 1 Score: 102.064 bits (253), Expect = 1.708e-22
Identity = 72/261 (27.59%), Postives = 123/261 (47.13%), Query Frame = 1
Query:  574 FMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSIS-NSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 1296
            F Q+F+    KV   TS+++L+ S + +D+ F E P+CLI+Q PR  K    +    P  E++I+ +  +  + C IC G A ++C+ C  D  DIT   +      C+     HP          +  K L ++V  +       MEL A++CIE  H+V+FVK                      +  W FFDSM+ +    N + IP+VS+  +  E+L  + E++         G  +R++ D+Y+ +Y + + + Y
Sbjct:  709 FYQIFMDKKDKVMVPTSQQLLEWSFINSDLKFAEAPSCLIIQMPRFGKDFKMFNKIFPSLELDITDLLDDTPRECRICGGLALYECRECYED-YDITPGKIKQFCEKCNTQVHLHPRRKIHRYVKLSVPKELHESVWRQGSYPHQQMELFAVLCIETSHYVAFVKYG------------------SADSAWLFFDSMADRDGGQNGFNIPQVSRCPEVGEYLKMTPEELHALDPKNIQGYARRLLCDAYMCMYQSPTMSLY 950          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Zebrafish
Match: cylda (cylindromatosis (turban tumor syndrome), a [Source:ZFIN;Acc:ZDB-GENE-061108-2])

HSP 1 Score: 102.064 bits (253), Expect = 1.708e-22
Identity = 72/261 (27.59%), Postives = 123/261 (47.13%), Query Frame = 1
Query:  574 FMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSIS-NSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 1296
            F Q+F+    KV   TS+++L+ S + +D+ F E P+CLI+Q PR  K    +    P  E++I+ +  +  + C IC G A ++C+ C  D  DIT   +      C+     HP          +  K L ++V  +       MEL A++CIE  H+V+FVK                      +  W FFDSM+ +    N + IP+VS+  +  E+L  + E++         G  +R++ D+Y+ +Y + + + Y
Sbjct:  709 FYQIFMDKKDKVMVPTSQQLLEWSFINSDLKFAEAPSCLIIQMPRFGKDFKMFNKIFPSLELDITDLLDDTPRECRICGGLALYECRECYED-YDITPGKIKQFCEKCNTQVHLHPRRKIHRYVKLSVPKELHESVWRQGSYPHQQMELFAVLCIETSHYVAFVKYG------------------SADSAWLFFDSMADRDGGQNGFNIPQVSRCPEVGEYLKMTPEELHALDPKNIQGYARRLLCDAYMCMYQSPTMSLY 950          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Zebrafish
Match: cyldl (cylindromatosis (turban tumor syndrome), like [Source:ZFIN;Acc:ZDB-GENE-131127-190])

HSP 1 Score: 100.138 bits (248), Expect = 6.204e-22
Identity = 66/258 (25.58%), Postives = 113/258 (43.80%), Query Frame = 1
Query:  574 FMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDEL--DITCTFLCS---------QHKCQHPACTKLLPDTVKSKSKVF-----MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQ-SISNSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 1296
            + Q+F+  +  +   T +++L+ S   N +   E+P CLI+  PR  K    +   +P  E++I+ + ++  + C  C   A  +C  C  D L  D    + C+         Q +  H   +  LP        +      +EL A++CIE  H+VSFVK   R T                  +W FFDSM+ +   SN Y IP V    +  ++L+    ++   +     G  KR+  D Y+++Y +KS + Y
Sbjct:  521 YYQIFMDYNHHLVLPTVQQLLEHSFYSNSLKLAEVPACLILTMPRSGKSFKMFPKIIPSTELDITGLLADSPQQCVSCGLLANEECAECFRDALFSDTGFKYFCTKCSTQVHSHQQRRHHTPSSLHLPQGFSYSDSLTPPPEKLELFAVLCIETSHYVSFVKHGPRDT------------------DWIFFDSMADRVGESNGYNIPEVRACPEVGQYLHMPLAQLANQVPREMDGVAKRLFCDGYMYLYQSKSMSLY 760          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Zebrafish
Match: cyldl (cylindromatosis (turban tumor syndrome), like [Source:ZFIN;Acc:ZDB-GENE-131127-190])

HSP 1 Score: 100.138 bits (248), Expect = 6.204e-22
Identity = 66/258 (25.58%), Postives = 113/258 (43.80%), Query Frame = 1
Query:  574 FMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDEL--DITCTFLCS---------QHKCQHPACTKLLPDTVKSKSKVF-----MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQ-SISNSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 1296
            + Q+F+  +  +   T +++L+ S   N +   E+P CLI+  PR  K    +   +P  E++I+ + ++  + C  C   A  +C  C  D L  D    + C+         Q +  H   +  LP        +      +EL A++CIE  H+VSFVK   R T                  +W FFDSM+ +   SN Y IP V    +  ++L+    ++   +     G  KR+  D Y+++Y +KS + Y
Sbjct:  521 YYQIFMDYNHHLVLPTVQQLLEHSFYSNSLKLAEVPACLILTMPRSGKSFKMFPKIIPSTELDITGLLADSPQQCVSCGLLANEECAECFRDALFSDTGFKYFCTKCSTQVHSHQQRRHHTPSSLHLPQGFSYSDSLTPPPEKLELFAVLCIETSHYVSFVKHGPRDT------------------DWIFFDSMADRVGESNGYNIPEVRACPEVGQYLHMPLAQLANQVPREMDGVAKRLFCDGYMYLYQSKSMSLY 760          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Xenopus
Match: tril (TLR4 interactor with leucine-rich repeats [Source:Xenbase;Acc:XB-GENE-6050227])

HSP 1 Score: 97.4413 bits (241), Expect = 7.520e-21
Identity = 68/261 (26.05%), Postives = 123/261 (47.13%), Query Frame = 1
Query:  574 FMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCT------FLCSQHKCQHP----------ACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSIS-NSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 1296
            F Q+F+  ++ V   T +++L+ S + + + F E P+CLI+Q PR  K    +    P  ++ I+ +  +  + C IC G A ++C+ C  D+ DIT         +C+     HP          +  K LPD       +    M+L A++CIE  H+V+FVK                    +++ +W FFDSM+ +    N + IP+V+   +  E+L  S E++         G  +R++ D+Y+ +Y + + + Y
Sbjct:  651 FYQIFMDKNENVGVPTIQQLLEWSFINSSLKFAEAPSCLIVQMPRFGKDFKMFNKIFPSLDLNITDLLEDTPRQCRICGGLAMYECRECY-DDPDITAGKIKQFCKICNTQVHLHPKRQHHKFNPVSLPKELPDWDWRHGCIPYQKMDLFAVLCIETSHYVAFVKYG------------------RDDSSWVFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEELHALDSRNIQGCARRLLCDAYMCMYQSPTMSLY 892          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Xenopus
Match: tril (TLR4 interactor with leucine-rich repeats [Source:Xenbase;Acc:XB-GENE-6050227])

HSP 1 Score: 97.4413 bits (241), Expect = 7.551e-21
Identity = 68/261 (26.05%), Postives = 123/261 (47.13%), Query Frame = 1
Query:  574 FMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCT------FLCSQHKCQHP----------ACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSIS-NSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 1296
            F Q+F+  ++ V   T +++L+ S + + + F E P+CLI+Q PR  K    +    P  ++ I+ +  +  + C IC G A ++C+ C  D+ DIT         +C+     HP          +  K LPD       +    M+L A++CIE  H+V+FVK                    +++ +W FFDSM+ +    N + IP+V+   +  E+L  S E++         G  +R++ D+Y+ +Y + + + Y
Sbjct:  530 FYQIFMDKNENVGVPTIQQLLEWSFINSSLKFAEAPSCLIVQMPRFGKDFKMFNKIFPSLDLNITDLLEDTPRQCRICGGLAMYECRECY-DDPDITAGKIKQFCKICNTQVHLHPKRQHHKFNPVSLPKELPDWDWRHGCIPYQKMDLFAVLCIETSHYVAFVKYG------------------RDDSSWVFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEELHALDSRNIQGCARRLLCDAYMCMYQSPTMSLY 771          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Xenopus
Match: tril (TLR4 interactor with leucine-rich repeats [Source:Xenbase;Acc:XB-GENE-6050227])

HSP 1 Score: 97.4413 bits (241), Expect = 8.699e-21
Identity = 68/261 (26.05%), Postives = 123/261 (47.13%), Query Frame = 1
Query:  574 FMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCT------FLCSQHKCQHP----------ACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSIS-NSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 1296
            F Q+F+  ++ V   T +++L+ S + + + F E P+CLI+Q PR  K    +    P  ++ I+ +  +  + C IC G A ++C+ C  D+ DIT         +C+     HP          +  K LPD       +    M+L A++CIE  H+V+FVK                    +++ +W FFDSM+ +    N + IP+V+   +  E+L  S E++         G  +R++ D+Y+ +Y + + + Y
Sbjct:  715 FYQIFMDKNENVGVPTIQQLLEWSFINSSLKFAEAPSCLIVQMPRFGKDFKMFNKIFPSLDLNITDLLEDTPRQCRICGGLAMYECRECY-DDPDITAGKIKQFCKICNTQVHLHPKRQHHKFNPVSLPKELPDWDWRHGCIPYQKMDLFAVLCIETSHYVAFVKYG------------------RDDSSWVFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEELHALDSRNIQGCARRLLCDAYMCMYQSPTMSLY 956          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Xenopus
Match: tril (TLR4 interactor with leucine-rich repeats [Source:Xenbase;Acc:XB-GENE-6050227])

HSP 1 Score: 97.4413 bits (241), Expect = 8.941e-21
Identity = 68/261 (26.05%), Postives = 123/261 (47.13%), Query Frame = 1
Query:  574 FMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCT------FLCSQHKCQHP----------ACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSIS-NSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 1296
            F Q+F+  ++ V   T +++L+ S + + + F E P+CLI+Q PR  K    +    P  ++ I+ +  +  + C IC G A ++C+ C  D+ DIT         +C+     HP          +  K LPD       +    M+L A++CIE  H+V+FVK                    +++ +W FFDSM+ +    N + IP+V+   +  E+L  S E++         G  +R++ D+Y+ +Y + + + Y
Sbjct:  733 FYQIFMDKNENVGVPTIQQLLEWSFINSSLKFAEAPSCLIVQMPRFGKDFKMFNKIFPSLDLNITDLLEDTPRQCRICGGLAMYECRECY-DDPDITAGKIKQFCKICNTQVHLHPKRQHHKFNPVSLPKELPDWDWRHGCIPYQKMDLFAVLCIETSHYVAFVKYG------------------RDDSSWVFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEELHALDSRNIQGCARRLLCDAYMCMYQSPTMSLY 974          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Xenopus
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:Xenbase;Acc:XB-GENE-5967455])

HSP 1 Score: 82.0333 bits (201), Expect = 6.694e-16
Identity = 61/263 (23.19%), Postives = 115/263 (43.73%), Query Frame = 1
Query:  556 CQINSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGD------ELDITCTFLCS------QHKCQHPACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSS-QSISNSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 1296
            C    M ++  L    K    TSEE      +       + P+CLI+Q PR+ K    +   +P  E++I+ +  +  + CSIC   A  +C+ C  D       +   C  LCS      + +  H      +P  +  ++ +    M+L A++CIE  H+V+F++                     +   W FFDSM+  +   N + IPRV+   + +E+L  + E++++          +R++ D+Y+ +Y++   + Y
Sbjct:  512 CATKVMALRKILEAAGKSTGFTSEEKDPEEFLNQLFQVLKAPSCLIIQMPRNGKNFKMFPTIIPTLELDITDLLEDTPRQCSICQSLAVVECQECYEDTGISPGHIKQYCE-LCSKQVHLHRRRIGHRPRGLSVPRDLSEQAVLHRQCMQLYAVLCIETSHYVAFIRH-----------------SFHHSTQWAFFDSMADREGGENGFNIPRVTPCPELTEYLKMTPEELQQEDPKTMPTYARRLLCDAYMCLYYSPDLSLY 756          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Mouse
Match: Cyld (CYLD lysine 63 deubiquitinase [Source:MGI Symbol;Acc:MGI:1921506])

HSP 1 Score: 104.375 bits (259), Expect = 2.543e-23
Identity = 73/261 (27.97%), Postives = 124/261 (47.51%), Query Frame = 1
Query:  574 FMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSIS-NSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 1296
            F Q+F+  ++KV   T +++L+ S + +++ F E P+CLI+Q PR  K    +K   P  E+ I+ +  +  + C IC G A ++C+ C  D+ DI+   +      CS     HP          +  K LPD       +    MEL A++CIE  H+V+FVK                    K++  W FFDSM+ +    N + IP+V+   +  E+L  S E +         G  +R++ D+Y+ +Y + + + Y
Sbjct:  528 FYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECY-DDPDISAGKIKQFCKTCSTQVHLHPRRLNHSYHPVSLPKDLPDWDWRHGCIPCQKMELFAVLCIETSHYVAFVKYG------------------KDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLY 769          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Mouse
Match: Cyld (CYLD lysine 63 deubiquitinase [Source:MGI Symbol;Acc:MGI:1921506])

HSP 1 Score: 104.375 bits (259), Expect = 3.229e-23
Identity = 73/261 (27.97%), Postives = 124/261 (47.51%), Query Frame = 1
Query:  574 FMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSIS-NSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 1296
            F Q+F+  ++KV   T +++L+ S + +++ F E P+CLI+Q PR  K    +K   P  E+ I+ +  +  + C IC G A ++C+ C  D+ DI+   +      CS     HP          +  K LPD       +    MEL A++CIE  H+V+FVK                    K++  W FFDSM+ +    N + IP+V+   +  E+L  S E +         G  +R++ D+Y+ +Y + + + Y
Sbjct:  710 FYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECY-DDPDISAGKIKQFCKTCSTQVHLHPRRLNHSYHPVSLPKDLPDWDWRHGCIPCQKMELFAVLCIETSHYVAFVKYG------------------KDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLY 951          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Mouse
Match: Cyld (CYLD lysine 63 deubiquitinase [Source:MGI Symbol;Acc:MGI:1921506])

HSP 1 Score: 104.375 bits (259), Expect = 3.229e-23
Identity = 73/261 (27.97%), Postives = 124/261 (47.51%), Query Frame = 1
Query:  574 FMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSIS-NSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 1296
            F Q+F+  ++KV   T +++L+ S + +++ F E P+CLI+Q PR  K    +K   P  E+ I+ +  +  + C IC G A ++C+ C  D+ DI+   +      CS     HP          +  K LPD       +    MEL A++CIE  H+V+FVK                    K++  W FFDSM+ +    N + IP+V+   +  E+L  S E +         G  +R++ D+Y+ +Y + + + Y
Sbjct:  710 FYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECY-DDPDISAGKIKQFCKTCSTQVHLHPRRLNHSYHPVSLPKDLPDWDWRHGCIPCQKMELFAVLCIETSHYVAFVKYG------------------KDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLY 951          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Mouse
Match: Cyld (CYLD lysine 63 deubiquitinase [Source:MGI Symbol;Acc:MGI:1921506])

HSP 1 Score: 104.375 bits (259), Expect = 3.229e-23
Identity = 73/261 (27.97%), Postives = 124/261 (47.51%), Query Frame = 1
Query:  574 FMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSIS-NSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 1296
            F Q+F+  ++KV   T +++L+ S + +++ F E P+CLI+Q PR  K    +K   P  E+ I+ +  +  + C IC G A ++C+ C  D+ DI+   +      CS     HP          +  K LPD       +    MEL A++CIE  H+V+FVK                    K++  W FFDSM+ +    N + IP+V+   +  E+L  S E +         G  +R++ D+Y+ +Y + + + Y
Sbjct:  710 FYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECY-DDPDISAGKIKQFCKTCSTQVHLHPRRLNHSYHPVSLPKDLPDWDWRHGCIPCQKMELFAVLCIETSHYVAFVKYG------------------KDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLY 951          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Mouse
Match: Cyld (CYLD lysine 63 deubiquitinase [Source:MGI Symbol;Acc:MGI:1921506])

HSP 1 Score: 104.375 bits (259), Expect = 3.384e-23
Identity = 73/261 (27.97%), Postives = 124/261 (47.51%), Query Frame = 1
Query:  574 FMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSIS-NSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 1296
            F Q+F+  ++KV   T +++L+ S + +++ F E P+CLI+Q PR  K    +K   P  E+ I+ +  +  + C IC G A ++C+ C  D+ DI+   +      CS     HP          +  K LPD       +    MEL A++CIE  H+V+FVK                    K++  W FFDSM+ +    N + IP+V+   +  E+L  S E +         G  +R++ D+Y+ +Y + + + Y
Sbjct:  713 FYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECY-DDPDISAGKIKQFCKTCSTQVHLHPRRLNHSYHPVSLPKDLPDWDWRHGCIPCQKMELFAVLCIETSHYVAFVKYG------------------KDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLY 954          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. UniProt/SwissProt
Match: sp|Q80TQ2|CYLD_MOUSE (Ubiquitin carboxyl-terminal hydrolase CYLD OS=Mus musculus OX=10090 GN=Cyld PE=1 SV=2)

HSP 1 Score: 104.375 bits (259), Expect = 2.258e-22
Identity = 73/261 (27.97%), Postives = 124/261 (47.51%), Query Frame = 1
Query:  574 FMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSIS-NSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 1296
            F Q+F+  ++KV   T +++L+ S + +++ F E P+CLI+Q PR  K    +K   P  E+ I+ +  +  + C IC G A ++C+ C  D+ DI+   +      CS     HP          +  K LPD       +    MEL A++CIE  H+V+FVK                    K++  W FFDSM+ +    N + IP+V+   +  E+L  S E +         G  +R++ D+Y+ +Y + + + Y
Sbjct:  710 FYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECY-DDPDISAGKIKQFCKTCSTQVHLHPRRLNHSYHPVSLPKDLPDWDWRHGCIPCQKMELFAVLCIETSHYVAFVKYG------------------KDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLY 951          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. UniProt/SwissProt
Match: sp|Q66H62|CYLD_RAT (Ubiquitin carboxyl-terminal hydrolase CYLD OS=Rattus norvegicus OX=10116 GN=Cyld PE=1 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 2.386e-22
Identity = 73/261 (27.97%), Postives = 124/261 (47.51%), Query Frame = 1
Query:  574 FMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSIS-NSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 1296
            F Q+F+  ++KV   T +++L+ S + +++ F E P+CLI+Q PR  K    +K   P  E+ I+ +  +  + C IC G A ++C+ C  D+ DI+   +      CS     HP          +  K LPD       +    MEL A++CIE  H+V+FVK                    K++  W FFDSM+ +    N + IP+V+   +  E+L  S E +         G  +R++ D+Y+ +Y + + + Y
Sbjct:  711 FYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECY-DDPDISAGKIKQFCKTCSTQVHLHPRRLNHTYHPVSLPKDLPDWDWRHGCIPCQKMELFAVLCIETSHYVAFVKYG------------------KDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLY 952          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. UniProt/SwissProt
Match: sp|Q5RED8|CYLD_PONAB (Ubiquitin carboxyl-terminal hydrolase CYLD OS=Pongo abelii OX=9601 GN=CYLD PE=2 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 6.340e-22
Identity = 72/261 (27.59%), Postives = 124/261 (47.51%), Query Frame = 1
Query:  574 FMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSIS-NSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 1296
            F Q+F+  ++KV   T +++L+ S + +++ F E P+CLI+Q PR  K    +K   P  E+ I+ +  +  + C IC G A ++C+ C  D+ DI+   +      C+     HP          +  K LPD       +    MEL A++CIE  H+V+FVK                    K++  W FFDSM+ +    N + IP+V+   +  E+L  S E +         G  +R++ D+Y+ +Y + + + Y
Sbjct:  714 FYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECY-DDPDISAGKIKQFCKTCNTQVHLHPKRLNHKYNPVSLPKDLPDWDWRHGCIPCQNMELFAVLCIETSHYVAFVKYG------------------KDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLY 955          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. UniProt/SwissProt
Match: sp|Q9NQC7|CYLD_HUMAN (Ubiquitin carboxyl-terminal hydrolase CYLD OS=Homo sapiens OX=9606 GN=CYLD PE=1 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 7.259e-22
Identity = 72/261 (27.59%), Postives = 124/261 (47.51%), Query Frame = 1
Query:  574 FMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSIS-NSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 1296
            F Q+F+  ++KV   T +++L+ S + +++ F E P+CLI+Q PR  K    +K   P  E+ I+ +  +  + C IC G A ++C+ C  D+ DI+   +      C+     HP          +  K LPD       +    MEL A++CIE  H+V+FVK                    K++  W FFDSM+ +    N + IP+V+   +  E+L  S E +         G  +R++ D+Y+ +Y + + + Y
Sbjct:  714 FYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECY-DDPDISAGKIKQFCKTCNTQVHLHPKRLNHKYNPVSLPKDLPDWDWRHGCIPCQNMELFAVLCIETSHYVAFVKYG------------------KDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLY 955          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. UniProt/SwissProt
Match: sp|Q1RMU2|CYLD_BOVIN (Ubiquitin carboxyl-terminal hydrolase CYLD OS=Bos taurus OX=9913 GN=CYLD PE=2 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 2.341e-21
Identity = 71/261 (27.20%), Postives = 124/261 (47.51%), Query Frame = 1
Query:  574 FMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSIS-NSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 1296
            F Q+F+  ++KV   T +++L+ S + +++ F E P+CLI+Q PR  K    +K   P  E+ I+ +  +  + C IC G A ++C+ C  D+ DI+   +      C+     HP          +  K LPD       +    MEL A++CIE  H+V+FVK                    K++  W FFDSM+ +    N + IP+V+   +  E+L  S + +         G  +R++ D+Y+ +Y + + + Y
Sbjct:  711 FYQIFMEKNEKVGVPTIQQLLECSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECY-DDPDISAGKIKQFCKTCNAQVHLHPKRLNHKYNPVSLPKDLPDWDWRHGCIPCQKMELFAVLCIETSHYVAFVKYG------------------KDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLDDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLY 952          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. TrEMBL
Match: H3CPD3 (Uncharacterized protein OS=Tetraodon nigroviridis OX=99883 PE=4 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 4.274e-23
Identity = 67/254 (26.38%), Postives = 121/254 (47.64%), Query Frame = 1
Query:  580 QLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGD------ELDITCTFLCSQHKCQHPA----CTKLLPDTV-----KSKSKVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQ--SISNSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKT 1290
            Q+FL  ++     T +++L+ S +  D+ F E+P+CL++Q PR       + + +P  E++I+ +  N  + C IC   AE +C  CL D       +   C+ +C+    +HP+      K+LP        +  S+  +EL A++CI   H+V F K                        +W FFDSM+ +     N Y IP +    +  EFL+  +E++  +        ++R++ DSY+F+YHN+ ++
Sbjct:   16 QIFLEKEQMGTMPTVQQLLETSCLSGDLKFEEVPSCLMVQMPRCGNKYKMFSHIIPSTELDITDLLYNSQRECFICGQSAEHECLQCLPDRKLQPGRIKQYCS-VCNSQVHRHPSRQGHTPKVLPAAASQAAERPVSRHTLELFAVLCIHTSHYVCFAKYG------------------PGPRSWLFFDSMADRCGDDQNGYNIPEIRACPEVGEFLSRPEEELGRTNPAQTPDLVRRLLCDSYMFLYHNRGQS 250          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. TrEMBL
Match: Q3UY73 (USP domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Cyld PE=2 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 1.200e-21
Identity = 73/261 (27.97%), Postives = 124/261 (47.51%), Query Frame = 1
Query:  574 FMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSIS-NSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 1296
            F Q+F+  ++KV   T +++L+ S + +++ F E P+CLI+Q PR  K    +K   P  E+ I+ +  +  + C IC G A ++C+ C  D+ DI+   +      CS     HP          +  K LPD       +    MEL A++CIE  H+V+FVK                    K++  W FFDSM+ +    N + IP+V+   +  E+L  S E +         G  +R++ D+Y+ +Y + + + Y
Sbjct:   14 FYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECY-DDPDISAGKIKQFCKTCSTQVHLHPRRLNHSYHPVSLPKDLPDWDWRHGCIPCQKMELFAVLCIETSHYVAFVKYG------------------KDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLY 255          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. TrEMBL
Match: H3A9I5 (Uncharacterized protein OS=Latimeria chalumnae OX=7897 GN=LOC102365523 PE=3 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 1.964e-21
Identity = 73/262 (27.86%), Postives = 128/262 (48.85%), Query Frame = 1
Query:  571 MFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDIT----------CTFLCSQHKCQ--HPACTKLLPDTVK-------SKSKVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSISNS-YAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 1296
            +F Q+F+   + V   + +++L+ S V +D+ F E P+C I+Q PR  K    +   LP  E++I+ +  +  + CSIC   +  +C+ C  D  DIT          C+    QH+ +  H     LLP  ++       S     MEL A++CIE  H+V+FVK                      + +W FFDSM+ +    S + IP+VS   + +E+L  S +++++       G ++R++ D+Y+ +YHN + + Y
Sbjct:  687 IFYQIFMEKKQSVNIPSVQQLLEWSFVNSDLKFTEAPSCFIVQMPRFGKNFKMFSTILPTLELDITDLLEDTPRECSICQSLSMVECRNCYEDS-DITPGRIKQYCSVCSKQVHQHRNRKSHDPRNLLLPKELQDCNEFPGSIPHQTMELSAVLCIETSHYVAFVKYG------------------PADTDWLFFDSMADRKGGQSGFNIPQVSPCPEVAEYLKMSADELRDLDPKSMQGCVRRLLCDAYMCMYHNPTLSLY 929          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. TrEMBL
Match: G1Q9J9 (USP domain-containing protein OS=Myotis lucifugus OX=59463 PE=4 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 3.220e-21
Identity = 73/261 (27.97%), Postives = 123/261 (47.13%), Query Frame = 1
Query:  574 FMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSIS-NSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 1296
            F Q+F+  ++KV   T +++L+ S + +++ F E P+CLI+Q PR  K    +K   P  E+ I+ +  +  + C IC G A ++C+ C  D  DI    +      C+     HP          +  K LPD     S V    MEL A++CIE  H+V+FVK                    +++  W FFDSM+ +    N + IP+V+   +  E+L  S E +         G  +R++ D+Y+ +Y + + + Y
Sbjct:   14 FYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICRGLAMYECRECYEDP-DIAAGTIKQFCKDCNTQVHLHPKRQNHKYNPVSLPKDLPDRDWRHSCVPCQKMELFAVLCIETSHYVAFVKYG------------------RDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVREYLKMSPEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLY 255          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. TrEMBL
Match: A0A3Q1JZB3 (Cylindromatosis (turban tumor syndrome), b OS=Anabas testudineus OX=64144 PE=4 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 3.295e-21
Identity = 72/259 (27.80%), Postives = 117/259 (45.17%), Query Frame = 1
Query:  556 CQINSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGD---------ELDITCTFLCSQHKCQHPACTKLL--PDTVKSKSKV---FMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQ--SISNSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKS 1284
            CQ    F Q+FL  ++     T +++L  S +  D+ F E+P+CL++Q PR       + + +P  E++I+ +  N  + C +C   AE++C  CL D         +   TC      H  +H    K L  P  V   + V    M+L A++CI+  H+VSFVK                     N  +W FFDSM+ +     + Y IP V    +  +FL    E++           ++R++ DSY+F+YHN  
Sbjct:  462 CQGAYTF-QIFLEKEQVGQMPTVQQLLDTSCLSGDLKFEEVPSCLMVQMPRFGNKYKMFSHIIPSTELDITDLLCNSPRECFVCGHLAEYECLQCLPDRKLQPGRIKQYCTTCNLQVHTHPSRHGHSPKALEVPANVAPDAPVPRHMMQLFAVLCIQTSHYVSFVKYG------------------PNPQSWLFFDSMADRCGDDGSGYNIPEVQHCPELGDFLAQPDEELTRVNPCKAPELVRRLLCDSYMFLYHNPG 701          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Cavefish
Match: cylda (CYLD lysine 63 deubiquitinase [Source:NCBI gene;Acc:103044817])

HSP 1 Score: 99.7525 bits (247), Expect = 7.369e-22
Identity = 71/261 (27.20%), Postives = 120/261 (45.98%), Query Frame = 1
Query:  574 FMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSIS-NSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 1296
            F Q+F+    KV   TS+++L+ S + +D+ F E P+CLI+Q PR  K    +    P  E++I+ +  +  + C IC G A ++C+ C  D  DIT   +      C+     HP          +  K L + V  +       MEL A++CIE  H+V+FVK                      +  W FFDSM+ +    N + IP+VS   +   +L  + E++         G  +R++ D+Y+ +Y + + + Y
Sbjct:  523 FYQIFMDKKDKVLVPTSQQLLEWSFINSDLKFAEAPSCLIIQMPRFGKDFKMFNKIFPSLELDITDLLEDTPRECRICGGLALYECRECYEDA-DITAGKIKQFCEKCNTQVHLHPRRKTHRYGKLSVPKELQEGVWRQGSFPHQQMELFAVLCIETSHYVAFVKYG------------------AADSAWLFFDSMADRDGGQNGFNIPQVSPCPEVGAYLKMTPEELHALDPKNIQGYARRLLCDAYMCMYQSPTMSLY 764          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Cavefish
Match: cylda (CYLD lysine 63 deubiquitinase [Source:NCBI gene;Acc:103044817])

HSP 1 Score: 99.3673 bits (246), Expect = 1.198e-21
Identity = 71/261 (27.20%), Postives = 120/261 (45.98%), Query Frame = 1
Query:  574 FMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSIS-NSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 1296
            F Q+F+    KV   TS+++L+ S + +D+ F E P+CLI+Q PR  K    +    P  E++I+ +  +  + C IC G A ++C+ C  D  DIT   +      C+     HP          +  K L + V  +       MEL A++CIE  H+V+FVK                      +  W FFDSM+ +    N + IP+VS   +   +L  + E++         G  +R++ D+Y+ +Y + + + Y
Sbjct:  672 FYQIFMDKKDKVLVPTSQQLLEWSFINSDLKFAEAPSCLIIQMPRFGKDFKMFNKIFPSLELDITDLLEDTPRECRICGGLALYECRECYEDA-DITAGKIKQFCEKCNTQVHLHPRRKTHRYGKLSVPKELQEGVWRQGSFPHQQMELFAVLCIETSHYVAFVKYG------------------AADSAWLFFDSMADRDGGQNGFNIPQVSPCPEVGAYLKMTPEELHALDPKNIQGYARRLLCDAYMCMYQSPTMSLY 913          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Cavefish
Match: cylda (CYLD lysine 63 deubiquitinase [Source:NCBI gene;Acc:103044817])

HSP 1 Score: 98.9821 bits (245), Expect = 1.378e-21
Identity = 71/261 (27.20%), Postives = 120/261 (45.98%), Query Frame = 1
Query:  574 FMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSIS-NSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 1296
            F Q+F+    KV   TS+++L+ S + +D+ F E P+CLI+Q PR  K    +    P  E++I+ +  +  + C IC G A ++C+ C  D  DIT   +      C+     HP          +  K L + V  +       MEL A++CIE  H+V+FVK                      +  W FFDSM+ +    N + IP+VS   +   +L  + E++         G  +R++ D+Y+ +Y + + + Y
Sbjct:  711 FYQIFMDKKDKVLVPTSQQLLEWSFINSDLKFAEAPSCLIIQMPRFGKDFKMFNKIFPSLELDITDLLEDTPRECRICGGLALYECRECYEDA-DITAGKIKQFCEKCNTQVHLHPRRKTHRYGKLSVPKELQEGVWRQGSFPHQQMELFAVLCIETSHYVAFVKYG------------------AADSAWLFFDSMADRDGGQNGFNIPQVSPCPEVGAYLKMTPEELHALDPKNIQGYARRLLCDAYMCMYQSPTMSLY 952          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Cavefish
Match: cylda (CYLD lysine 63 deubiquitinase [Source:NCBI gene;Acc:103044817])

HSP 1 Score: 98.9821 bits (245), Expect = 1.378e-21
Identity = 71/261 (27.20%), Postives = 120/261 (45.98%), Query Frame = 1
Query:  574 FMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTVKSKSKVF---MELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSIS-NSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 1296
            F Q+F+    KV   TS+++L+ S + +D+ F E P+CLI+Q PR  K    +    P  E++I+ +  +  + C IC G A ++C+ C  D  DIT   +      C+     HP          +  K L + V  +       MEL A++CIE  H+V+FVK                      +  W FFDSM+ +    N + IP+VS   +   +L  + E++         G  +R++ D+Y+ +Y + + + Y
Sbjct:  711 FYQIFMDKKDKVLVPTSQQLLEWSFINSDLKFAEAPSCLIIQMPRFGKDFKMFNKIFPSLELDITDLLEDTPRECRICGGLALYECRECYEDA-DITAGKIKQFCEKCNTQVHLHPRRKTHRYGKLSVPKELQEGVWRQGSFPHQQMELFAVLCIETSHYVAFVKYG------------------AADSAWLFFDSMADRDGGQNGFNIPQVSPCPEVGAYLKMTPEELHALDPKNIQGYARRLLCDAYMCMYQSPTMSLY 952          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Cavefish
Match: cyldl (cylindromatosis (turban tumor syndrome), like [Source:ZFIN;Acc:ZDB-GENE-131127-190])

HSP 1 Score: 95.1301 bits (235), Expect = 2.414e-20
Identity = 66/265 (24.91%), Postives = 114/265 (43.02%), Query Frame = 1
Query:  565 NSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTF-----LCSQHKCQHPA------CTKLLPDTV----------KSKSKVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSISNSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 1296
             S F Q+F+  +  +   T +++L+ S   + +   E+P+CLI+  PR  K    +   +P  E++I+ +  N  + C +C   A  +C  C GD +     F      CS     HP+       T  LP+             S  +  +EL A++CIE  H+VSFVK   + T+                  W FFDSM+ +   N Y +P+V +  +   +L     ++   +     G  KR+  D Y+++Y + +   Y
Sbjct:  492 TSFFYQIFVDYNNTLVLPTVQQLLEHSFYTSCLRLEEVPSCLILTMPRSGKQFKMFPKIIPSLELDITALLYNP-QQCVLCGQLAHVECTECFGDPVFGNTGFKHLCDTCSAQVHLHPSRRPHKPTTMTLPEGFIRMWGSGGPPHSPPREKLELFAVLCIETSHYVSFVKHGPKATD------------------WIFFDSMADRIEINGYNVPQVKECPEVGRYLTMPLAELAAQVPREMEGVAKRLFCDGYMYLYQSPNMGLY 737          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Nematostella
Match: EDO47295 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMM7])

HSP 1 Score: 89.7373 bits (221), Expect = 2.802e-19
Identity = 71/270 (26.30%), Postives = 121/270 (44.81%), Query Frame = 1
Query:  547 HNGCQINSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAE-FQCKTCLGDEL-DITCTFLCS---QHKCQHPACT--KLLPDTVKSK-----------SKVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQ-SISNSYAIPRVSKAIKESEFLNSSKEKMKESIELYD-SGDIKRIIKDSYIFIYHNKSKTCY 1296
            H  C+  S + Q+    D+ +   T + +++ S +  D+   E+P+CLI+Q PR       Y    P   ++I+ I  N  + C +C  +A  F+CK C  +++  I  T  C    +    HP  T  KL P  V  +            +  MEL A++CI+  H+V+FVK  +                   +  W FFDSM+ +   SN Y IP V    + S +L +  +++  +    +  G++KR+  D+Y+ +Y N     Y
Sbjct:  230 HGRCE-ESNYYQIITEKDEGIKLATVQTLIEQSFMAADLKLAEVPSCLILQMPRFGNKYKMYDIIFPNTTLDITDILDNVPRPCVLCGEQASTFECKECYEEKIFSIGITSFCRDCCKKVHSHPRRTSHKLTPIIVPREYSQYARRDGPLERYTMELFAVVCIQTSHYVAFVKCGQ-----------------GPDAPWCFFDSMADRKGESNGYNIPAVRACPEASRWLLAKPDEIIGANRRGELPGNMKRLFGDAYMCMYQNFDTAMY 481          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Medaka
Match: cylda (CYLD lysine 63 deubiquitinase [Source:NCBI gene;Acc:101156964])

HSP 1 Score: 100.138 bits (248), Expect = 5.654e-22
Identity = 70/261 (26.82%), Postives = 120/261 (45.98%), Query Frame = 1
Query:  574 FMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------CSQHKCQHP----------ACTKLLPDTVKSKS---KVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSIS-NSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 1296
            F Q+F+    KV   T +++L+ S + +D+ F E P+CLI+Q PR  K    +    P  E++I+ +  +  + C IC G A ++C+ C  D+ DIT   +      C+     HP          +  K L +    +    +  MEL A++CIE  H+V+FVK                      +  W FFDSM+ +    N + IP+VS   +   +L  S E++         G  +R++ D+Y+ +Y + + + Y
Sbjct:  676 FYQIFMDKKDKVGVPTIQQLLEWSFINSDLKFAEAPSCLIIQMPRFGKDFKMFNKIFPSLELDITDLLEDTPRECRICGGLAFYECRDCY-DDGDITAGKIKQFCEKCNTQVHLHPKRKAHRHGKLSVPKELQEGTGRQGGFPRQRMELFAVLCIETSHYVAFVKYG------------------TADSAWLFFDSMADRDGGQNGFNIPQVSPCPEVETYLKMSPEELHTLDPKSIQGQARRLLCDAYMCMYQSPTMSLY 917          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Medaka
Match: cyldb (ubiquitin carboxyl-terminal hydrolase CYLD [Source:NCBI gene;Acc:101163809])

HSP 1 Score: 99.3673 bits (246), Expect = 8.145e-22
Identity = 67/248 (27.02%), Postives = 114/248 (45.97%), Query Frame = 1
Query:  577 MQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGD---------ELDITCTFLCSQH--KCQH-PACTKLLPDTVKSKSKVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQ--SISNSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHN 1278
            +Q+FL  ++     T +++L  S +  D+ F  +P+CLI+Q PR       + + +P  E++I+ +  N  + C IC   AEF+C  CL D         +  +TC      H  +C H P    +  D      +  M+L A++CI+  H+VSFVK                        +W FFDSM+ +     + Y IP +    +  +FL  S+E+   S  L     ++R++ DSY+ +Y +
Sbjct:  465 LQIFLEKEQLQHIPTVQQLLDTSCMSEDLKFEMVPSCLIIQMPRFGNKYKMFSHIIPSMELDITDLLHNSPRECFICGHLAEFECPQCLPDRKLQPGRIKQYCLTCNTQVHSHPSRCSHFPRAVTVPADADTPVPRHTMQLFAVLCIQTSHYVSFVKYG------------------PEPHSWVFFDSMADRCGDDQSGYNIPEIRACPELGDFLCQSEEEQARSNPLQAPELVRRLLCDSYMLLYQS 694          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Medaka
Match: ENSORLT00000011257.2 (ubiquitin carboxyl-terminal hydrolase CYLD [Source:NCBI gene;Acc:101167576])

HSP 1 Score: 91.6633 bits (226), Expect = 2.874e-19
Identity = 64/253 (25.30%), Postives = 114/253 (45.06%), Query Frame = 1
Query:  589 LTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------------CSQHKCQHPACTKLLPDTVKSK----SKVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSS-QSISNSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 1296
            L++   +   + + +L+ S +   + F E P+CL++  PR  K    +   LP   ++I+ +  + L+ CSIC   AE++C  C  D  DIT   L              +++  H      +P+   S     ++  M L A+ CIE  H+VSFVK   + T                  +W FFDSM+  +   N + IP+V    +   +L+ S+E++           ++R++ DSY+ +YH+   + Y
Sbjct:  680 LSLPPSLRVASVQNLLETSFMHTGLKFVEAPSCLLLLMPRFGKDFKMFDAILPTLSLDITDLLDDTLRQCSICQSVAEWECLQCYEDP-DITPGHLKQYCQTCNTQVHSHRNRLSHSPVKIGIPEGPWSGPLICTRRKMSLFAVTCIETSHYVSFVKHGPQPT------------------DWLFFDSMADREGGQNGFNIPQVKACPEVGRYLSLSEEELSRVDPASLRETVRRLLCDSYMCLYHSPELSLY 913          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Medaka
Match: ENSORLT00000045278.1 (ubiquitin carboxyl-terminal hydrolase CYLD [Source:NCBI gene;Acc:101167576])

HSP 1 Score: 91.6633 bits (226), Expect = 2.895e-19
Identity = 64/253 (25.30%), Postives = 114/253 (45.06%), Query Frame = 1
Query:  589 LTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------------CSQHKCQHPACTKLLPDTVKSK----SKVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSS-QSISNSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 1296
            L++   +   + + +L+ S +   + F E P+CL++  PR  K    +   LP   ++I+ +  + L+ CSIC   AE++C  C  D  DIT   L              +++  H      +P+   S     ++  M L A+ CIE  H+VSFVK   + T                  +W FFDSM+  +   N + IP+V    +   +L+ S+E++           ++R++ DSY+ +YH+   + Y
Sbjct:  709 LSLPPSLRVASVQNLLETSFMHTGLKFVEAPSCLLLLMPRFGKDFKMFDAILPTLSLDITDLLDDTLRQCSICQSVAEWECLQCYEDP-DITPGHLKQYCQTCNTQVHSHRNRLSHSPVKIGIPEGPWSGPLICTRRKMSLFAVTCIETSHYVSFVKHGPQPT------------------DWLFFDSMADREGGQNGFNIPQVKACPEVGRYLSLSEEELSRVDPASLRETVRRLLCDSYMCLYHSPELSLY 942          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Medaka
Match: ENSORLT00000041324.1 (ubiquitin carboxyl-terminal hydrolase CYLD [Source:NCBI gene;Acc:101167576])

HSP 1 Score: 91.6633 bits (226), Expect = 2.895e-19
Identity = 64/253 (25.30%), Postives = 114/253 (45.06%), Query Frame = 1
Query:  589 LTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFL------------CSQHKCQHPACTKLLPDTVKSK----SKVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSS-QSISNSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 1296
            L++   +   + + +L+ S +   + F E P+CL++  PR  K    +   LP   ++I+ +  + L+ CSIC   AE++C  C  D  DIT   L              +++  H      +P+   S     ++  M L A+ CIE  H+VSFVK   + T                  +W FFDSM+  +   N + IP+V    +   +L+ S+E++           ++R++ DSY+ +YH+   + Y
Sbjct:  709 LSLPPSLRVASVQNLLETSFMHTGLKFVEAPSCLLLLMPRFGKDFKMFDAILPTLSLDITDLLDDTLRQCSICQSVAEWECLQCYEDP-DITPGHLKQYCQTCNTQVHSHRNRLSHSPVKIGIPEGPWSGPLICTRRKMSLFAVTCIETSHYVSFVKHGPQPT------------------DWLFFDSMADREGGQNGFNIPQVKACPEVGRYLSLSEEELSRVDPASLRETVRRLLCDSYMCLYHSPELSLY 942          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Planmine SMEST
Match: SMESG000056847.1 (SMESG000056847.1)

HSP 1 Score: 513.457 bits (1321), Expect = 1.227e-172
Identity = 248/250 (99.20%), Postives = 249/250 (99.60%), Query Frame = 1
Query:  547 HNGCQINSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFLCSQHKCQHPACTKLLPDTVKSKSKVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSISNSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 1296
            HNGC+ NSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFLCSQHKCQHPACTKLLPDTVKSKSKVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSISNSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY
Sbjct:  823 HNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFLCSQHKCQHPACTKLLPDTVKSKSKVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSISNSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 1072          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Planmine SMEST
Match: SMESG000056847.1 (SMESG000056847.1)

HSP 1 Score: 513.457 bits (1321), Expect = 1.480e-171
Identity = 248/250 (99.20%), Postives = 249/250 (99.60%), Query Frame = 1
Query:  547 HNGCQINSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFLCSQHKCQHPACTKLLPDTVKSKSKVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSISNSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 1296
            HNGC+ NSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFLCSQHKCQHPACTKLLPDTVKSKSKVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSISNSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY
Sbjct:  921 HNGCKTNSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFLCSQHKCQHPACTKLLPDTVKSKSKVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSISNSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 1170          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Planmine SMEST
Match: SMESG000007140.1 (SMESG000007140.1)

HSP 1 Score: 472.626 bits (1215), Expect = 5.794e-164
Identity = 240/250 (96.00%), Postives = 242/250 (96.80%), Query Frame = 1
Query:  547 HNGCQINSMFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFLCSQHKCQHPACTKLLPDTVKSKSKVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSISNSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 1296
            HNGCQ NSMFMQLFLTVD KV FMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSY+YALPLNEIEISQICSNYLKNCS CNGEAEFQCK CL +ELDITCTF CSQHKCQHPACTKL PDTVKSKSKVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSISNSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY
Sbjct:  249 HNGCQTNSMFMQLFLTVDNKVSFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYEYALPLNEIEISQICSNYLKNCSKCNGEAEFQCKKCLRNELDITCTFRCSQHKCQHPACTKLRPDTVKSKSKVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSISNSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 498          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Planmine SMEST
Match: SMESG000044770.1 (SMESG000044770.1)

HSP 1 Score: 444.506 bits (1142), Expect = 9.469e-157
Identity = 228/242 (94.21%), Postives = 232/242 (95.87%), Query Frame = 1
Query:  571 MFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFLCSQHKCQHPACTKLLPDTVKSKSKVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSISNSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 1296
            MFMQLFLTVDKKV FMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSY+YALPLNEIEISQICSNY KNCS CNGEAEFQCKTCL +ELDITCTFLCSQHKCQHPACTKL PD VKSKSKVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAK+MDIKNEINWF FDSMSSQSISNSYAIPRVSKAIKES FLNSSKE+MKE IELYD GDIKRIIKDSYIFIYHNKSKTCY
Sbjct:    1 MFMQLFLTVDKKVRFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYEYALPLNEIEISQICSNYFKNCSKCNGEAEFQCKTCLRNELDITCTFLCSQHKCQHPACTKLRPDKVKSKSKVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKKMDIKNEINWFLFDSMSSQSISNSYAIPRVSKAIKESYFLNSSKERMKEIIELYDLGDIKRIIKDSYIFIYHNKSKTCY 242          
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Planmine SMEST
Match: SMESG000044770.1 (SMESG000044770.1)

HSP 1 Score: 439.499 bits (1129), Expect = 6.313e-155
Identity = 226/240 (94.17%), Postives = 230/240 (95.83%), Query Frame = 1
Query:  577 MQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCTFLCSQHKCQHPACTKLLPDTVKSKSKVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSISNSYAIPRVSKAIKESEFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY 1296
            MQLFLTVDKKV FMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSY+YALPLNEIEISQICSNY KNCS CNGEAEFQCKTCL +ELDITCTFLCSQHKCQHPACTKL PD VKSKSKVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAK+MDIKNEINWF FDSMSSQSISNSYAIPRVSKAIKES FLNSSKE+MKE IELYD GDIKRIIKDSYIFIYHNKSKTCY
Sbjct:    1 MQLFLTVDKKVRFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKGTNSYEYALPLNEIEISQICSNYFKNCSKCNGEAEFQCKTCLRNELDITCTFLCSQHKCQHPACTKLRPDKVKSKSKVFMELQAIICIEKCHFVSFVKQVERLTNEQVEKLRAKKMDIKNEINWFLFDSMSSQSISNSYAIPRVSKAIKESYFLNSSKERMKEIIELYDLGDIKRIIKDSYIFIYHNKSKTCY 240          
The following BLAST results are available for this feature:
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CYLD1.118e-2227.59CYLD lysine 63 deubiquitinase [Source:HGNC Symbol;... [more]
CYLD1.482e-2227.59CYLD lysine 63 deubiquitinase [Source:HGNC Symbol;... [more]
CYLD1.482e-2227.59CYLD lysine 63 deubiquitinase [Source:HGNC Symbol;... [more]
CYLD1.482e-2227.59CYLD lysine 63 deubiquitinase [Source:HGNC Symbol;... [more]
CYLD1.512e-2227.59CYLD lysine 63 deubiquitinase [Source:HGNC Symbol;... [more]
back to top
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cyld-11.772e-1327.27CYLinDromatosis (Human disease gene) homolog [Sou... [more]
cyld-11.892e-1327.27CYLinDromatosis (Human disease gene) homolog [Sou... [more]
cyld-12.940e-1327.27CYLinDromatosis (Human disease gene) homolog [Sou... [more]
back to top
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CYLD2.012e-2126.09gene:FBgn0032210 transcript:FBtr0080072[more]
CYLD2.944e-2126.09gene:FBgn0032210 transcript:FBtr0080070[more]
CYLD2.944e-2126.09gene:FBgn0032210 transcript:FBtr0080071[more]
back to top
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cylda1.484e-2227.59cylindromatosis (turban tumor syndrome), a [Source... [more]
cylda1.708e-2227.59cylindromatosis (turban tumor syndrome), a [Source... [more]
cylda1.708e-2227.59cylindromatosis (turban tumor syndrome), a [Source... [more]
cyldl6.204e-2225.58cylindromatosis (turban tumor syndrome), like [Sou... [more]
cyldl6.204e-2225.58cylindromatosis (turban tumor syndrome), like [Sou... [more]
back to top
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tril7.520e-2126.05TLR4 interactor with leucine-rich repeats [Source:... [more]
tril7.551e-2126.05TLR4 interactor with leucine-rich repeats [Source:... [more]
tril8.699e-2126.05TLR4 interactor with leucine-rich repeats [Source:... [more]
tril8.941e-2126.05TLR4 interactor with leucine-rich repeats [Source:... [more]
dnah26.694e-1623.19dynein, axonemal, heavy chain 2 [Source:Xenbase;Ac... [more]
back to top
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cyld2.543e-2327.97CYLD lysine 63 deubiquitinase [Source:MGI Symbol;A... [more]
Cyld3.229e-2327.97CYLD lysine 63 deubiquitinase [Source:MGI Symbol;A... [more]
Cyld3.229e-2327.97CYLD lysine 63 deubiquitinase [Source:MGI Symbol;A... [more]
Cyld3.229e-2327.97CYLD lysine 63 deubiquitinase [Source:MGI Symbol;A... [more]
Cyld3.384e-2327.97CYLD lysine 63 deubiquitinase [Source:MGI Symbol;A... [more]
back to top
BLAST of Cylindromatosis (turban tumor syndrome), b vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q80TQ2|CYLD_MOUSE2.258e-2227.97Ubiquitin carboxyl-terminal hydrolase CYLD OS=Mus ... [more]
sp|Q66H62|CYLD_RAT2.386e-2227.97Ubiquitin carboxyl-terminal hydrolase CYLD OS=Ratt... [more]
sp|Q5RED8|CYLD_PONAB6.340e-2227.59Ubiquitin carboxyl-terminal hydrolase CYLD OS=Pong... [more]
sp|Q9NQC7|CYLD_HUMAN7.259e-2227.59Ubiquitin carboxyl-terminal hydrolase CYLD OS=Homo... [more]
sp|Q1RMU2|CYLD_BOVIN2.341e-2127.20Ubiquitin carboxyl-terminal hydrolase CYLD OS=Bos ... [more]
back to top
BLAST of Cylindromatosis (turban tumor syndrome), b vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H3CPD34.274e-2326.38Uncharacterized protein OS=Tetraodon nigroviridis ... [more]
Q3UY731.200e-2127.97USP domain-containing protein (Fragment) OS=Mus mu... [more]
H3A9I51.964e-2127.86Uncharacterized protein OS=Latimeria chalumnae OX=... [more]
G1Q9J93.220e-2127.97USP domain-containing protein OS=Myotis lucifugus ... [more]
A0A3Q1JZB33.295e-2127.80Cylindromatosis (turban tumor syndrome), b OS=Anab... [more]
back to top
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cylda7.369e-2227.20CYLD lysine 63 deubiquitinase [Source:NCBI gene;Ac... [more]
cylda1.198e-2127.20CYLD lysine 63 deubiquitinase [Source:NCBI gene;Ac... [more]
cylda1.378e-2127.20CYLD lysine 63 deubiquitinase [Source:NCBI gene;Ac... [more]
cylda1.378e-2127.20CYLD lysine 63 deubiquitinase [Source:NCBI gene;Ac... [more]
cyldl2.414e-2024.91cylindromatosis (turban tumor syndrome), like [Sou... [more]
back to top
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO472952.802e-1926.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cylda5.654e-2226.82CYLD lysine 63 deubiquitinase [Source:NCBI gene;Ac... [more]
cyldb8.145e-2227.02ubiquitin carboxyl-terminal hydrolase CYLD [Source... [more]
ENSORLT00000011257.22.874e-1925.30ubiquitin carboxyl-terminal hydrolase CYLD [Source... [more]
ENSORLT00000045278.12.895e-1925.30ubiquitin carboxyl-terminal hydrolase CYLD [Source... [more]
ENSORLT00000041324.12.895e-1925.30ubiquitin carboxyl-terminal hydrolase CYLD [Source... [more]
back to top
BLAST of Cylindromatosis (turban tumor syndrome), b vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000056847.11.227e-17299.20SMESG000056847.1[more]
SMESG000056847.11.480e-17199.20SMESG000056847.1[more]
SMESG000007140.15.794e-16496.00SMESG000007140.1[more]
SMESG000044770.19.469e-15794.21SMESG000044770.1[more]
SMESG000044770.16.313e-15594.17SMESG000044770.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016673 ID=SMED30016673|Name=Cylindromatosis (turban tumor syndrome), b|organism=Schmidtea mediterranea sexual|type=transcript|length=1401bp
GTCCAAAAGAACAATTATTAAGGTAAGTTATTAAGCACTATTTGAGTGTT
TTTTAATCTTTTTTCGTGTTTTCAAATTTAATTCATTTTACGACAAATTT
TGAAGGTTTTGAAGCCATTTTTCTCCGCAACTTTGAGTTGATTTGAAAGC
GGATTTTTCGTTCTTTTTTGCTAAACTAGATTTTTTACTTAATAACTTTT
TTGAATTTTTTTTAGTCATAAGGTTGATTTCGTATAAAATATTATCTTTT
TATTTGTAAAGTTAATTATTTTGTTGATGAATACACCGAATTCCTCTGTG
AGAGCACAGTTTCGTTTTTGTCCGTTACAAGATTTTATTAGGATGTCCTC
ACTGCATTTTACAACAATGATAAATTTAAAATATTTAAATCCTTTATTTT
CACAAAATAAAATATTTATATTTTAGTAAACTAAATGTGGTCTTTCCATA
ATTTTATTAGCATTAATTAATTTTAAGTATTTTAAATGTAATTATCACTA
AATAATATAAATACTAATCTTGTTATTAATATTAAGTATAATTTCACATA
ATGGTTGCCAAATAAATTCTATGTTTATGCAATTATTTCTGACAGTTGAC
AAAAAAGTGCCCTTCATGACCAGTGAGGAAATGCTCAAGATATCAATGGT
ACAGAATGATATCATGTTCAATGAGTTGCCGACATGTTTAATAATGCAAG
CTCCAAGAGATGCCAAAGGAACGAATTCCTATAAATATGCTTTGCCTTTG
AATGAAATTGAAATTTCTCAAATTTGCTCCAACTATTTAAAAAATTGCTC
CATATGTAATGGCGAAGCCGAATTTCAATGTAAAACGTGCTTGGGAGATG
AATTAGATATAACTTGCACCTTCCTATGTTCACAACATAAATGCCAACAT
CCTGCATGCACCAAACTTCTTCCAGACACGGTGAAATCCAAATCAAAAGT
TTTCATGGAATTGCAGGCTATAATTTGCATTGAAAAATGTCATTTTGTAT
CCTTTGTAAAGCAAGTTGAAAGGTTAACGAATGAGCAGGTTGAAAAGCTA
AGAGCAAAGCAAATGGATATAAAAAATGAAATTAATTGGTTTTTCTTTGA
TAGTATGAGTTCTCAGTCAATATCCAACAGTTATGCCATTCCAAGAGTTT
CAAAAGCTATAAAAGAATCAGAATTCTTAAACAGCTCTAAAGAGAAAATG
AAAGAAAGCATCGAATTGTATGATTCAGGAGATATAAAGCGGATCATAAA
AGATTCCTACATTTTCATCTACCACAACAAATCTAAAACTTGTTATTAAT
TTCCCTACAAAGTGAAAAGCTTTTTTGACTTTTGTTCTTTTTATCAAACT
TTAAATTAAATTATAAAACTTTCAATAAATCATGATATTTGTTTAAAAAA
A
back to top

protein sequence of SMED30016673-orf-1

>SMED30016673-orf-1 ID=SMED30016673-orf-1|Name=SMED30016673-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=243bp
MFMQLFLTVDKKVPFMTSEEMLKISMVQNDIMFNELPTCLIMQAPRDAKG
TNSYKYALPLNEIEISQICSNYLKNCSICNGEAEFQCKTCLGDELDITCT
FLCSQHKCQHPACTKLLPDTVKSKSKVFMELQAIICIEKCHFVSFVKQVE
RLTNEQVEKLRAKQMDIKNEINWFFFDSMSSQSISNSYAIPRVSKAIKES
EFLNSSKEKMKESIELYDSGDIKRIIKDSYIFIYHNKSKTCY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:1904888cranial skeletal system development
GO:0016055Wnt signaling pathway
GO:0016579protein deubiquitination
GO:0032088negative regulation of NF-kappaB transcription factor activity
GO:0042347negative regulation of NF-kappaB import into nucleus
GO:0045087innate immune response
GO:0070266necroptotic process
GO:0070536protein K63-linked deubiquitination
GO:0090090negative regulation of canonical Wnt signaling pathway
GO:1902017regulation of cilium assembly
GO:1990108protein linear deubiquitination
GO:2001238positive regulation of extrinsic apoptotic signaling pathway
GO:2001242regulation of intrinsic apoptotic signaling pathway
GO:0002376immune system process
GO:0006508proteolysis
GO:0006511ubiquitin-dependent protein catabolic process
GO:0007346regulation of mitotic cell cycle
GO:0008150biological_process
GO:0010803regulation of tumor necrosis factor-mediated signaling pathway
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000463cholinergic neuron
PLANA:0000464GABAergic neuron
PLANA:0000484secretory system
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0036064ciliary basal body
GO:0042995cell projection
GO:0048471perinuclear region of cytoplasm
GO:0097542ciliary tip
GO:0005575cellular_component
GO:0005737cytoplasm
GO:0005813centrosome
GO:0005815microtubule organizing center
GO:0005819spindle
GO:0005829cytosol
GO:0005856cytoskeleton
GO:0005874microtubule
GO:0005886plasma membrane
Vocabulary: molecular function
TermDefinition
GO:0016787hydrolase activity
GO:0036459thiol-dependent ubiquitinyl hydrolase activity
GO:0046872metal ion binding
GO:0061578Lys63-specific deubiquitinase activity
GO:0003674molecular_function
GO:0004843thiol-dependent ubiquitin-specific protease activity
GO:0008233peptidase activity
GO:0008234cysteine-type peptidase activity
GO:0008270zinc ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.90.70.10coord: 1..242
e-value: 2.2E-39
score: 137.3
NoneNo IPR availablePANTHERPTHR1183040S RIBOSOMAL PROTEIN S3Acoord: 2..238
NoneNo IPR availablePANTHERPTHR11830:SF3CYLINDROMATOSIS, ISOFORM Dcoord: 2..238