Cytoplasmic polyadenylation element-binding protein

Overview
NameCytoplasmic polyadenylation element-binding protein
Smed IDSMED30016672
Length (bp)1278
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cytoplasmic polyadenylation element-binding protein (SMED30016672) t-SNE clustered cells

Violin plots show distribution of expression levels for Cytoplasmic polyadenylation element-binding protein (SMED30016672) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cytoplasmic polyadenylation element-binding protein (SMED30016672) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cytoplasmic polyadenylation element-binding protein (SMED30016672) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016672

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30016672SMESG000055629.1 SmedASXL_016021SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30016672SMESG000055629.1 dd_Smed_v4_8889_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30016672SMESG000055629.1 dd_Smed_v6_8889_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30016672SMESG000055629.1 Contig35135newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30016672SMESG000055629.1 Contig35135uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30016672SMESG000055629.1 Contig39085newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30016672SMESG000055629.1 Contig39085uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30016672SMESG000055629.1 SMESG000066348.1 SMESG000050918.1 Contig45882newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30016672SMESG000055629.1 SMESG000066348.1 SMESG000050918.1 Contig45882uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
cephalic gangliaSMED30016672SMESG000055629.1 KX074204smed_ncbi_20200123PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30016672SMESG000055629.1 KX074204smed_ncbi_20200123PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30016672SMESG000055629.1 KX074204smed_ncbi_20200123PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
spermatogoniumSMED30016672SMESG000055629.1 KX074204smed_ncbi_20200123PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
spermatocyteSMED30016672SMESG000055629.1 KX074204smed_ncbi_20200123PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Human
Match: CPEB4 (cytoplasmic polyadenylation element binding protein 4 [Source:HGNC Symbol;Acc:HGNC:21747])

HSP 1 Score: 500.36 bits (1287), Expect = 6.659e-178
Identity = 240/322 (74.53%), Postives = 273/322 (84.78%), Query Frame = 2
Query:  206 SFDPQLFEVLR----NLESKTANMSLDDNSLSNMLPGEQFNSNVLKNINPFMFSPL-PQREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            S +  L +++R     ++ +++   ++D  L +    +  +S +    +P  FS    +R ERYSRKVFVGGLPPDIDE+EITA+F+RFG L+VDWPHKAESKSYFPPKGY FLLFQDE SVQ LIDACI ++ K Y CVSSPTIKDKPVQIRPW+L+DSDFVMDGS+PLDPRKTIFVGGVPRPLRA+ELAMIMDRLYGGVCY+GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH +IDKRVEVKPYVLDDQ+CDECQG+RCGGKFAPFFCANVTCLQYYCE CWA IHSR GRE+HKPLVKEG DRPR + FRW
Sbjct:    3 SLESSLIDIMRAENDTIKGQSSLFPMEDGFLDDGRGDQPLHSGLG---SPHCFSHQNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYVLDDQLCDECQGARCGGKFAPFFCANVTCLQYYCEYCWAAIHSRAGREFHKPLVKEGGDRPRHISFRW 321          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Human
Match: CPEB4 (cytoplasmic polyadenylation element binding protein 4 [Source:HGNC Symbol;Acc:HGNC:21747])

HSP 1 Score: 500.36 bits (1287), Expect = 1.344e-177
Identity = 231/264 (87.50%), Postives = 248/264 (93.94%), Query Frame = 2
Query:  365 QREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            +R ERYSRKVFVGGLPPDIDE+EITA+F+RFG L+VDWPHKAESKSYFPPKGY FLLFQDE SVQ LIDACI ++ K Y CVSSPTIKDKPVQIRPW+L+DSDFVMDGS+PLDPRKTIFVGGVPRPLRA+ELAMIMDRLYGGVCY+GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH +IDKRVEVKPYVLDDQ+CDECQG+RCGGKFAPFFCANVTCLQYYCE CWA IHSR GRE+HKPLVKEG DRPR + FRW
Sbjct:   75 ERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYVLDDQLCDECQGARCGGKFAPFFCANVTCLQYYCEYCWAAIHSRAGREFHKPLVKEGGDRPRHISFRW 338          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Human
Match: CPEB3 (cytoplasmic polyadenylation element binding protein 3 [Source:HGNC Symbol;Acc:HGNC:21746])

HSP 1 Score: 513.072 bits (1320), Expect = 1.916e-177
Identity = 234/264 (88.64%), Postives = 250/264 (94.70%), Query Frame = 2
Query:  365 QREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            +R ERYSRKVFVGGLPPDIDE+EITA+F+RFG LVVDWPHKAESKSYFPPKGY FLLFQ+E SVQ LIDAC+ ++ K Y CVSSPTIKDKPVQIRPW+L+DSDFVMDGS+PLDPRKTIFVGGVPRPLRA+ELAMIMDRLYGGVCY+GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH+DIDKRVEVKPYVLDDQMCDECQG+RCGGKFAPFFCANVTCLQYYCE CWA IHSR GRE+HKPLVKEG DRPR VPFRW
Sbjct:  420 ERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACLEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHNDIDKRVEVKPYVLDDQMCDECQGTRCGGKFAPFFCANVTCLQYYCEYCWASIHSRAGREFHKPLVKEGGDRPRHVPFRW 683          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Human
Match: CPEB4 (cytoplasmic polyadenylation element binding protein 4 [Source:HGNC Symbol;Acc:HGNC:21747])

HSP 1 Score: 497.664 bits (1280), Expect = 2.832e-177
Identity = 231/264 (87.50%), Postives = 248/264 (93.94%), Query Frame = 2
Query:  365 QREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            +R ERYSRKVFVGGLPPDIDE+EITA+F+RFG L+VDWPHKAESKSYFPPKGY FLLFQDE SVQ LIDACI ++ K Y CVSSPTIKDKPVQIRPW+L+DSDFVMDGS+PLDPRKTIFVGGVPRPLRA+ELAMIMDRLYGGVCY+GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH +IDKRVEVKPYVLDDQ+CDECQG+RCGGKFAPFFCANVTCLQYYCE CWA IHSR GRE+HKPLVKEG DRPR + FRW
Sbjct:   31 ERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYVLDDQLCDECQGARCGGKFAPFFCANVTCLQYYCEYCWAAIHSRAGREFHKPLVKEGGDRPRHISFRW 294          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Human
Match: CPEB4 (cytoplasmic polyadenylation element binding protein 4 [Source:HGNC Symbol;Acc:HGNC:21747])

HSP 1 Score: 497.664 bits (1280), Expect = 2.832e-177
Identity = 231/264 (87.50%), Postives = 248/264 (93.94%), Query Frame = 2
Query:  365 QREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            +R ERYSRKVFVGGLPPDIDE+EITA+F+RFG L+VDWPHKAESKSYFPPKGY FLLFQDE SVQ LIDACI ++ K Y CVSSPTIKDKPVQIRPW+L+DSDFVMDGS+PLDPRKTIFVGGVPRPLRA+ELAMIMDRLYGGVCY+GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH +IDKRVEVKPYVLDDQ+CDECQG+RCGGKFAPFFCANVTCLQYYCE CWA IHSR GRE+HKPLVKEG DRPR + FRW
Sbjct:   31 ERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYVLDDQLCDECQGARCGGKFAPFFCANVTCLQYYCEYCWAAIHSRAGREFHKPLVKEGGDRPRHISFRW 294          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Celegans
Match: cpb-1 (Cytoplasmic polyadenylation element-binding protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q03571])

HSP 1 Score: 282.722 bits (722), Expect = 1.116e-89
Identity = 129/268 (48.13%), Postives = 176/268 (65.67%), Query Frame = 2
Query:  371 EERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPK------------GYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIH-----SRQGREYHKPLVKEG 1123
            E  YSRKVF+GGLP D+ EE++ A F  FG +++DWP + E  +    +            GY FL+F  E SVQ L++AC   E KYY  +SSPT+ DK VQ+RPW L+D D+  + +  +D R+T+F+GGVPRP RA +LA  ++  YG V Y GID DPELKYPKGA RV FS  Q+++ AIS RFVQ+ H + +KRVE+KPYV+++Q CDEC+G  C   +AP+FC + +CLQYYCE CW  +H       +  + H P+V+ G
Sbjct:  241 EPLYSRKVFIGGLPIDVSEEQVWATFGAFGKVLIDWPRRPEHNAERAEQELKKGSGSRAVTGYVFLVFTHERSVQELVNACEFYEDKYYLQLSSPTMTDKAVQVRPWRLSDIDYFCNDNSSVDHRRTVFIGGVPRPTRAQDLARCLEGHYGKVSYVGIDIDPELKYPKGAARVTFSTSQAFVRAISGRFVQVNHAENNKRVEIKPYVMEEQYCDECEGRLCKHNYAPYFCGHASCLQYYCEGCWDRMHIGKNEDNKLEDQHYPMVRTG 508          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Celegans
Match: cpb-2 (Cytoplasmic polyadenylation element-binding protein 2 [Source:UniProtKB/Swiss-Prot;Acc:Q18317])

HSP 1 Score: 209.92 bits (533), Expect = 9.421e-62
Identity = 111/268 (41.42%), Postives = 158/268 (58.96%), Query Frame = 2
Query:  335 INPFMFSPLPQREE-------RYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVK 1117
            INPFM +   Q E        R S     G L P +   ++      FG+   D     + + +    GY FLLF+ E SV++L+  C  +E   +  + S T   + VQIRPW LAD++F+MD + P++ +   F+GGVPRPL+A+ELA   ++ YG V   GID D + KYP+G+GRVAFS+  +Y+ AI+ R++ L H DI KRVE+KPY   +Q C+EC G R   + AP+FC ++ C QYYCE CW  +HS   R +H P+VK
Sbjct:  307 INPFMRNMPAQSESSQTGGFGRISSGSIGGFLNPGM--AQVARGNLGFGSTKSDGSINGDKRQHH--LGYVFLLFEKERSVRDLVLDCFEEEEGLFITLESSTDSIR-VQIRPWLLADAEFLMDFNVPINTKLVAFIGGVPRPLKAVELAHFFEQTYGHVVCVGIDIDNKFKYPRGSGRVAFSDYDAYVQAITDRYIVLDHEDIHKRVEIKPYFFHNQSCEECSG-RYHRQHAPYFCPSLECFQYYCEPCWHKMHSHPSRFHHMPVVK 568          

HSP 2 Score: 50.0618 bits (118), Expect = 2.226e-6
Identity = 23/38 (60.53%), Postives = 26/38 (68.42%), Query Frame = 2
Query:  374 ERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHK 487
            E YSRKVFVGGLP  + E +I   F R+G L VDWP K
Sbjct:  232 EVYSRKVFVGGLPSCVKESDILNFFSRYGRLQVDWPSK 269          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Celegans
Match: cpb-3 (Cytoplasmic polyadenylation element-binding protein 3 [Source:UniProtKB/Swiss-Prot;Acc:O01835])

HSP 1 Score: 140.584 bits (353), Expect = 6.711e-36
Identity = 93/305 (30.49%), Postives = 150/305 (49.18%), Query Frame = 2
Query:  305 EQFNSNVLKNINPFMFSPLPQRE---ERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKA----ESKSYFPPK----------------GYCFLLFQDEISVQNLIDAC---IMDESKYYWCV---SSPTIKDKPVQIRPWSLADSDFVMDGS---EPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDEC--QGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSR-QGREYHKPLV 1114
            +Q + N  ++ +   F  LP R+     +SRK+FVGG+P DI E  +  +F  FG+  V+WP +       +S   P                 GY +++F+DE +V +L+  C   I    ++Y+ +    S + + + VQI PW  +DS F  D +     ++P++T+FVG +   + A  L  IM+  +G V    +DTD + KYP G+GRV F    +Y  AI   ++ +      KRV++ P+ L+   C  C  Q + C       FC N  C +YYC  CWA  H +   +E H P++
Sbjct:  265 QQEHGNKNRDSDATWFGELPPRDYTSPTFSRKIFVGGVPWDITEAALKDSFGEFGSCAVEWPGQEARYRSGQSNLAPSNGSLRAQTKYTGQAATGYVYMIFEDERAVASLLHECSQEIGGAGEWYFKIRAQRSKSTEIRQVQIIPWVTSDSMFCEDDTLLETGIEPKRTVFVGALHGMMTAQVLHSIMEDCFGAVECVQLDTD-KFKYPIGSGRVTFREHGAYFKAIEMGYLHVYTSKFRKRVQIDPF-LESTCCMVCNSQSAHC-------FCRNKNCFKYYCHNCWALDHGKDDDQEVHIPVI 560          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Celegans
Match: fog-1 (Feminization Of Germline [Source:UniProtKB/TrEMBL;Acc:A0A0K3AQU4])

HSP 1 Score: 130.568 bits (327), Expect = 9.380e-33
Identity = 75/211 (35.55%), Postives = 118/211 (55.92%), Query Frame = 2
Query:  383 SRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSY-----FPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEP---LDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKR-VEVKPYVLDDQMCDECQG 988
            S KVFVGG+   ++ + I   F +FGT+ VDWP K +  S           Y FL++ DE SV  L+ AC  +    ++ VS P  +D  +QIRPW + +  ++++ +     +D  +T+F+GG+PR + A E+A +    +G V    ID D +  YPKGA RV F    ++  A+  +F++  + D  K  +E+KPYV++D  CDEC G
Sbjct:  204 SNKVFVGGISHMMNRKIINKFFGQFGTVFVDWPVKQKPNSRGKSIAIGSYSYLFLVYSDEQSVIKLMSACHRNSQNDFF-VSVPGFRDM-IQIRPWFIYNGFYILEKARHNRIIDIHRTVFLGGLPRIVTAEEIAQMFSE-FGVVLLVTIDIDQDYGYPKGAARVTFERDSAFNRALEKKFLKFDNIDSSKTMIEIKPYVMEDVGCDECGG 411          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Celegans
Match: fog-1 (Feminization Of Germline [Source:UniProtKB/TrEMBL;Acc:A0A0K3AQU4])

HSP 1 Score: 117.857 bits (294), Expect = 4.062e-29
Identity = 68/199 (34.17%), Postives = 110/199 (55.28%), Query Frame = 2
Query:  419 IDEEEITAAFKRFGTLVVDWPHKAESKSY-----FPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEP---LDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKR-VEVKPYVLDDQMCDECQG 988
            ++ + I   F +FGT+ VDWP K +  S           Y FL++ DE SV  L+ AC  +    ++ VS P  +D  +QIRPW + +  ++++ +     +D  +T+F+GG+PR + A E+A +    +G V    ID D +  YPKGA RV F    ++  A+  +F++  + D  K  +E+KPYV++D  CDEC G
Sbjct:    2 MNRKIINKFFGQFGTVFVDWPVKQKPNSRGKSIAIGSYSYLFLVYSDEQSVIKLMSACHRNSQNDFF-VSVPGFRDM-IQIRPWFIYNGFYILEKARHNRIIDIHRTVFLGGLPRIVTAEEIAQMFSE-FGVVLLVTIDIDQDYGYPKGAARVTFERDSAFNRALEKKFLKFDNIDSSKTMIEIKPYVMEDVGCDECGG 197          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Fly
Match: orb2 (gene:FBgn0264307 transcript:FBtr0331511)

HSP 1 Score: 493.041 bits (1268), Expect = 8.131e-172
Identity = 226/260 (86.92%), Postives = 239/260 (91.92%), Query Frame = 2
Query:  377 RYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            R+SRKVFVGGLPPDIDE+EIT +F+RFG LVVDWPHKAESKSYFPPKGY FLLFQDE SVQ LID+CI DE K Y CVSSPTIKDK VQIRPW LAD+D+V+D +  LDPRKT+FVGGVPRPL+A ELAMIMDRLYGGVCY+GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH DIDKRVEVKPYVLDDQMCDEC+G RCGGKFAPFFCANVTCLQYYCE CWA IHSR GREYHKPLVKEGADRPR VPFRW
Sbjct:  291 RFSRKVFVGGLPPDIDEDEITTSFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQDESSVQQLIDSCITDEDKLYLCVSSPTIKDKAVQIRPWRLADADYVLDATMSLDPRKTVFVGGVPRPLKAFELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVLDDQMCDECEGQRCGGKFAPFFCANVTCLQYYCEHCWAVIHSRPGREYHKPLVKEGADRPRAVPFRW 550          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Fly
Match: orb2 (gene:FBgn0264307 transcript:FBtr0331515)

HSP 1 Score: 497.278 bits (1279), Expect = 2.137e-171
Identity = 226/260 (86.92%), Postives = 239/260 (91.92%), Query Frame = 2
Query:  377 RYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            R+SRKVFVGGLPPDIDE+EIT +F+RFG LVVDWPHKAESKSYFPPKGY FLLFQDE SVQ LID+CI DE K Y CVSSPTIKDK VQIRPW LAD+D+V+D +  LDPRKT+FVGGVPRPL+A ELAMIMDRLYGGVCY+GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH DIDKRVEVKPYVLDDQMCDEC+G RCGGKFAPFFCANVTCLQYYCE CWA IHSR GREYHKPLVKEGADRPR VPFRW
Sbjct:  444 RFSRKVFVGGLPPDIDEDEITTSFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQDESSVQQLIDSCITDEDKLYLCVSSPTIKDKAVQIRPWRLADADYVLDATMSLDPRKTVFVGGVPRPLKAFELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVLDDQMCDECEGQRCGGKFAPFFCANVTCLQYYCEHCWAVIHSRPGREYHKPLVKEGADRPRAVPFRW 703          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Fly
Match: orb2 (gene:FBgn0264307 transcript:FBtr0331513)

HSP 1 Score: 497.278 bits (1279), Expect = 2.137e-171
Identity = 226/260 (86.92%), Postives = 239/260 (91.92%), Query Frame = 2
Query:  377 RYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            R+SRKVFVGGLPPDIDE+EIT +F+RFG LVVDWPHKAESKSYFPPKGY FLLFQDE SVQ LID+CI DE K Y CVSSPTIKDK VQIRPW LAD+D+V+D +  LDPRKT+FVGGVPRPL+A ELAMIMDRLYGGVCY+GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH DIDKRVEVKPYVLDDQMCDEC+G RCGGKFAPFFCANVTCLQYYCE CWA IHSR GREYHKPLVKEGADRPR VPFRW
Sbjct:  444 RFSRKVFVGGLPPDIDEDEITTSFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQDESSVQQLIDSCITDEDKLYLCVSSPTIKDKAVQIRPWRLADADYVLDATMSLDPRKTVFVGGVPRPLKAFELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVLDDQMCDECEGQRCGGKFAPFFCANVTCLQYYCEHCWAVIHSRPGREYHKPLVKEGADRPRAVPFRW 703          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Fly
Match: orb2 (gene:FBgn0264307 transcript:FBtr0331512)

HSP 1 Score: 497.278 bits (1279), Expect = 2.137e-171
Identity = 226/260 (86.92%), Postives = 239/260 (91.92%), Query Frame = 2
Query:  377 RYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            R+SRKVFVGGLPPDIDE+EIT +F+RFG LVVDWPHKAESKSYFPPKGY FLLFQDE SVQ LID+CI DE K Y CVSSPTIKDK VQIRPW LAD+D+V+D +  LDPRKT+FVGGVPRPL+A ELAMIMDRLYGGVCY+GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH DIDKRVEVKPYVLDDQMCDEC+G RCGGKFAPFFCANVTCLQYYCE CWA IHSR GREYHKPLVKEGADRPR VPFRW
Sbjct:  444 RFSRKVFVGGLPPDIDEDEITTSFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQDESSVQQLIDSCITDEDKLYLCVSSPTIKDKAVQIRPWRLADADYVLDATMSLDPRKTVFVGGVPRPLKAFELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVLDDQMCDECEGQRCGGKFAPFFCANVTCLQYYCEHCWAVIHSRPGREYHKPLVKEGADRPRAVPFRW 703          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Fly
Match: orb2 (gene:FBgn0264307 transcript:FBtr0331514)

HSP 1 Score: 497.278 bits (1279), Expect = 2.137e-171
Identity = 226/260 (86.92%), Postives = 239/260 (91.92%), Query Frame = 2
Query:  377 RYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            R+SRKVFVGGLPPDIDE+EIT +F+RFG LVVDWPHKAESKSYFPPKGY FLLFQDE SVQ LID+CI DE K Y CVSSPTIKDK VQIRPW LAD+D+V+D +  LDPRKT+FVGGVPRPL+A ELAMIMDRLYGGVCY+GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH DIDKRVEVKPYVLDDQMCDEC+G RCGGKFAPFFCANVTCLQYYCE CWA IHSR GREYHKPLVKEGADRPR VPFRW
Sbjct:  444 RFSRKVFVGGLPPDIDEDEITTSFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQDESSVQQLIDSCITDEDKLYLCVSSPTIKDKAVQIRPWRLADADYVLDATMSLDPRKTVFVGGVPRPLKAFELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVLDDQMCDECEGQRCGGKFAPFFCANVTCLQYYCEHCWAVIHSRPGREYHKPLVKEGADRPRAVPFRW 703          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Zebrafish
Match: cpeb2 (cytoplasmic polyadenylation element binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-130530-639])

HSP 1 Score: 502.671 bits (1293), Expect = 7.764e-178
Identity = 250/362 (69.06%), Postives = 287/362 (79.28%), Query Frame = 2
Query:   71 QNFDLNTSNQNLALNASGDGSIYDSMNSTNFNYLDKISSADNMKISFDPQLFEVLRNLESKTANMSLDDNSLSNMLPGEQFNSNVLKNINPFMFSPLPQREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            +N     +N N  L       +YDS+N  +     + S  D M+   DP        L+ +++   +DD  L +   G Q    VL + + +      +R ER+SRKVFVGGLPPDIDE+EIT++F+RFG LVVDWPHKAESKSYFPPKGY FLLFQ+E SVQ LI+AC+ ++ K Y CVSSPTIKDKPVQIRPW+L+DSDFVMDGS+PLDPRKTIFVGGVPRPLRA+ELAMIMDRLYGGVCY+GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH DIDKRVEVKPYVLDDQ+CDECQG+RCGGKFAPFFCANVTCLQYYCE CWA+IHSR GRE+HKPLVKEGADRPR + FRW
Sbjct:   42 ENMFRTDNNSNTLLPLQDRSRMYDSLNMHSL----ESSLIDIMRAEQDP--------LKGRSSLFPIDDGLLDDGH-GNQGVPGVLGSPHCYPHQN-GERIERFSRKVFVGGLPPDIDEDEITSSFRRFGHLVVDWPHKAESKSYFPPKGYAFLLFQEETSVQALIEACLEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVLDDQLCDECQGARCGGKFAPFFCANVTCLQYYCEFCWANIHSRAGREFHKPLVKEGADRPRQIHFRW 389          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Zebrafish
Match: cpeb2 (cytoplasmic polyadenylation element binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-130530-639])

HSP 1 Score: 500.745 bits (1288), Expect = 8.332e-177
Identity = 252/371 (67.92%), Postives = 288/371 (77.63%), Query Frame = 2
Query:   71 QNFDLNTSNQNLALNASGDGSIYDSMNSTNFNYLDKISSADNMKISFDPQLFEV---------LRNLESKTANMSLDDNSLSNMLPGEQFNSNVLKNINPFMFSPLPQREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            +N     +N N  L       +YDS+N  +     + S  D M+   DP    V         L  L  +++   +DD  L +   G Q    VL + + +      +R ER+SRKVFVGGLPPDIDE+EIT++F+RFG LVVDWPHKAESKSYFPPKGY FLLFQ+E SVQ LI+AC+ ++ K Y CVSSPTIKDKPVQIRPW+L+DSDFVMDGS+PLDPRKTIFVGGVPRPLRA+ELAMIMDRLYGGVCY+GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH DIDKRVEVKPYVLDDQ+CDECQG+RCGGKFAPFFCANVTCLQYYCE CWA+IHSR GRE+HKPLVKEGADRPR + FRW
Sbjct:   42 ENMFRTDNNSNTLLPLQDRSRMYDSLNMHSL----ESSLIDIMRAEQDPLKGHVGCPHPGADGLLMLNGRSSLFPIDDGLLDDGH-GNQGVPGVLGSPHCYPHQN-GERIERFSRKVFVGGLPPDIDEDEITSSFRRFGHLVVDWPHKAESKSYFPPKGYAFLLFQEETSVQALIEACLEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVLDDQLCDECQGARCGGKFAPFFCANVTCLQYYCEFCWANIHSRAGREFHKPLVKEGADRPRQIHFRW 406          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Zebrafish
Match: cpeb3 (cytoplasmic polyadenylation element binding protein 3 [Source:ZFIN;Acc:ZDB-GENE-090312-68])

HSP 1 Score: 504.982 bits (1299), Expect = 8.015e-176
Identity = 234/264 (88.64%), Postives = 248/264 (93.94%), Query Frame = 2
Query:  365 QREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            +R ERYSRKVFVGGLPPDIDE+EIT +F+RFG LVVDWPHKAESKSYFPPKGY FLLFQ+E SVQ LIDACI ++ K Y CVSSPTIKDKPVQIRPW+L+DSDFVMDGS+PLDPRKTIFVGGVPRPLRA+ELAMIMDRLYGGVCY+GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH+DIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCE CWA IHSR GRE+HKPLVKEG DRPR V FRW
Sbjct:  322 ERMERYSRKVFVGGLPPDIDEDEITNSFRRFGHLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHNDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEYCWASIHSRAGREFHKPLVKEGGDRPRHVSFRW 585          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Zebrafish
Match: cpeb4a (cytoplasmic polyadenylation element binding protein 4a [Source:NCBI gene;Acc:393956])

HSP 1 Score: 504.597 bits (1298), Expect = 4.545e-175
Identity = 230/264 (87.12%), Postives = 246/264 (93.18%), Query Frame = 2
Query:  365 QREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            +R ERYSRKVFVGGLPPDIDE+EITA+F+RFG L VDWPHKAESKSYFPPKGY FLLFQDE SVQ LIDAC+ ++ K Y CVSSPTIKDKPVQIRPW+L DSDFVMDGS+PLDPRKTIFVGGVPRPLRA+ELAMIMDRLYGGVCY+GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH +IDKRVEVKPYVLDDQ+CDECQG+RCGGKFAPFFCANVTCLQYYCE CWA IHSR GRE+HKPLVKEG DRPR + FRW
Sbjct:  371 ERIERYSRKVFVGGLPPDIDEDEITASFRRFGHLFVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACMEEDGKLYLCVSSPTIKDKPVQIRPWNLNDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYVLDDQLCDECQGTRCGGKFAPFFCANVTCLQYYCEYCWAAIHSRAGREFHKPLVKEGGDRPRHISFRW 634          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Zebrafish
Match: cpeb4a (cytoplasmic polyadenylation element binding protein 4a [Source:NCBI gene;Acc:393956])

HSP 1 Score: 505.753 bits (1301), Expect = 1.436e-174
Identity = 230/264 (87.12%), Postives = 246/264 (93.18%), Query Frame = 2
Query:  365 QREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            +R ERYSRKVFVGGLPPDIDE+EITA+F+RFG L VDWPHKAESKSYFPPKGY FLLFQDE SVQ LIDAC+ ++ K Y CVSSPTIKDKPVQIRPW+L DSDFVMDGS+PLDPRKTIFVGGVPRPLRA+ELAMIMDRLYGGVCY+GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH +IDKRVEVKPYVLDDQ+CDECQG+RCGGKFAPFFCANVTCLQYYCE CWA IHSR GRE+HKPLVKEG DRPR + FRW
Sbjct:  439 ERIERYSRKVFVGGLPPDIDEDEITASFRRFGHLFVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACMEEDGKLYLCVSSPTIKDKPVQIRPWNLNDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYVLDDQLCDECQGTRCGGKFAPFFCANVTCLQYYCEYCWAAIHSRAGREFHKPLVKEGGDRPRHISFRW 702          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Xenopus
Match: CPEB2 (cytoplasmic polyadenylation element binding protein 2 [Source:NCBI gene;Acc:100492019])

HSP 1 Score: 512.686 bits (1319), Expect = 0.000e+0
Identity = 256/356 (71.91%), Postives = 285/356 (80.06%), Query Frame = 2
Query:   92 SNQNLALNASGDGSIYDSMNSTNF-NYLDKISSADNMKISFDPQLFEVLRNLESKTANMSLDDNSLSNMLPGEQFNSNVLKNINPFMFSPLPQREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            +N N  L       +YDS+N  +  N L +I     M+   DP        L+ +++   LDD  L +   G      VL + N +      +R ER+SRKVFVGGLPPDIDE+EITA+F+RFG LVVDWPHKAESKSYFPPKGY FLLFQ+E SVQ LIDACI +E K Y CVSSPTIKDKPVQIRPW+L+DSDFVMDGS+PLDPRKTIFVGGVPRPLRA+ELAMIMDRLYGGVCY+GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH DIDKRVEVKPYVLDDQMCDECQG+RCGGKFAPFFCANVTCLQYYCE CWA+IHSR GRE+HKPLVKEGADRPR + FRW
Sbjct:  101 NNSNTLLPLQDRSRMYDSLNMHSLENSLIEI-----MRAEHDP--------LKGRSSLFPLDDGLLDD---GHNDQVGVLNSPNCYSGHQNGERIERFSRKVFVGGLPPDIDEDEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACIEEEGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVLDDQMCDECQGARCGGKFAPFFCANVTCLQYYCEFCWANIHSRAGREFHKPLVKEGADRPRQIHFRW 440          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Xenopus
Match: CPEB2 (cytoplasmic polyadenylation element binding protein 2 [Source:NCBI gene;Acc:100492019])

HSP 1 Score: 513.457 bits (1321), Expect = 1.511e-180
Identity = 255/360 (70.83%), Postives = 289/360 (80.28%), Query Frame = 2
Query:   92 SNQNLALNASGDGSIYDSMNSTNF-NYLDKISSADN----MKISFDPQLFEVLRNLESKTANMSLDDNSLSNMLPGEQFNSNVLKNINPFMFSPLPQREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            +N N  L       +YDS+N  +  N L +I  A++     ++++     + L  L  +++   LDD  L +   G      VL + N +      +R ER+SRKVFVGGLPPDIDE+EITA+F+RFG LVVDWPHKAESKSYFPPKGY FLLFQ+E SVQ LIDACI +E K Y CVSSPTIKDKPVQIRPW+L+DSDFVMDGS+PLDPRKTIFVGGVPRPLRA+ELAMIMDRLYGGVCY+GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH DIDKRVEVKPYVLDDQMCDECQG+RCGGKFAPFFCANVTCLQYYCE CWA+IHSR GRE+HKPLVKEGADRPR + FRW
Sbjct:  130 NNSNTLLPLQDRSRMYDSLNMHSLENSLIEIMRAEHDPLKGRLNYPHPGTDSLLMLNGRSSLFPLDDGLLDD---GHNDQVGVLNSPNCYSGHQNGERIERFSRKVFVGGLPPDIDEDEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACIEEEGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVLDDQMCDECQGARCGGKFAPFFCANVTCLQYYCEFCWANIHSRAGREFHKPLVKEGADRPRQIHFRW 486          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Xenopus
Match: CPEB2 (cytoplasmic polyadenylation element binding protein 2 [Source:NCBI gene;Acc:100492019])

HSP 1 Score: 512.301 bits (1318), Expect = 1.566e-180
Identity = 256/356 (71.91%), Postives = 285/356 (80.06%), Query Frame = 2
Query:   92 SNQNLALNASGDGSIYDSMNSTNF-NYLDKISSADNMKISFDPQLFEVLRNLESKTANMSLDDNSLSNMLPGEQFNSNVLKNINPFMFSPLPQREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            +N N  L       +YDS+N  +  N L +I     M+   DP        L+ +++   LDD  L +   G      VL + N +      +R ER+SRKVFVGGLPPDIDE+EITA+F+RFG LVVDWPHKAESKSYFPPKGY FLLFQ+E SVQ LIDACI +E K Y CVSSPTIKDKPVQIRPW+L+DSDFVMDGS+PLDPRKTIFVGGVPRPLRA+ELAMIMDRLYGGVCY+GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH DIDKRVEVKPYVLDDQMCDECQG+RCGGKFAPFFCANVTCLQYYCE CWA+IHSR GRE+HKPLVKEGADRPR + FRW
Sbjct:  120 NNSNTLLPLQDRSRMYDSLNMHSLENSLIEI-----MRAEHDP--------LKGRSSLFPLDDGLLDD---GHNDQVGVLNSPNCYSGHQNGERIERFSRKVFVGGLPPDIDEDEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACIEEEGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVLDDQMCDECQGARCGGKFAPFFCANVTCLQYYCEFCWANIHSRAGREFHKPLVKEGADRPRQIHFRW 459          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Xenopus
Match: CPEB2 (cytoplasmic polyadenylation element binding protein 2 [Source:NCBI gene;Acc:100492019])

HSP 1 Score: 512.301 bits (1318), Expect = 3.803e-180
Identity = 255/360 (70.83%), Postives = 289/360 (80.28%), Query Frame = 2
Query:   92 SNQNLALNASGDGSIYDSMNSTNF-NYLDKISSADN----MKISFDPQLFEVLRNLESKTANMSLDDNSLSNMLPGEQFNSNVLKNINPFMFSPLPQREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            +N N  L       +YDS+N  +  N L +I  A++     ++++     + L  L  +++   LDD  L +   G      VL + N +      +R ER+SRKVFVGGLPPDIDE+EITA+F+RFG LVVDWPHKAESKSYFPPKGY FLLFQ+E SVQ LIDACI +E K Y CVSSPTIKDKPVQIRPW+L+DSDFVMDGS+PLDPRKTIFVGGVPRPLRA+ELAMIMDRLYGGVCY+GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH DIDKRVEVKPYVLDDQMCDECQG+RCGGKFAPFFCANVTCLQYYCE CWA+IHSR GRE+HKPLVKEGADRPR + FRW
Sbjct:  121 NNSNTLLPLQDRSRMYDSLNMHSLENSLIEIMRAEHDPLKGRLNYPHPGTDSLLMLNGRSSLFPLDDGLLDD---GHNDQVGVLNSPNCYSGHQNGERIERFSRKVFVGGLPPDIDEDEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACIEEEGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVLDDQMCDECQGARCGGKFAPFFCANVTCLQYYCEFCWANIHSRAGREFHKPLVKEGADRPRQIHFRW 477          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Xenopus
Match: CPEB2 (cytoplasmic polyadenylation element binding protein 2 [Source:NCBI gene;Acc:100492019])

HSP 1 Score: 513.072 bits (1320), Expect = 9.078e-180
Identity = 252/346 (72.83%), Postives = 285/346 (82.37%), Query Frame = 2
Query:  134 IYDSMNSTNF-NYLDKISSADN----MKISFDPQLFEVLRNLESKTANMSLDDNSLSNMLPGEQFNSNVLKNINPFMFSPLPQREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            +YDS+N  +  N L +I  A++     ++++     + L  L  +++   LDD  L +   G      VL + N +      +R ER+SRKVFVGGLPPDIDE+EITA+F+RFG LVVDWPHKAESKSYFPPKGY FLLFQ+E SVQ LIDACI +E K Y CVSSPTIKDKPVQIRPW+L+DSDFVMDGS+PLDPRKTIFVGGVPRPLRA+ELAMIMDRLYGGVCY+GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH DIDKRVEVKPYVLDDQMCDECQG+RCGGKFAPFFCANVTCLQYYCE CWA+IHSR GRE+HKPLVKEGADRPR + FRW
Sbjct:  183 MYDSLNMHSLENSLIEIMRAEHDPLKGRLNYPHPGTDSLLMLNGRSSLFPLDDGLLDD---GHNDQVGVLNSPNCYSGHQNGERIERFSRKVFVGGLPPDIDEDEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACIEEEGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVLDDQMCDECQGARCGGKFAPFFCANVTCLQYYCEFCWANIHSRAGREFHKPLVKEGADRPRQIHFRW 525          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Mouse
Match: Cpeb3 (cytoplasmic polyadenylation element binding protein 3 [Source:MGI Symbol;Acc:MGI:2443075])

HSP 1 Score: 506.908 bits (1304), Expect = 3.266e-179
Identity = 234/264 (88.64%), Postives = 250/264 (94.70%), Query Frame = 2
Query:  365 QREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            +R ERYSRKVFVGGLPPDIDE+EITA+F+RFG LVVDWPHKAESKSYFPPKGY FLLFQ+E SVQ LIDAC+ ++ K Y CVSSPTIKDKPVQIRPW+L+DSDFVMDGS+PLDPRKTIFVGGVPRPLRA+ELAMIMDRLYGGVCY+GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH+DIDKRVEVKPYVLDDQMCDECQG+RCGGKFAPFFCANVTCLQYYCE CWA IHSR GRE+HKPLVKEG DRPR VPFRW
Sbjct:  151 ERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACLEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHNDIDKRVEVKPYVLDDQMCDECQGTRCGGKFAPFFCANVTCLQYYCEYCWASIHSRAGREFHKPLVKEGGDRPRHVPFRW 414          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Mouse
Match: Cpeb3 (cytoplasmic polyadenylation element binding protein 3 [Source:MGI Symbol;Acc:MGI:2443075])

HSP 1 Score: 506.908 bits (1304), Expect = 3.266e-179
Identity = 234/264 (88.64%), Postives = 250/264 (94.70%), Query Frame = 2
Query:  365 QREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            +R ERYSRKVFVGGLPPDIDE+EITA+F+RFG LVVDWPHKAESKSYFPPKGY FLLFQ+E SVQ LIDAC+ ++ K Y CVSSPTIKDKPVQIRPW+L+DSDFVMDGS+PLDPRKTIFVGGVPRPLRA+ELAMIMDRLYGGVCY+GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH+DIDKRVEVKPYVLDDQMCDECQG+RCGGKFAPFFCANVTCLQYYCE CWA IHSR GRE+HKPLVKEG DRPR VPFRW
Sbjct:  151 ERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACLEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHNDIDKRVEVKPYVLDDQMCDECQGTRCGGKFAPFFCANVTCLQYYCEYCWASIHSRAGREFHKPLVKEGGDRPRHVPFRW 414          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Mouse
Match: Cpeb3 (cytoplasmic polyadenylation element binding protein 3 [Source:MGI Symbol;Acc:MGI:2443075])

HSP 1 Score: 513.457 bits (1321), Expect = 7.549e-178
Identity = 234/264 (88.64%), Postives = 250/264 (94.70%), Query Frame = 2
Query:  365 QREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            +R ERYSRKVFVGGLPPDIDE+EITA+F+RFG LVVDWPHKAESKSYFPPKGY FLLFQ+E SVQ LIDAC+ ++ K Y CVSSPTIKDKPVQIRPW+L+DSDFVMDGS+PLDPRKTIFVGGVPRPLRA+ELAMIMDRLYGGVCY+GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH+DIDKRVEVKPYVLDDQMCDECQG+RCGGKFAPFFCANVTCLQYYCE CWA IHSR GRE+HKPLVKEG DRPR VPFRW
Sbjct:  421 ERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACLEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHNDIDKRVEVKPYVLDDQMCDECQGTRCGGKFAPFFCANVTCLQYYCEYCWASIHSRAGREFHKPLVKEGGDRPRHVPFRW 684          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Mouse
Match: Cpeb3 (cytoplasmic polyadenylation element binding protein 3 [Source:MGI Symbol;Acc:MGI:2443075])

HSP 1 Score: 513.457 bits (1321), Expect = 7.549e-178
Identity = 234/264 (88.64%), Postives = 250/264 (94.70%), Query Frame = 2
Query:  365 QREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            +R ERYSRKVFVGGLPPDIDE+EITA+F+RFG LVVDWPHKAESKSYFPPKGY FLLFQ+E SVQ LIDAC+ ++ K Y CVSSPTIKDKPVQIRPW+L+DSDFVMDGS+PLDPRKTIFVGGVPRPLRA+ELAMIMDRLYGGVCY+GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH+DIDKRVEVKPYVLDDQMCDECQG+RCGGKFAPFFCANVTCLQYYCE CWA IHSR GRE+HKPLVKEG DRPR VPFRW
Sbjct:  421 ERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACLEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHNDIDKRVEVKPYVLDDQMCDECQGTRCGGKFAPFFCANVTCLQYYCEYCWASIHSRAGREFHKPLVKEGGDRPRHVPFRW 684          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Mouse
Match: Cpeb3 (cytoplasmic polyadenylation element binding protein 3 [Source:MGI Symbol;Acc:MGI:2443075])

HSP 1 Score: 513.457 bits (1321), Expect = 1.131e-177
Identity = 234/264 (88.64%), Postives = 250/264 (94.70%), Query Frame = 2
Query:  365 QREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            +R ERYSRKVFVGGLPPDIDE+EITA+F+RFG LVVDWPHKAESKSYFPPKGY FLLFQ+E SVQ LIDAC+ ++ K Y CVSSPTIKDKPVQIRPW+L+DSDFVMDGS+PLDPRKTIFVGGVPRPLRA+ELAMIMDRLYGGVCY+GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH+DIDKRVEVKPYVLDDQMCDECQG+RCGGKFAPFFCANVTCLQYYCE CWA IHSR GRE+HKPLVKEG DRPR VPFRW
Sbjct:  429 ERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACLEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHNDIDKRVEVKPYVLDDQMCDECQGTRCGGKFAPFFCANVTCLQYYCEYCWASIHSRAGREFHKPLVKEGGDRPRHVPFRW 692          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. UniProt/SwissProt
Match: sp|Q812E0|CPEB2_MOUSE (Cytoplasmic polyadenylation element-binding protein 2 OS=Mus musculus OX=10090 GN=Cpeb2 PE=1 SV=1)

HSP 1 Score: 508.834 bits (1309), Expect = 2.060e-177
Identity = 250/346 (72.25%), Postives = 284/346 (82.08%), Query Frame = 2
Query:  134 IYDSMNSTNF-NYLDKISSADN----MKISFDPQLFEVLRNLESKTANMSLDDNSLSNMLPGEQFNSNVLKNINPFMFSPLPQREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            +YDS+N  +  N L  I  A++     ++S+     + L  L  +++   +DD+ L +   G      VL +   +      +R ER+SRKVFVGGLPPDIDE+EITA+F+RFG LVVDWPHKAESKSYFPPKGY FLLFQ+E SVQ LIDACI ++ K Y CVSSPTIKDKPVQIRPW+L+DSDFVMDGS+PLDPRKTIFVGGVPRPLRA+ELAMIMDRLYGGVCY+GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH DIDKRVEVKPYVLDDQMCDECQG+RCGGKFAPFFCANVTCLQYYCE CWA+IHSR GRE+HKPLVKEGADRPR + FRW
Sbjct:  178 MYDSLNMHSLENSLIDIMRAEHDPLKGRLSYPHPGTDNLLMLNGRSSLFPIDDSLLDD---GHSDQVGVLNSPTCYSAHQNGERIERFSRKVFVGGLPPDIDEDEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVLDDQMCDECQGARCGGKFAPFFCANVTCLQYYCEFCWANIHSRAGREFHKPLVKEGADRPRQIHFRW 520          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. UniProt/SwissProt
Match: sp|Q28CH2|CPEB3_XENTR (Cytoplasmic polyadenylation element-binding protein 3 OS=Xenopus tropicalis OX=8364 GN=cpeb3 PE=2 SV=1)

HSP 1 Score: 510.375 bits (1313), Expect = 1.956e-176
Identity = 233/264 (88.26%), Postives = 249/264 (94.32%), Query Frame = 2
Query:  365 QREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            +R ERYSRKVFVGGLPPDIDE+EITA+F+RFG LVVDWPHKAESKSYFPPKGY FLLFQ+E SVQ LIDAC+ ++ K Y CVSSPTIKDKPVQIRPW+L+DSDFVMDGS+PLDPRKTIFVGGVPRPLRA+ELAMIMDRLYGGVCY+GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH+DIDKRVEVKPYVLDDQMCDECQG+RCGGKFAPFFCANVTCLQYYCE CWA IHSR GRE+HKPLVKEG DRPR VPF W
Sbjct:  368 ERIERYSRKVFVGGLPPDIDEDEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACLEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHNDIDKRVEVKPYVLDDQMCDECQGTRCGGKFAPFFCANVTCLQYYCEYCWASIHSRAGREFHKPLVKEGGDRPRHVPFHW 631          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. UniProt/SwissProt
Match: sp|Q8NE35|CPEB3_HUMAN (Cytoplasmic polyadenylation element-binding protein 3 OS=Homo sapiens OX=9606 GN=CPEB3 PE=1 SV=2)

HSP 1 Score: 512.301 bits (1318), Expect = 2.184e-176
Identity = 234/264 (88.64%), Postives = 250/264 (94.70%), Query Frame = 2
Query:  365 QREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            +R ERYSRKVFVGGLPPDIDE+EITA+F+RFG LVVDWPHKAESKSYFPPKGY FLLFQ+E SVQ LIDAC+ ++ K Y CVSSPTIKDKPVQIRPW+L+DSDFVMDGS+PLDPRKTIFVGGVPRPLRA+ELAMIMDRLYGGVCY+GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH+DIDKRVEVKPYVLDDQMCDECQG+RCGGKFAPFFCANVTCLQYYCE CWA IHSR GRE+HKPLVKEG DRPR VPFRW
Sbjct:  434 ERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACLEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHNDIDKRVEVKPYVLDDQMCDECQGTRCGGKFAPFFCANVTCLQYYCEYCWASIHSRAGREFHKPLVKEGGDRPRHVPFRW 697          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. UniProt/SwissProt
Match: sp|Q7TN99|CPEB3_MOUSE (Cytoplasmic polyadenylation element-binding protein 3 OS=Mus musculus OX=10090 GN=Cpeb3 PE=1 SV=1)

HSP 1 Score: 513.072 bits (1320), Expect = 2.323e-176
Identity = 234/264 (88.64%), Postives = 250/264 (94.70%), Query Frame = 2
Query:  365 QREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            +R ERYSRKVFVGGLPPDIDE+EITA+F+RFG LVVDWPHKAESKSYFPPKGY FLLFQ+E SVQ LIDAC+ ++ K Y CVSSPTIKDKPVQIRPW+L+DSDFVMDGS+PLDPRKTIFVGGVPRPLRA+ELAMIMDRLYGGVCY+GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH+DIDKRVEVKPYVLDDQMCDECQG+RCGGKFAPFFCANVTCLQYYCE CWA IHSR GRE+HKPLVKEG DRPR VPFRW
Sbjct:  452 ERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACLEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHNDIDKRVEVKPYVLDDQMCDECQGTRCGGKFAPFFCANVTCLQYYCEYCWASIHSRAGREFHKPLVKEGGDRPRHVPFRW 715          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. UniProt/SwissProt
Match: sp|Q7Z5Q1|CPEB2_HUMAN (Cytoplasmic polyadenylation element-binding protein 2 OS=Homo sapiens OX=9606 GN=CPEB2 PE=2 SV=3)

HSP 1 Score: 508.449 bits (1308), Expect = 2.383e-176
Identity = 250/346 (72.25%), Postives = 283/346 (81.79%), Query Frame = 2
Query:  134 IYDSMNSTNF-NYLDKISSADN----MKISFDPQLFEVLRNLESKTANMSLDDNSLSNMLPGEQFNSNVLKNINPFMFSPLPQREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            +YDS+N  +  N L  I  A++     ++S+     + L  L  +++   +DD  L +   G      VL +   +      +R ER+SRKVFVGGLPPDIDE+EITA+F+RFG LVVDWPHKAESKSYFPPKGY FLLFQ+E SVQ LIDACI ++ K Y CVSSPTIKDKPVQIRPW+L+DSDFVMDGS+PLDPRKTIFVGGVPRPLRA+ELAMIMDRLYGGVCY+GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH DIDKRVEVKPYVLDDQMCDECQG+RCGGKFAPFFCANVTCLQYYCE CWA+IHSR GRE+HKPLVKEGADRPR + FRW
Sbjct:  246 MYDSLNMHSLENSLIDIMRAEHDPLKGRLSYPHPGTDNLLMLNGRSSLFPIDDGLLDD---GHSDQVGVLNSPTCYSAHQNGERIERFSRKVFVGGLPPDIDEDEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVLDDQMCDECQGARCGGKFAPFFCANVTCLQYYCEFCWANIHSRAGREFHKPLVKEGADRPRQIHFRW 588          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. TrEMBL
Match: A0A219TTV5 (Cytoplasmic polyadenylation element binding protein 2 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 808.52 bits (2087), Expect = 0.000e+0
Identity = 378/378 (100.00%), Postives = 378/378 (100.00%), Query Frame = 2
Query:   23 SQIAKSAINGNCNSKSQNFDLNTSNQNLALNASGDGSIYDSMNSTNFNYLDKISSADNMKISFDPQLFEVLRNLESKTANMSLDDNSLSNMLPGEQFNSNVLKNINPFMFSPLPQREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            SQIAKSAINGNCNSKSQNFDLNTSNQNLALNASGDGSIYDSMNSTNFNYLDKISSADNMKISFDPQLFEVLRNLESKTANMSLDDNSLSNMLPGEQFNSNVLKNINPFMFSPLPQREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW
Sbjct:  457 SQIAKSAINGNCNSKSQNFDLNTSNQNLALNASGDGSIYDSMNSTNFNYLDKISSADNMKISFDPQLFEVLRNLESKTANMSLDDNSLSNMLPGEQFNSNVLKNINPFMFSPLPQREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 834          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. TrEMBL
Match: A0A1W6I181 (Cytoplasmic polyadenylation element-binding protein 2 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 807.364 bits (2084), Expect = 0.000e+0
Identity = 377/378 (99.74%), Postives = 378/378 (100.00%), Query Frame = 2
Query:   23 SQIAKSAINGNCNSKSQNFDLNTSNQNLALNASGDGSIYDSMNSTNFNYLDKISSADNMKISFDPQLFEVLRNLESKTANMSLDDNSLSNMLPGEQFNSNVLKNINPFMFSPLPQREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            SQIAKSAINGNCNSKSQNFDLNTSNQNLALNASGDGSIYDS+NSTNFNYLDKISSADNMKISFDPQLFEVLRNLESKTANMSLDDNSLSNMLPGEQFNSNVLKNINPFMFSPLPQREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW
Sbjct:  471 SQIAKSAINGNCNSKSQNFDLNTSNQNLALNASGDGSIYDSINSTNFNYLDKISSADNMKISFDPQLFEVLRNLESKTANMSLDDNSLSNMLPGEQFNSNVLKNINPFMFSPLPQREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 848          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. TrEMBL
Match: A0A0V0J7I6 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR136726 PE=4 SV=1)

HSP 1 Score: 546.199 bits (1406), Expect = 0.000e+0
Identity = 259/361 (71.75%), Postives = 289/361 (80.06%), Query Frame = 2
Query:  173 DKISSADNMKISFDPQLFEVLRNLE---SKTANMSLDDNSLSNMLPGEQFNSNVLKNIN-----------------------------PFMF-SPLPQREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            +K+S+ D  K  FD QL EV++ L+   S T N+ LDD SL N+   + F S ++  I+                             P+ F S +  REE YSRKVFVGGLPPDIDEEEIT AF+RFG L+VDWPHK ESK+YFPPKGYCFLLFQ+E SVQNLI ACI+DE+KYYWCVSSPT+KDKPVQIRPW+LADSDFVMDGS+PLDPRKTIFVGGVPRPLRAIELA+IMDRLYGGVCY+GID DPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH+DIDKRVEVKPYVLD+QMCDECQG+RCGGKFAPFFCANVTCLQYYCEQCW  IHS  GREYHKPLVKEGA+RPR   +RW
Sbjct:  589 EKLSTLDPFKFGFDSQLLEVIKTLDANSSATTNL-LDDLSLKNLATSDGFQSAMMNQISGVPPPSCRTSGSILSSTGFQNQTLTGMGPPYAFLSGMSPREEGYSRKVFVGGLPPDIDEEEITTAFRRFGPLIVDWPHKTESKAYFPPKGYCFLLFQEEQSVQNLISACIVDENKYYWCVSSPTMKDKPVQIRPWNLADSDFVMDGSQPLDPRKTIFVGGVPRPLRAIELALIMDRLYGGVCYAGIDIDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHNDIDKRVEVKPYVLDNQMCDECQGTRCGGKFAPFFCANVTCLQYYCEQCWVQIHSHHGREYHKPLVKEGAERPRPALYRW 948          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. TrEMBL
Match: A0A210PP73 (Cytoplasmic polyadenylation element-binding protein 2 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT17209 PE=4 SV=1)

HSP 1 Score: 536.184 bits (1380), Expect = 0.000e+0
Identity = 260/355 (73.24%), Postives = 289/355 (81.41%), Query Frame = 2
Query:  131 SIYDSMNSTNFNYLDKISSADNMKIS-FDPQLFEVLRN-------LESKTA---NMSLDDNSLSNMLPGEQFNSNVLKNINPFMFSPLPQRE--ERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            S+ DS       Y D+  S D+M+ S F+ QL +++R+       L+ K        LD++ L     G  F+            SP  Q E  ER+SRKVFVGGLPPDIDEEEITAAF+RFG LVVDWPHKAESKSYFPPKGYCFLLFQDE+SVQ LI++CI+D+ K YWCVSSPT+KDKPVQIRPW+L+DSDFVMDGS+PLDPRKTIFVGGVPRPLRA+ELAMIMDRLYGGVCY+GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH +IDKRVEVKPYVLDDQMCDECQG+RCGGKFAPFFCANVTCLQYYCE CWA IHSR GRE+HKPLVKEGADRPR VPFRW
Sbjct:  290 SLDDSQRDAVLTYQDRSGSYDSMRFSSFETQLLDIMRSTGDPNEALKGKPTFGFGEGLDEDGLDQS--GGSFHGGSQG-------SPGSQGERIERFSRKVFVGGLPPDIDEEEITAAFRRFGALVVDWPHKAESKSYFPPKGYCFLLFQDEMSVQALIESCIVDDDKLYWCVSSPTMKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYVLDDQMCDECQGARCGGKFAPFFCANVTCLQYYCEHCWAQIHSRPGREFHKPLVKEGADRPRAVPFRW 635          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. TrEMBL
Match: A0A2T7PBJ3 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_10068 PE=4 SV=1)

HSP 1 Score: 535.413 bits (1378), Expect = 0.000e+0
Identity = 264/372 (70.97%), Postives = 290/372 (77.96%), Query Frame = 2
Query:   98 QNLALNASGDGSIYDSMNSTNFNYLDKISSADNMKI-SFDPQLFEVLRN----------LESKTA--------NMSLDDNSLSNMLPGEQFNSNVLKNINPFMFSPLPQREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            + L LN S D  I+     T   Y D+    D MK  + + QL +++R            +SK          N  L+D SL   +P     +    + N  M     +R ERYSRKVFVGGLPPDIDEEEITAAF+RFG LVVDWPHKAESKSYFPPKGYCFL+FQDE+SVQNLID C++DE K YWCVSSPT+KDKPVQIRPW+L+DSDFVMDGS+PLDPRKTIFVGGVPRPLRA+ELAMIMDRLYGGVCY+GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH DIDKRVEVKPYVLDDQMCDEC GSRC GKFAPFFCANVTCLQYYCE CWA IHSR GRE+HKPLVKEGADRPR VPFRW
Sbjct:  268 KQLDLNTSDDVGIHREGLVT---YQDRTGQFDTMKFPALENQLLDIMRTASMEHHSHEGFKSKIPYFSYLIEENHLLEDGSLDQTVPS--LGTPPHSSPNSGM-----ERIERYSRKVFVGGLPPDIDEEEITAAFRRFGPLVVDWPHKAESKSYFPPKGYCFLIFQDELSVQNLIDMCLVDEEKLYWCVSSPTMKDKPVQIRPWTLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVLDDQMCDECHGSRCAGKFAPFFCANVTCLQYYCEYCWAQIHSRPGREFHKPLVKEGADRPRAVPFRW 629          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Cavefish
Match: ENSAMXT00000057037.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000743.1:747:25198:1 gene:ENSAMXG00000013453.2 transcript:ENSAMXT00000057037.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 498.434 bits (1282), Expect = 3.722e-176
Identity = 231/264 (87.50%), Postives = 246/264 (93.18%), Query Frame = 2
Query:  365 QREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            +R ERYSRKVFVGGLPPDIDE+EITA+F+RFG L VDWPHKAESKSYFPPKGY FLLFQDE SVQ LIDACI ++ K Y CVSSPTIKDKPVQIRPW+L DSDFVMDGS+PLDPRKTIFVGGVPRPLRA+ELAMIMDRLYGGVCY+GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH +IDKRVEVKPYVLDDQ+CDECQG+RCGGKFAPFFCANVTCLQYYCE CWA IHSR GRE+HKPLVKEG DRPR + FRW
Sbjct:  135 ERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLFVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLNDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYVLDDQLCDECQGTRCGGKFAPFFCANVTCLQYYCEYCWAAIHSRAGREFHKPLVKEGGDRPRHISFRW 398          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Cavefish
Match: ENSAMXT00000013842.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000743.1:54:25198:1 gene:ENSAMXG00000013453.2 transcript:ENSAMXT00000013842.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 503.442 bits (1295), Expect = 5.379e-175
Identity = 231/264 (87.50%), Postives = 246/264 (93.18%), Query Frame = 2
Query:  365 QREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            +R ERYSRKVFVGGLPPDIDE+EITA+F+RFG L VDWPHKAESKSYFPPKGY FLLFQDE SVQ LIDACI ++ K Y CVSSPTIKDKPVQIRPW+L DSDFVMDGS+PLDPRKTIFVGGVPRPLRA+ELAMIMDRLYGGVCY+GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH +IDKRVEVKPYVLDDQ+CDECQG+RCGGKFAPFFCANVTCLQYYCE CWA IHSR GRE+HKPLVKEG DRPR + FRW
Sbjct:  349 ERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLFVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLNDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYVLDDQLCDECQGTRCGGKFAPFFCANVTCLQYYCEYCWAAIHSRAGREFHKPLVKEGGDRPRHISFRW 612          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Cavefish
Match: cpeb4a (cytoplasmic polyadenylation element-binding protein 4 [Source:NCBI gene;Acc:103023840])

HSP 1 Score: 504.597 bits (1298), Expect = 5.210e-174
Identity = 230/264 (87.12%), Postives = 246/264 (93.18%), Query Frame = 2
Query:  365 QREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            +R ERYSRKVFVGGLPPDIDE+EITA+F+RFG L VDWPHKAESKSYFPPKGY FLLFQ+E SVQ LIDAC+ +E K Y CVSSPTIKDKPVQIRPW+L DSDFVMDGS+PLDPRKTIFVGGVPRPLRA+ELAMIMDRLYGGVCY+GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH +IDKRVEVKPYVLDDQ+CDECQG+RCGGKFAPFFCANVTCLQYYCE CWA IHSR GRE+HKPLVKEG DRPR + FRW
Sbjct:  453 ERIERYSRKVFVGGLPPDIDEDEITASFRRFGHLFVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACMEEEGKLYLCVSSPTIKDKPVQIRPWNLNDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYVLDDQLCDECQGTRCGGKFAPFFCANVTCLQYYCEYCWAAIHSRAGREFHKPLVKEGGDRPRHISFRW 716          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Cavefish
Match: cpeb4a (cytoplasmic polyadenylation element-binding protein 4 [Source:NCBI gene;Acc:103023840])

HSP 1 Score: 504.597 bits (1298), Expect = 8.593e-174
Identity = 230/264 (87.12%), Postives = 246/264 (93.18%), Query Frame = 2
Query:  365 QREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            +R ERYSRKVFVGGLPPDIDE+EITA+F+RFG L VDWPHKAESKSYFPPKGY FLLFQ+E SVQ LIDAC+ +E K Y CVSSPTIKDKPVQIRPW+L DSDFVMDGS+PLDPRKTIFVGGVPRPLRA+ELAMIMDRLYGGVCY+GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH +IDKRVEVKPYVLDDQ+CDECQG+RCGGKFAPFFCANVTCLQYYCE CWA IHSR GRE+HKPLVKEG DRPR + FRW
Sbjct:  470 ERIERYSRKVFVGGLPPDIDEDEITASFRRFGHLFVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACMEEEGKLYLCVSSPTIKDKPVQIRPWNLNDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYVLDDQLCDECQGTRCGGKFAPFFCANVTCLQYYCEYCWAAIHSRAGREFHKPLVKEGGDRPRHISFRW 733          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Cavefish
Match: cpeb4a (cytoplasmic polyadenylation element-binding protein 4 [Source:NCBI gene;Acc:103023840])

HSP 1 Score: 504.982 bits (1299), Expect = 8.639e-174
Identity = 230/264 (87.12%), Postives = 246/264 (93.18%), Query Frame = 2
Query:  365 QREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            +R ERYSRKVFVGGLPPDIDE+EITA+F+RFG L VDWPHKAESKSYFPPKGY FLLFQ+E SVQ LIDAC+ +E K Y CVSSPTIKDKPVQIRPW+L DSDFVMDGS+PLDPRKTIFVGGVPRPLRA+ELAMIMDRLYGGVCY+GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH +IDKRVEVKPYVLDDQ+CDECQG+RCGGKFAPFFCANVTCLQYYCE CWA IHSR GRE+HKPLVKEG DRPR + FRW
Sbjct:  478 ERIERYSRKVFVGGLPPDIDEDEITASFRRFGHLFVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACMEEEGKLYLCVSSPTIKDKPVQIRPWNLNDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYVLDDQLCDECQGTRCGGKFAPFFCANVTCLQYYCEYCWAAIHSRAGREFHKPLVKEGGDRPRHISFRW 741          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Sea Lamprey
Match: cpeb4a (cytoplasmic polyadenylation element binding protein 4a [Source:NCBI gene;Acc:393956])

HSP 1 Score: 503.056 bits (1294), Expect = 6.856e-180
Identity = 234/261 (89.66%), Postives = 247/261 (94.64%), Query Frame = 2
Query:  374 ERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            ERYSRKVFVGGLPPDIDE+EITA+F+RFG LVVDWPHKAESKSYFPPKGY FLLFQ+E SVQ LIDACI +E K Y CVSSPTIKDKPVQIRPW+L+DSDFVMDGS+PLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCY+GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH DIDKRVEVKPYVLDDQMCDECQG+RCGGKFAPFFCANVTCLQYYCE CWA IHSR GRE+HKPLVKEGADRPR + +RW
Sbjct:   61 ERYSRKVFVGGLPPDIDEDEITASFRRFGMLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACIKEEDKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVLDDQMCDECQGARCGGKFAPFFCANVTCLQYYCEHCWASIHSRAGREFHKPLVKEGADRPRHISYRW 321          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009811.1 (pep scaffold:Pmarinus_7.0:GL480497:1015:8265:1 gene:ENSPMAG00000008870.1 transcript:ENSPMAT00000009811.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 210.69 bits (535), Expect = 2.723e-64
Identity = 107/267 (40.07%), Postives = 162/267 (60.67%), Query Frame = 2
Query:  359 LPQREER---YSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESK------YYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADR 1132
            LP R  +   +S KVF+GG+P DI E  +   FK FG++ V+WP K      +PPKGY ++LF+ E SV+ L+ AC  D         YY+ VSS  ++ K VQ+ PW L+DS++V   S+ LDP KT+FVG +   L A  L  IM+ L+GGV Y+GIDTD   +YP G+GRV F+N +SY+ A++A F++++     K+++V PY L++ +C       C  +  P+FC  + C +Y+C+ CW   HS +   +H+PL++    R
Sbjct:  138 LPPRSHKSPIFSPKVFLGGVPWDITEAGLINCFKMFGSVSVEWPGKDGKHPRYPPKGYVYILFESEKSVRALLQACTHDFRSSDGCGDYYYKVSSRRMRCKEVQVIPWVLSDSNYVRSQSQRLDPSKTVFVGALHGMLNAEGLTTIMNDLFGGVVYAGIDTDKH-RYPIGSGRVTFNNHKSYMKAVNAAFIEIKTPKFTKKLQVDPY-LEESICQ-----LCCSQAGPYFCREMACFKYFCKSCWHWQHSLETLRHHQPLMRNQKSR 397          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Nematostella
Match: EDO48703 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIG6])

HSP 1 Score: 484.182 bits (1245), Expect = 4.867e-173
Identity = 226/260 (86.92%), Postives = 240/260 (92.31%), Query Frame = 2
Query:  377 RYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            R+SRKVFVGGLPPDIDE+EI A+F RFG+L VDWPHKAESKSYFPPKGY FLL+ +EISVQ LI AC   + K Y CVSSPTIKDKPVQIRPW+LAD+DFVMDGS+ LDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCY+GID DPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH DIDKRVEVKPYVLDDQ+CDEC G+RC GKFAPFFCANVTCLQYYCEQCWA IHSR GRE+HKPLVKEGADRPRTVPFRW
Sbjct:   11 RFSRKVFVGGLPPDIDEDEIHASFCRFGSLTVDWPHKAESKSYFPPKGYAFLLYLEEISVQKLISACFRQDDKLYLCVSSPTIKDKPVQIRPWNLADADFVMDGSQALDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYAGIDVDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVLDDQLCDECHGARCAGKFAPFFCANVTCLQYYCEQCWAIIHSRAGREFHKPLVKEGADRPRTVPFRW 270          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Nematostella
Match: EDO28156 (pep supercontig:ASM20922v1:NEMVEscaffold_2549:12231:13210:-1 gene:NEMVEDRAFT_v1g148668 transcript:EDO28156 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 166.007 bits (419), Expect = 6.198e-51
Identity = 75/83 (90.36%), Postives = 78/83 (93.98%), Query Frame = 2
Query:  908 LQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            LQH DIDKRVEVKPYVLDDQ+CDEC G+RC GKFAPFFCANVTCLQYYCEQCWA IHSR GRE+HKPLVKEGADRPRTVPFRW
Sbjct:    2 LQHGDIDKRVEVKPYVLDDQLCDECHGARCAGKFAPFFCANVTCLQYYCEQCWAIIHSRAGREFHKPLVKEGADRPRTVPFRW 84          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Nematostella
Match: EDO46538 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPN2])

HSP 1 Score: 139.813 bits (351), Expect = 9.315e-40
Identity = 68/163 (41.72%), Postives = 101/163 (61.96%), Query Frame = 2
Query:  623 IKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPL 1111
            ++ K VQ+ PW L+D+++V    + LD   T+FVGG+   L A  LA IM+ L+GGV Y+GIDTD   +YP G+GRV F N +S++ A+ A F++++     K+V+V PY L+D +C+ C  +       PFFC   +C +YYC  CW   HS +G   H+PL
Sbjct:    1 MRCKEVQVIPWVLSDTNYVRGPHQRLDTSWTVFVGGLHGMLNAEGLAYIMNELFGGVVYAGIDTDKH-RYPIGSGRVTFDNHKSFMNAVRAGFIEIETPKFTKKVQVDPY-LEDSLCETCHSTP-----GPFFCREESCFRYYCHSCWLWHHSIEGFRDHRPL 156          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Medaka
Match: cpeb4a (cytoplasmic polyadenylation element-binding protein 4-like [Source:NCBI gene;Acc:101160327])

HSP 1 Score: 499.975 bits (1286), Expect = 5.545e-178
Identity = 243/324 (75.00%), Postives = 270/324 (83.33%), Query Frame = 2
Query:  203 ISFDPQLFEVLR-NLESKTANMSL----DDNSLSNMLPGEQFNSNVLKNINPFMFSPL-PQREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            +S +  L +++R   +S   N SL    D+ S +     E  +  +   ++   F  L  +R ERYSRKVFVGGLPPDIDE+EITA+F+RFG L VDWPHKAESKSYFPPKGY FLLFQDE SVQ LIDACI ++ K Y CVSSPTIKDKPVQIRPW+L DSDFVMDGS+PLDPRKTIFVGGVPRPLRA+ELAMIMDRLYGGVCY+GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH +IDKRVEVKPYVLDDQ+CDECQG+RCGGKFAPFFCANVTCLQYYCE CWA IHSR GRE+HKPLVKEG DRPR + FRW
Sbjct:    2 VSLENSLIDIMRAEQDSLKGNSSLFPVEDERSFAE---DESVDQGLAGLVSAHCFPHLNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGHLFVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIQEDGKLYLCVSSPTIKDKPVQIRPWNLNDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYVLDDQLCDECQGTRCGGKFAPFFCANVTCLQYYCEYCWAAIHSRAGREFHKPLVKEGGDRPRHISFRW 322          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Medaka
Match: cpeb3 (cytoplasmic polyadenylation element binding protein 3 [Source:NCBI gene;Acc:101157316])

HSP 1 Score: 503.827 bits (1296), Expect = 5.516e-175
Identity = 232/264 (87.88%), Postives = 248/264 (93.94%), Query Frame = 2
Query:  365 QREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            +R ERYSRKVFVGGLPPDIDE+EIT +F+R+G LVVDWPHKAESKSYFPPKGY FLLFQ+E SVQ LIDACI ++ K Y CVSSPTIKDKPVQIRPW+L+DSDFVMDGS+PLDPRKTIFVGGVPRPLRA+ELAMIMDRLYGGVCY+GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH+DIDKRVEVKPYVLDDQMCDECQG+RCGGKFAPFFCANVTCLQYYCE CWA IHSR GRE+HKPLVKEG DRPR V FRW
Sbjct:  355 ERMERYSRKVFVGGLPPDIDEDEITNSFRRYGHLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHNDIDKRVEVKPYVLDDQMCDECQGARCGGKFAPFFCANVTCLQYYCEYCWASIHSRAGREFHKPLVKEGGDRPRHVSFRW 618          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Medaka
Match: cpeb2 (cytoplasmic polyadenylation element binding protein 2 [Source:NCBI gene;Acc:101169847])

HSP 1 Score: 506.908 bits (1304), Expect = 1.828e-174
Identity = 240/302 (79.47%), Postives = 267/302 (88.41%), Query Frame = 2
Query:  251 KTANMSLDDNSLSNMLPGEQFNSNVLKNINPFMFSPLPQREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            +++   +DDN L +  PG Q    VL + N +      +R ER+SRKVFVGGLPPDIDE+EIT++F+RFG LVVDWPHKAESKSYFPPKGY FLLFQ+E SVQ LI+AC+ ++ K Y CVSSPTIKDKPVQIRPW+L+DSDFVMDGS+PLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCY+GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH DIDKRVEVKPYVLDDQ+CDECQG+RCGGKFAPFFCANVTCLQYYCE CWA+IHSR GRE+HKPLVKEGADRPR + FRW
Sbjct:  455 RSSLFPIDDNLLDDG-PGSQGVPGVLSSPNCYPHQ-NGERIERFSRKVFVGGLPPDIDEDEITSSFRRFGHLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIEACMEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVLDDQLCDECQGARCGGKFAPFFCANVTCLQYYCEFCWANIHSRAGREFHKPLVKEGADRPRQIHFRW 754          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Medaka
Match: CPEB4 (cytoplasmic polyadenylation element binding protein 4 [Source:NCBI gene;Acc:101172999])

HSP 1 Score: 505.753 bits (1301), Expect = 4.576e-174
Identity = 231/264 (87.50%), Postives = 246/264 (93.18%), Query Frame = 2
Query:  365 QREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            +R ERYSRKVFVGGLPPDIDE+EITA+F+RFG L VDWPHKAESKSYFPPKGY FLLFQDE SVQ LIDACI ++ K Y CVSSPTIKDKPVQIRPW+L DSDFVMDGS+PLDPRKTIFVGGVPRPLRA+ELAMIMDRLYGGVCY+GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH +IDKRVEVKPYVLDDQ+CDECQG+RCGGKFAPFFCANVTCLQYYCE CWA IHSR GRE+HKPLVKEG DRPR + FRW
Sbjct:  478 ERVERYSRKVFVGGLPPDIDEDEITASFRRFGHLFVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLNDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYVLDDQLCDECQGTRCGGKFAPFFCANVTCLQYYCEYCWAAIHSRAGREFHKPLVKEGGDRPRHISFRW 741          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Medaka
Match: CPEB4 (cytoplasmic polyadenylation element binding protein 4 [Source:NCBI gene;Acc:101172999])

HSP 1 Score: 505.753 bits (1301), Expect = 4.576e-174
Identity = 231/264 (87.50%), Postives = 246/264 (93.18%), Query Frame = 2
Query:  365 QREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            +R ERYSRKVFVGGLPPDIDE+EITA+F+RFG L VDWPHKAESKSYFPPKGY FLLFQDE SVQ LIDACI ++ K Y CVSSPTIKDKPVQIRPW+L DSDFVMDGS+PLDPRKTIFVGGVPRPLRA+ELAMIMDRLYGGVCY+GIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQH +IDKRVEVKPYVLDDQ+CDECQG+RCGGKFAPFFCANVTCLQYYCE CWA IHSR GRE+HKPLVKEG DRPR + FRW
Sbjct:  478 ERVERYSRKVFVGGLPPDIDEDEITASFRRFGHLFVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLNDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYVLDDQLCDECQGTRCGGKFAPFFCANVTCLQYYCEYCWAAIHSRAGREFHKPLVKEGGDRPRHISFRW 741          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Planmine SMEST
Match: SMESG000055629.1 (SMESG000055629.1)

HSP 1 Score: 808.905 bits (2088), Expect = 0.000e+0
Identity = 378/378 (100.00%), Postives = 378/378 (100.00%), Query Frame = 2
Query:   23 SQIAKSAINGNCNSKSQNFDLNTSNQNLALNASGDGSIYDSMNSTNFNYLDKISSADNMKISFDPQLFEVLRNLESKTANMSLDDNSLSNMLPGEQFNSNVLKNINPFMFSPLPQREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            SQIAKSAINGNCNSKSQNFDLNTSNQNLALNASGDGSIYDSMNSTNFNYLDKISSADNMKISFDPQLFEVLRNLESKTANMSLDDNSLSNMLPGEQFNSNVLKNINPFMFSPLPQREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW
Sbjct:  468 SQIAKSAINGNCNSKSQNFDLNTSNQNLALNASGDGSIYDSMNSTNFNYLDKISSADNMKISFDPQLFEVLRNLESKTANMSLDDNSLSNMLPGEQFNSNVLKNINPFMFSPLPQREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 845          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Planmine SMEST
Match: SMESG000055629.1 (SMESG000055629.1)

HSP 1 Score: 808.52 bits (2087), Expect = 0.000e+0
Identity = 378/378 (100.00%), Postives = 378/378 (100.00%), Query Frame = 2
Query:   23 SQIAKSAINGNCNSKSQNFDLNTSNQNLALNASGDGSIYDSMNSTNFNYLDKISSADNMKISFDPQLFEVLRNLESKTANMSLDDNSLSNMLPGEQFNSNVLKNINPFMFSPLPQREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 1156
            SQIAKSAINGNCNSKSQNFDLNTSNQNLALNASGDGSIYDSMNSTNFNYLDKISSADNMKISFDPQLFEVLRNLESKTANMSLDDNSLSNMLPGEQFNSNVLKNINPFMFSPLPQREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW
Sbjct:  456 SQIAKSAINGNCNSKSQNFDLNTSNQNLALNASGDGSIYDSMNSTNFNYLDKISSADNMKISFDPQLFEVLRNLESKTANMSLDDNSLSNMLPGEQFNSNVLKNINPFMFSPLPQREERYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW 833          
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Planmine SMEST
Match: SMESG000055011.1 (SMESG000055011.1)

HSP 1 Score: 182.185 bits (461), Expect = 2.169e-51
Identity = 96/254 (37.80%), Postives = 148/254 (58.27%), Query Frame = 2
Query:  377 RYSRKVFVGGLPPDIDEEEITAAFKRFGTLVVDWPHK------AESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESK--YYWCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRAIELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYYCEQCWAHIHSRQGREY-HKPL 1111
            +YSRKVF+GG+P D  E ++ +AF +FG L V +P K        S S    KGYC+++F+ E SV  L+  C  +E+    ++ +SSP  + K VQ+ PW   DS +   GS   D +KT+FVG +   + A  LA +M+ L+  V ++ +DTD + KYP G+GRV FS+Q+SY+ A++A F+ ++     K +++ PY L+D MC+ C  S        +FC +  C +Y+C  CW   H+R    + HKPL
Sbjct:  325 QYSRKVFLGGVPWDSTENDLMSAFIKFGYLSVMFPQKDLNSGSKYSASSNSLKGYCYIIFESEDSVARLLSQCCKNEANGGEFFKISSPKFRSKDVQVIPWITQDSQYCRTGSPKPDSKKTVFVGALHGMMTAYALANVMNELFDNVIFTALDTD-KYKYPIGSGRVTFSSQKSYMRAVTANFIHVKTAKFSKTIQIDPY-LEDSMCNNCFQSP-----GIYFCRSFECFRYFCSGCWQVWHNRCETLFNHKPL 571          
The following BLAST results are available for this feature:
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CPEB46.659e-17874.53cytoplasmic polyadenylation element binding protei... [more]
CPEB41.344e-17787.50cytoplasmic polyadenylation element binding protei... [more]
CPEB31.916e-17788.64cytoplasmic polyadenylation element binding protei... [more]
CPEB42.832e-17787.50cytoplasmic polyadenylation element binding protei... [more]
CPEB42.832e-17787.50cytoplasmic polyadenylation element binding protei... [more]
back to top
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cpb-11.116e-8948.13Cytoplasmic polyadenylation element-binding protei... [more]
cpb-29.421e-6241.42Cytoplasmic polyadenylation element-binding protei... [more]
cpb-36.711e-3630.49Cytoplasmic polyadenylation element-binding protei... [more]
fog-19.380e-3335.55Feminization Of Germline [Source:UniProtKB/TrEMBL... [more]
fog-14.062e-2934.17Feminization Of Germline [Source:UniProtKB/TrEMBL... [more]
back to top
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
orb28.131e-17286.92gene:FBgn0264307 transcript:FBtr0331511[more]
orb22.137e-17186.92gene:FBgn0264307 transcript:FBtr0331515[more]
orb22.137e-17186.92gene:FBgn0264307 transcript:FBtr0331513[more]
orb22.137e-17186.92gene:FBgn0264307 transcript:FBtr0331512[more]
orb22.137e-17186.92gene:FBgn0264307 transcript:FBtr0331514[more]
back to top
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cpeb27.764e-17869.06cytoplasmic polyadenylation element binding protei... [more]
cpeb28.332e-17767.92cytoplasmic polyadenylation element binding protei... [more]
cpeb38.015e-17688.64cytoplasmic polyadenylation element binding protei... [more]
cpeb4a4.545e-17587.12cytoplasmic polyadenylation element binding protei... [more]
cpeb4a1.436e-17487.12cytoplasmic polyadenylation element binding protei... [more]
back to top
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CPEB20.000e+071.91cytoplasmic polyadenylation element binding protei... [more]
CPEB21.511e-18070.83cytoplasmic polyadenylation element binding protei... [more]
CPEB21.566e-18071.91cytoplasmic polyadenylation element binding protei... [more]
CPEB23.803e-18070.83cytoplasmic polyadenylation element binding protei... [more]
CPEB29.078e-18072.83cytoplasmic polyadenylation element binding protei... [more]
back to top
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cpeb33.266e-17988.64cytoplasmic polyadenylation element binding protei... [more]
Cpeb33.266e-17988.64cytoplasmic polyadenylation element binding protei... [more]
Cpeb37.549e-17888.64cytoplasmic polyadenylation element binding protei... [more]
Cpeb37.549e-17888.64cytoplasmic polyadenylation element binding protei... [more]
Cpeb31.131e-17788.64cytoplasmic polyadenylation element binding protei... [more]
back to top
BLAST of Cytoplasmic polyadenylation element-binding protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q812E0|CPEB2_MOUSE2.060e-17772.25Cytoplasmic polyadenylation element-binding protei... [more]
sp|Q28CH2|CPEB3_XENTR1.956e-17688.26Cytoplasmic polyadenylation element-binding protei... [more]
sp|Q8NE35|CPEB3_HUMAN2.184e-17688.64Cytoplasmic polyadenylation element-binding protei... [more]
sp|Q7TN99|CPEB3_MOUSE2.323e-17688.64Cytoplasmic polyadenylation element-binding protei... [more]
sp|Q7Z5Q1|CPEB2_HUMAN2.383e-17672.25Cytoplasmic polyadenylation element-binding protei... [more]
back to top
BLAST of Cytoplasmic polyadenylation element-binding protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A219TTV50.000e+0100.00Cytoplasmic polyadenylation element binding protei... [more]
A0A1W6I1810.000e+099.74Cytoplasmic polyadenylation element-binding protei... [more]
A0A0V0J7I60.000e+071.75Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A210PP730.000e+073.24Cytoplasmic polyadenylation element-binding protei... [more]
A0A2T7PBJ30.000e+070.97Uncharacterized protein OS=Pomacea canaliculata OX... [more]
back to top
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000057037.13.722e-17687.50pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000013842.25.379e-17587.50pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
cpeb4a5.210e-17487.12cytoplasmic polyadenylation element-binding protei... [more]
cpeb4a8.593e-17487.12cytoplasmic polyadenylation element-binding protei... [more]
cpeb4a8.639e-17487.12cytoplasmic polyadenylation element-binding protei... [more]
back to top
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cpeb4a6.856e-18089.66cytoplasmic polyadenylation element binding protei... [more]
ENSPMAT00000009811.12.723e-6440.07pep scaffold:Pmarinus_7.0:GL480497:1015:8265:1 gen... [more]
back to top
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO487034.867e-17386.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO281566.198e-5190.36pep supercontig:ASM20922v1:NEMVEscaffold_2549:1223... [more]
EDO465389.315e-4041.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cpeb4a5.545e-17875.00cytoplasmic polyadenylation element-binding protei... [more]
cpeb35.516e-17587.88cytoplasmic polyadenylation element binding protei... [more]
cpeb21.828e-17479.47cytoplasmic polyadenylation element binding protei... [more]
CPEB44.576e-17487.50cytoplasmic polyadenylation element binding protei... [more]
CPEB44.576e-17487.50cytoplasmic polyadenylation element binding protei... [more]
back to top
BLAST of Cytoplasmic polyadenylation element-binding protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000055629.10.000e+0100.00SMESG000055629.1[more]
SMESG000055629.10.000e+0100.00SMESG000055629.1[more]
SMESG000055011.12.169e-5137.80SMESG000055011.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016672 ID=SMED30016672|Name=Cytoplasmic polyadenylation element-binding protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1278bp
TAATAATAATAATAATAATAATTCACAAATTGCCAAGTCTGCCATCAATG
GCAATTGCAATTCTAAATCACAAAATTTTGATTTAAATACATCGAATCAA
AATCTCGCATTGAACGCTTCTGGAGACGGCTCGATCTATGATTCGATGAA
TTCCACCAATTTCAACTATCTCGACAAAATCTCCTCTGCTGACAACATGA
AAATCAGTTTTGATCCGCAATTGTTTGAAGTTTTGCGAAACCTGGAATCG
AAAACCGCTAACATGAGTCTCGATGACAATTCCCTGTCAAATATGCTGCC
GGGAGAACAATTCAACAGCAATGTATTGAAGAACATCAATCCATTCATGT
TTTCTCCACTGCCGCAAAGAGAGGAAAGATATTCGAGAAAAGTATTCGTC
GGTGGTTTGCCTCCGGATATTGATGAAGAGGAAATTACTGCTGCTTTTAA
ACGTTTCGGTACATTGGTCGTCGATTGGCCCCACAAAGCCGAAAGCAAAT
CATATTTTCCACCAAAAGGCTATTGCTTCCTGTTGTTCCAAGACGAAATC
TCGGTTCAGAATTTGATTGACGCTTGCATTATGGATGAAAGTAAATATTA
TTGGTGTGTGTCTTCACCTACAATCAAGGACAAACCTGTTCAAATTCGAC
CATGGAGTTTGGCGGACTCGGATTTTGTGATGGATGGCTCTGAGCCTTTA
GATCCCAGAAAAACCATATTTGTCGGGGGTGTGCCGAGACCTCTTAGAGC
TATTGAATTGGCAATGATTATGGATCGACTGTATGGCGGAGTGTGCTATT
CCGGAATTGATACAGATCCGGAACTGAAATATCCGAAAGGAGCCGGAAGA
GTAGCATTTTCCAATCAACAAAGTTACATTGCTGCAATAAGTGCTCGTTT
TGTTCAATTGCAACATCACGACATTGACAAAAGAGTTGAAGTCAAACCAT
ACGTTCTTGATGATCAAATGTGTGATGAATGTCAGGGTTCACGATGTGGC
GGAAAATTCGCTCCGTTTTTCTGTGCAAACGTTACGTGTTTACAATATTA
CTGTGAGCAATGTTGGGCACATATTCACAGCCGTCAAGGTCGAGAATACC
ACAAACCGCTGGTAAAGGAAGGTGCTGATAGACCTCGCACCGTTCCGTTT
CGTTGGTGATTCCATTTCAATGAGCTCGTATGTGTTTTGTCAGTGGTTGT
GCATATCTCTGACTGTTTGTCTGTCGAGTTTTTTTTCTATTTTCTCTCTC
CTCTCTCTCTCTCTCTCTCTCTCTGTGT
back to top

protein sequence of SMED30016672-orf-1

>SMED30016672-orf-1 ID=SMED30016672-orf-1|Name=SMED30016672-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=386bp
NNNNNNNSQIAKSAINGNCNSKSQNFDLNTSNQNLALNASGDGSIYDSMN
STNFNYLDKISSADNMKISFDPQLFEVLRNLESKTANMSLDDNSLSNMLP
GEQFNSNVLKNINPFMFSPLPQREERYSRKVFVGGLPPDIDEEEITAAFK
RFGTLVVDWPHKAESKSYFPPKGYCFLLFQDEISVQNLIDACIMDESKYY
WCVSSPTIKDKPVQIRPWSLADSDFVMDGSEPLDPRKTIFVGGVPRPLRA
IELAMIMDRLYGGVCYSGIDTDPELKYPKGAGRVAFSNQQSYIAAISARF
VQLQHHDIDKRVEVKPYVLDDQMCDECQGSRCGGKFAPFFCANVTCLQYY
CEQCWAHIHSRQGREYHKPLVKEGADRPRTVPFRW*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0045182translation regulator activity
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
GO:0000900translation repressor activity, nucleic acid binding
GO:0003723RNA binding
GO:0003730mRNA 3'-UTR binding
GO:0005515protein binding
GO:0008135translation factor activity, RNA binding
GO:0035613RNA stem-loop binding
GO:0035925mRNA 3'-UTR AU-rich region binding
GO:0043022ribosome binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000044cephalic ganglia
PLANA:0000099neuron
PLANA:0000208testis
PLANA:0000220spermatogonium
PLANA:0000221spermatocyte
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR038446CEBP_ZZ_sf
IPR034819CPEB
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
IPR032296CEBP_ZZ
Vocabulary: biological process
TermDefinition
GO:0000122negative regulation of transcription from RNA polymerase II promoter
GO:0006412translation
GO:0006417regulation of translation
GO:0007616long-term memory
GO:0017148negative regulation of translation
GO:0045727positive regulation of translation
GO:0048167regulation of synaptic plasticity
GO:0050955thermoception
GO:0060213positive regulation of nuclear-transcribed mRNA poly(A) tail shortening
GO:0060998regulation of dendritic spine development
GO:0060999positive regulation of dendritic spine development
GO:00611583'-UTR-mediated mRNA destabilization
GO:0071230cellular response to amino acid stimulus
GO:1900153positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
GO:1900248negative regulation of cytoplasmic translational elongation
GO:1900273positive regulation of long-term synaptic potentiation
GO:1900365positive regulation of mRNA polyadenylation
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005886plasma membrane
GO:0014069postsynaptic density
GO:0016020membrane
GO:0030014CCR4-NOT complex
GO:0030054cell junction
GO:0030425dendrite
GO:0042995cell projection
GO:0043005neuron projection
GO:0045202synapse
GO:0045211postsynaptic membrane
GO:0097440apical dendrite
GO:1990124messenger ribonucleoprotein complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 238..311
e-value: 0.016
score: 22.6
coord: 130..204
e-value: 0.0021
score: 27.3
IPR000504RNA recognition motif domainPFAMPF16367RRM_7coord: 128..217
e-value: 5.6E-35
score: 119.3
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 237..315
score: 8.962
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 129..216
score: 10.684
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 129..217
e-value: 3.3E-26
score: 93.4
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 221..314
e-value: 7.9E-30
score: 104.9
IPR038446CEBP, ZZ domain superfamilyGENE3DG3DSA:3.30.40.130coord: 315..380
e-value: 2.3E-26
score: 93.4
IPR032296Cytoplasmic polyadenylation element-binding protein, ZZ domainPFAMPF16366CEBP_ZZcoord: 310..372
e-value: 1.2E-20
score: 73.5
IPR034819Cytoplasmic polyadenylation element-binding proteinPANTHERPTHR12566CYTOPLASMIC POLYADENYLATION ELEMENT BINDING PROTEIN CPEBcoord: 122..385
NoneNo IPR availablePANTHERPTHR12566:SF7CYTOPLASMIC POLYADENYLATION ELEMENT-BINDING PROTEIN 3coord: 122..385
NoneNo IPR availableCDDcd12726RRM2_CPEB2_likecoord: 237..317
e-value: 1.52437E-57
score: 180.373
NoneNo IPR availableCDDcd12724RRM1_CPEB2_likecoord: 129..220
e-value: 4.03077E-66
score: 202.677
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 127..298