Intraflagellar transport protein 140

Overview
NameIntraflagellar transport protein 140
Smed IDSMED30016654
Length (bp)4921
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Intraflagellar transport protein 140 (SMED30016654) t-SNE clustered cells

Violin plots show distribution of expression levels for Intraflagellar transport protein 140 (SMED30016654) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Intraflagellar transport protein 140 (SMED30016654) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Intraflagellar transport protein 140 (SMED30016654) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016654

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30016654SMESG000001316.1 SmedASXL_017950SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30016654SMESG000001316.1 SmedASXL_017949SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30016654SMESG000001316.1 dd_Smed_v4_11300_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30016654SMESG000001316.1 dd_Smed_v4_11300_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30016654SMESG000001316.1 dd_Smed_v4_11300_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30016654SMESG000001316.1 dd_Smed_v4_11300_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30016654SMESG000001316.1 dd_Smed_v6_11300_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30016654SMESG000001316.1 dd_Smed_v4_11300_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30016654SMESG000001316.1 dd_Smed_v4_11300_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Intraflagellar transport protein 140 vs. Ensembl Human
Match: IFT140 (intraflagellar transport 140 [Source:HGNC Symbol;Acc:HGNC:29077])

HSP 1 Score: 743.036 bits (1917), Expect = 0.000e+0
Identity = 373/839 (44.46%), Postives = 557/839 (66.39%), Query Frame = 1
Query: 2245 NENISLSPTVTNEHEDSLLLAKDVSSSLPVSHFWDKIDHRLIVVEIRSFDDKELNFNFTNISSIGEKVKKNNRVLVSLFATQDDGILMFDNIICDEEYERLIGFDAPYYFFAIRNDIAYKK-QAKDGL--TCSFITPRVMRDFVGLEDSDGINKQALLNFSYYLTIGNMDEAFKSMKLIKSELVWRNMARMCVKTRRLDVATVCLGKMNYACAAMQLREARQNLPELDAKVAMLALHLDMKEEAIKLLEKSQRYDILNELYQAMEEWNKALDVAEKHDRIHLKTTYYNYAKYLEEEKRYSEALENFVKSGTHAFEVPRMLFNQPDELEKFIRERPEKALRKWWAQYMECCGEMKAALEFYAAAQDNFSLVRAYWLLGMEKKATEVCNDTGDRAACYHLARQFEATNNVDQAIHYYSRAKAYNSAIRLCKENKKDDHLVNLALLCKPEEQVEAASYLQTRNGYQDKAVILFHKAGQVSRAIDLACKTKQFGALQHISNDLSDKVHPDLLQKCASFFMENNQFDRAVDMLASSKQLWEALKLCVDYNVPMTEELAEKLSPPRLNENIEHTQTSISRINSSPHEYTEAERLRLLEGIAEIALSQRQYHLACKKFTQAGNQMMAMKSLLKSGDTEKIIRFANISKTKEVYVLAANYLQNLDWRRDPDIMKNIITFYTKGKALERLATFYEACSQSEIEEYQNYSKAIGALGEAYKYWSKMKFESENQKNVKLDSIRNKCTLMKKFLATIEMFETSPDEAIHQCQLLLDEPNIDVAIRYGDIYSHMIQYFIHQSKFKAAYACLDEMKRRIRNPSIVTAYIDVATLEFLHKSLGIPFRQ--PSQI 4746
             E +S +   TN+    L + + + + +PV+HFWD+ + RL V E      +    +       G      + +++S F +++ G L+ ++         L+G + PYY+F  + + A ++ + + G       ++ R +RDFVGLED D   + A+L+FS+++TIG+MDEAFKS+KLIKSE VW NMARMCVKT+RLDVA VCLG M +A  A  LREA Q  PEL+A+VA+LA  L M E+A +L  K +R+D+LN+ YQA   W +AL VAE HDR+HL++TY+ YA +LE     S AL  + KS TH FEVPRML      LE ++ +  +K L +WWAQY+E  GEM AAL +Y  A+D+FSLVR +   G  +KA ++ N+TG+ AA YHLARQ+E+   V QA+H+Y+RA+A+ +AIRLCKEN  DD L+NLALL  PE+ +EAA Y + +    D+AV+L+HKAG  S+A++LA  T+QF ALQ I+ DL +   P LL +C+ FF+E++Q++RAV++L ++++  EAL+LC+  N+ +TEE+AEK++                 +     +  E  R  LLE IA+  + Q  YHLA KK+TQAGN++ AM++LLKSGDTEKI  FA++S+ KE+Y++AANYLQ+LDWR++P+IMKNII FYTKG+AL+ LA FY+AC+Q EI+EYQNY KA GAL EAYK  +K K +S   +  +L  ++++  L+K+F+     +   P E+I QC+LLL+EP++D  IR GD+Y  ++++++ + +++ AY  L+EM+RR+   ++ + Y+    ++ +H+ LG+P  +  P Q+
Sbjct:  622 RETLSFNEQETNK--SHLFVDEGLKNYVPVNHFWDQSEPRLFVCEAVQETPRSQPQSANGQPQDGRAGPAADVLILSFFISEEHGFLLHESFPRPATSHSLLGMEVPYYYFTRKPEEADREDEVEPGCHHIPQMVSRRPLRDFVGLEDCDKATRDAMLHFSFFVTIGDMDEAFKSIKLIKSEAVWENMARMCVKTQRLDVAKVCLGNMGHARGARALREAEQE-PELEARVAVLATQLGMLEDAEQLYRKCKRHDLLNKFYQAAGRWQEALQVAEHHDRVHLRSTYHRYAGHLEASADCSRALSYYEKSDTHRFEVPRMLSEDLPSLELYVNKMKDKTLWRWWAQYLESQGEMDAALHYYELARDHFSLVRIHCFQGNVQKAAQIANETGNLAASYHLARQYESQEEVGQAVHFYTRAQAFKNAIRLCKENGLDDQLMNLALLSSPEDMIEAARYYEEKGVQMDRAVMLYHKAGHFSKALELAFATQQFVALQLIAEDLDETSDPALLARCSDFFIEHSQYERAVELLLAARKYQEALQLCLGQNMSITEEMAEKMT-----------------VAKDSSDLPEESRRELLEQIADCCMRQGSYHLATKKYTQAGNKLKAMRALLKSGDTEKITFFASVSRQKEIYIMAANYLQSLDWRKEPEIMKNIIGFYTKGRALDLLAGFYDACAQVEIDEYQNYDKAHGALTEAYKCLAKAKAKSPLDQETRLAQLQSRMALVKRFIQARRTYTEDPKESIKQCELLLEEPDLDSTIRIGDVYGFLVEHYVRKEEYQTAYRFLEEMRRRLPLANM-SYYVSPQAVDAVHRGLGLPLPRTVPEQV 1439          

HSP 2 Score: 322.783 bits (826), Expect = 2.571e-89
Identity = 200/660 (30.30%), Postives = 336/660 (50.91%), Query Frame = 1
Query:   76 MAIYLTKQLNLDDVQILD--IKFHQKLELLAISVIRESSHGHVIIANNKGEIFNSCKISKPQPISAILWHPSKAQLAVGWSDGQISLFDETQNVSNESLHLHCLPIASFAWSSHGSKLMSADIEGHLYAWKIDARGSFSQNPIFNFSANCPINCILLRMPKLKGSDVYDIRELAKAAVSGDERALDLMSWTKSSSGIKLTGYSYMEVSNFFAGLGDGRVILINEDGKTTNITSLSGSVVRLLYHEERDVLIATTDIGMLTQHQLLSDGSSKEVMKVKLASRTPNPS-LIWAGPSTLAISLGESMIRMWDIDREENYMLQPSEDMGYTKMGLLSVVDYCASQRTIVAGSNKGQIVMWKMMGNEESYSKENPENRWCLQPATELHVN-GQVSAGSIEKLVASSTNVIAAGTSSNIMYILEEKPMISAFYNGIVITQKGASELFIQLYSSCKESNDNKMFTNEPVLDEQYQETTEKKMECFTIAVEHLITLMDCTRENLIISDGKTVFVYELKLRSSDLASLCGQFESPTFILKIHQQNIYVSEKSQLQIRNFQGIIKQVVDLGNMDGKLSHIDINNNFMVCTTDKCCLRIYDLSRRDPKPIGIIKDFGECIPAVTMIASVSINCNGTVVSLIVEKQKET-DPKLYFWNIETDSIQYFNFSTG 2040
            MA+Y   Q+   D       I +H     LA++ I  +S G V I   +GE      + +P  ++++ WHP++  LAVGW  G++++F++     +     H   I    WS  G+ L+S D  G L  W++D RG     P+        +   + R+P   G D+    +LAKAAVSGDE+ALD+ +W KSSSG  L   S+ E   FF  L DG V  ++E GKTT + S   ++  L Y E+R+ L+  T+   L+ + +  +G ++EVMKVKL+ +T   + +     S L +++GE+ +R WDI+R ENY+L P E  G+ K   ++ V YC  +  + AG+++G++ MW+ + +         ++RW LQ  TEL  N  Q+  GS + L+A ++ +  A        IL E+ M S F+  +   Q   S L             N  F +  V                ++  +  I+ +  T++ + + +G+ V ++EL   S       G F   T +L +H++N+Y  E +++Q+R +QG +KQ++     +G    +DI  NF+V  TD    + +DLSRR+ K     +   E +P V  IAS+  + +G+ +S++  K   + D K+ F+++E D++  F+F TG
Sbjct:    1 MALYYDHQIEAPDAAGSPSFISWHPVHPFLAVAYISTTSTGSVDIYLEQGECVPDTHVERPFRVASLCWHPTRLVLAVGWETGEVTVFNKQDKEQHTMPLTHTADITVLRWSPSGNCLLSGDRLGVLLLWRLDQRGRVQGTPLLKHEYGKHLTHCIFRLPP-PGEDLV---QLAKAAVSGDEKALDMFNWKKSSSGSLLKMGSH-EGLLFFVSLMDGTVHYVDEKGKTTQVVSADSTIQMLFYMEKREALVVVTENLRLSLYTVPPEGKAEEVMKVKLSGKTGRRADIALIEGSLLVMAVGEAALRFWDIERGENYILSPDEKFGFEKGENMNCVCYCKVKGLLAAGTDRGRVAMWRKVPDFLGSPGAEGKDRWALQTPTELQGNITQIQWGSRKNLLAVNSVISVA--------ILSERAMSSHFHQQVAAMQVSPSLL-------------NVCFLSTGV--------------AHSLRTDMHISGVFATKDAVAVWNGRQVAIFEL---SGAAIRSAGTFLCETPVLAMHEENVYTVESNRVQVRTWQGTVKQLLLFSETEGNPCFLDICGNFLVVGTDLAHFKSFDLSRREAKAHCSCRSLAELVPGVGGIASLRCSSSGSTISILPSKADNSPDSKICFYDVEMDTVTVFDFKTG 617          
BLAST of Intraflagellar transport protein 140 vs. Ensembl Human
Match: IFT140 (intraflagellar transport 140 [Source:HGNC Symbol;Acc:HGNC:29077])

HSP 1 Score: 632.869 bits (1631), Expect = 0.000e+0
Identity = 312/652 (47.85%), Postives = 455/652 (69.79%), Query Frame = 1
Query: 2797 MARMCVKTRRLDVATVCLGKMNYACAAMQLREARQNLPELDAKVAMLALHLDMKEEAIKLLEKSQRYDILNELYQAMEEWNKALDVAEKHDRIHLKTTYYNYAKYLEEEKRYSEALENFVKSGTHAFEVPRMLFNQPDELEKFIRERPEKALRKWWAQYMECCGEMKAALEFYAAAQDNFSLVRAYWLLGMEKKATEVCNDTGDRAACYHLARQFEATNNVDQAIHYYSRAKAYNSAIRLCKENKKDDHLVNLALLCKPEEQVEAASYLQTRNGYQDKAVILFHKAGQVSRAIDLACKTKQFGALQHISNDLSDKVHPDLLQKCASFFMENNQFDRAVDMLASSKQLWEALKLCVDYNVPMTEELAEKLSPPRLNENIEHTQTSISRINSSPHEYTEAERLRLLEGIAEIALSQRQYHLACKKFTQAGNQMMAMKSLLKSGDTEKIIRFANISKTKEVYVLAANYLQNLDWRRDPDIMKNIITFYTKGKALERLATFYEACSQSEIEEYQNYSKAIGALGEAYKYWSKMKFESENQKNVKLDSIRNKCTLMKKFLATIEMFETSPDEAIHQCQLLLDEPNIDVAIRYGDIYSHMIQYFIHQSKFKAAYACLDEMKRRIRNPSIVTAYIDVATLEFLHKSLGIPFRQ--PSQI 4746
            MARMCVKT+RLDVA VCLG M +A  A  LREA Q  PEL+A+VA+LA  L M E+A +L  K +R+D+LN+ YQA   W +AL VAE HDR+HL++TY+ YA +LE     S AL  + KS TH FEVPRML      LE ++ +  +K L +WWAQY+E  GEM AAL +Y  A+D+FSLVR +   G  +KA ++ N+TG+ AA YHLARQ+E+   V QA+H+Y+RA+A+ +AIRLCKEN  DD L+NLALL  PE+ +EAA Y + +    D+AV+L+HKAG  S+A++LA  T+QF ALQ I+ DL +   P LL +C+ FF+E++Q++RAV++L ++++  EAL+LC+  N+ +TEE+AEK++  + + ++                  E  R  LLE IA+  + Q  YHLA KK+TQAGN++ AM++LLKSGDTEKI  FA++S+ KE+Y++AANYLQ+LDWR++P+IMKNII FYTKG+AL+ LA FY+AC+Q EI+EYQNY KA GAL EAYK  +K K +S   +  +L  ++++  L+K+F+     +   P E+I QC+LLL+EP++D  IR GD+Y  ++++++ + +++ AY  L+EM+RR+   ++ + Y+    ++ +H+ LG+P  +  P Q+
Sbjct:    1 MARMCVKTQRLDVAKVCLGNMGHARGARALREAEQE-PELEARVAVLATQLGMLEDAEQLYRKCKRHDLLNKFYQAAGRWQEALQVAEHHDRVHLRSTYHRYAGHLEASADCSRALSYYEKSDTHRFEVPRMLSEDLPSLELYVNKMKDKTLWRWWAQYLESQGEMDAALHYYELARDHFSLVRIHCFQGNVQKAAQIANETGNLAASYHLARQYESQEEVGQAVHFYTRAQAFKNAIRLCKENGLDDQLMNLALLSSPEDMIEAARYYEEKGVQMDRAVMLYHKAGHFSKALELAFATQQFVALQLIAEDLDETSDPALLARCSDFFIEHSQYERAVELLLAARKYQEALQLCLGQNMSITEEMAEKMTVAKDSSDL-----------------PEESRRELLEQIADCCMRQGSYHLATKKYTQAGNKLKAMRALLKSGDTEKITFFASVSRQKEIYIMAANYLQSLDWRKEPEIMKNIIGFYTKGRALDLLAGFYDACAQVEIDEYQNYDKAHGALTEAYKCLAKAKAKSPLDQETRLAQLQSRMALVKRFIQARRTYTEDPKESIKQCELLLEEPDLDSTIRIGDVYGFLVEHYVRKEEYQTAYRFLEEMRRRLPLANM-SYYVSPQAVDAVHRGLGLPLPRTVPEQV 633          
BLAST of Intraflagellar transport protein 140 vs. Ensembl Human
Match: IFT140 (intraflagellar transport 140 [Source:HGNC Symbol;Acc:HGNC:29077])

HSP 1 Score: 88.1965 bits (217), Expect = 1.100e-19
Identity = 37/99 (37.37%), Postives = 66/99 (66.67%), Query Frame = 1
Query: 4315 EEYQNYSKAIGALGEAYKYWSKMKFESENQKNVKLDSIRNKCTLMKKFLATIEMFETSPDEAIHQCQLLLDEPNIDVAIRYGDIYSHMIQYFIHQSKFK 4611
            +EYQNY KA GAL EAYK  +K K +S   +  +L  ++++  L+K+F+     +   P E+I QC+LLL+EP++D  IR GD+Y  ++++++ + +++
Sbjct:    1 DEYQNYDKAHGALTEAYKCLAKAKAKSPLDQETRLAQLQSRMALVKRFIQARRTYTEDPKESIKQCELLLEEPDLDSTIRIGDVYGFLVEHYVRKEEYQ 99          
BLAST of Intraflagellar transport protein 140 vs. Ensembl Human
Match: IFT140 (intraflagellar transport 140 [Source:HGNC Symbol;Acc:HGNC:29077])

HSP 1 Score: 61.2326 bits (147), Expect = 2.233e-10
Identity = 34/120 (28.33%), Postives = 58/120 (48.33%), Query Frame = 1
Query:   76 MAIYLTKQLNLDDVQILD--IKFHQKLELLAISVIRESSHGHVIIANNKGEIFNSCKISKPQPISAILWHPSKAQLAVGWSDGQISLFDETQNVSNESLHLHCLPIASFAWSSHGSKLMS 429
            MA+Y   Q+   D       I +H     LA++ I  +S G V I   +GE      + +P  ++++ WHP++  LAVGW  G++++F++     +     H   I    WS  G+ L+S
Sbjct:    1 MALYYDHQIEAPDAAGSPSFISWHPVHPFLAVAYISTTSTGSVDIYLEQGECVPDTHVERPFRVASLCWHPTRLVLAVGWETGEVTVFNKQDKEQHTMPLTHTADITVLRWSPSGNCLLS 120          
BLAST of Intraflagellar transport protein 140 vs. Ensembl Human
Match: IFT140 (intraflagellar transport 140 [Source:HGNC Symbol;Acc:HGNC:29077])

HSP 1 Score: 56.6102 bits (135), Expect = 7.250e-9
Identity = 31/112 (27.68%), Postives = 53/112 (47.32%), Query Frame = 1
Query:   76 MAIYLTKQLNLDDVQILD--IKFHQKLELLAISVIRESSHGHVIIANNKGEIFNSCKISKPQPISAILWHPSKAQLAVGWSDGQISLFDETQNVSNESLHLHCLPIASFAWS 405
            MA+Y   Q+   D       I +H     LA++ I  +S G V I   +GE      + +P  ++++ WHP++  LAVGW  G++++F++     +     H   I    WS
Sbjct:    1 MALYYDHQIEAPDAAGSPSFISWHPVHPFLAVAYISTTSTGSVDIYLEQGECVPDTHVERPFRVASLCWHPTRLVLAVGWETGEVTVFNKQDKEQHTMPLTHTADITVLRWS 112          
BLAST of Intraflagellar transport protein 140 vs. Ensembl Celegans
Match: che-11 (pep chromosome:WBcel235:V:12144295:12150689:-1 gene:WBGene00000490.1 transcript:C27A7.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:che-11)

HSP 1 Score: 510.375 bits (1313), Expect = 2.152e-154
Identity = 279/801 (34.83%), Postives = 466/801 (58.18%), Query Frame = 1
Query: 2329 PVSHFWDKIDHRLIVVEIRSFDDKELNFNFTNISSIGEKVKKNNRVLVSLFATQDDGI----LMFDNIICDEEYERLIGFDAPYYFFAIRNDIAYKKQAKDGLTCSFITPRVMRDFVGLEDSDGINKQALLNFSYYLTIGNMDEAFKSMKLIKSELVWRNMARMCVKTRRLDVATVCLGKMNYACAAMQLREARQNLPELDAKVAMLALHLDMKEEAIKLLEKSQRYDILNELYQAMEEWNKALDVAEKHDRIHLKTTYYNYAKYLEEEKRYSE---ALENFVKSGTHAFEVPRMLFNQPDELEKFIRERPEKALRKWWAQYMECCGEMKAALEFYAAAQDNFSLVRAYWLLGMEKKATEVCNDTGDRAACYHLARQFEATNNVDQAIHYYSRAKAYNSAIRLCKENKKDDHLVNLALLCKPEEQVEAASYLQTRNGYQDKAVILFHKAGQVSRAIDLACKTKQFGALQHISNDLSDKVHPDLLQKCASFFMENNQFDRAVDMLASSKQLWEALKLCVDYNVPMTEELAEKLSPPRLNENIEHTQTSISRINSSPHEYTEAERLRLLEGIAEIALSQRQYHLACKKFTQAGNQMMAMKSLLKSGDTEKIIRFANISKTKEVYVLAANYLQNLDWRRDPDIMKNIITFYTKGKALERLATFYEACSQSEIEEYQNYSKAIGALGEAYKYWSKMKFESENQKNVKLDSIRNK----CTLMKKFLATIEMFETSPDEAIHQCQLLLDEPNIDVAIRYGDIYSHMIQYFIHQSKFKAAYACLDEMKRRIRNPSIVTAYIDVATLE 4698
            P +  WD+ D R +VVE                    E    + RVL + F T + GI    +   N+ C     +L+    P ++F  ++    +    +      +  + +R+F+G E+ D   ++A+++FS+YLTIG+MD AFK+++ IKS+ VW +MA M +KTRRLDVA VCLG M     A  +R ++QN      K A LA+ L M EEA+ +  +++RYD++N+LYQ+   W+ A ++AE  DRIHL+ T+YNYAKYLE  +  +    A+EN+ K+G HAFEV RML + P ++E+++R + E++L  WW  Y+E  GE++ A+ FY++A+D + +VR   + G   +A  +  ++ D+AACY + R +E   +V +A+ ++++A+A +SAIRL KE+   D L NL L+    E V AA Y +   GY  KAV+L+HKAG + RA+DLA +T+QF AL  I+ DL     P +L++ A FF  N  +++AV+ L  +K+   A++LC + NV ++++ AE ++P +  +++ + Q                ER ++LE +AE+ L Q  Y  A KKFTQAG+++ AM++LLKSGD +KI  FAN ++ KE+Y+LAAN+LQ  DW+ +   MK+I TFYTK ++ E L  FY++ +  E E  +   K++GAL  A      ++ E +N     LD+++         ++K  + +E+ +    + + Q   L +E   D  +    +++ +I+    +  +K AY  +  +++++ N  + T +++ +TL+
Sbjct:  641 PGAFEWDENDARYLVVECIHV----------------EPESTDQRVLTA-FVTSEHGIQLQGMQQKNLHCG----KLVSVSVPNFYFVRKSGWDEEDNRDERTIGKTLVAKCLREFLGNENCDESTRKAMMDFSFYLTIGSMDAAFKAIQFIKSDSVWDHMASMSIKTRRLDVAMVCLGHMKNVRGARAVRRSQQNGENDSMKCAALAIELSMLEEALIIYAQNERYDLMNKLYQSQNMWSSAFEIAETKDRIHLRNTHYNYAKYLEARRDQASIEAAIENYEKAGVHAFEVFRMLKDYPKQIEQYVRRKREESLYSWWGAYLESVGELEGAISFYSSAKDYYCMVRVKCIQGKTDEAARLAEESKDKAACYLIGRMYENDGDVVKAVKFFTKARALSSAIRLAKEHDMKDRLANLCLMAGGSELVSAARYYEDLPGYAHKAVMLYHKAGMIGRALDLAFRTEQFSALDLITKDLDAGTDPKILRRAAEFFENNQNYEKAVNFLCLAKEFSGAVQLCKNRNVRVSDKFAELMTPTK--DDMPNVQ----------------ERKQVLETVAELCLQQGAYSAAAKKFTQAGDKLSAMRALLKSGDIQKIRFFANTARNKEIYILAANFLQTTDWQDNQQTMKDIETFYTKSQSFEHLGNFYKSVAIIEAEHLRTLDKSMGALEMAAV--CVLEAEQKNMSTTGLDALKEDLKKYVVQLRKLQSVLEVMKNDAADGMRQLTTLAEESIDDDIVPCTRLFALIIEDHASRKNWKPAYRAITGLQKKVPNVDLET-FVETSTLD 1399          

HSP 2 Score: 139.428 bits (350), Expect = 1.041e-32
Identity = 143/612 (23.37%), Postives = 261/612 (42.65%), Query Frame = 1
Query:  244 SKPQPISAILWHPSKAQLAVGWSDGQISLFDETQNVSNESLHLHCLPIASFAWSSHGSKLMSADIEG--HLYAWKIDARGSFSQNPIFNFSANCPINCILLRMPKLKGSDVYDIRELAKAAVSGDERALDLMSW-TKSSSGIKLTGYSYMEVSNFFAGLGDGRVILINEDGKTTNITSLSGSVVRLLYHEERDVLIA-TTDIGMLTQHQLLSDGSSKEVMKVKLASRTPNPSLIWAGPSTLAISLGESMIRMWDIDREENYMLQPSEDMGYTKMGLLSVVDYCASQRTIVAGSNKGQIVMWKMMGNEESYSKENPENRWCLQPATELHVNGQVSAGSIEKLVASSTNVIAAGTSSNIMYILEEKPMISAFYNGIVITQKGASELFIQLYSSCKESNDNKMFTNEPVLDEQYQETTEKKMECFTIAVEHLITLMDCTRENLIISDGKTVFVYELKLRSSDLASL-CGQFESPTFILKIHQQNIYVSEKSQLQIRNFQGIIKQVVDLGNMDGKLSHIDINNNFMVCTTDKCCLRIYDLSRRDPKPIGIIKDFGECIPAVTMIASVSINCNGTVVSL-IVEKQKETDPKLYFWNIETDSIQYFNFSTGLGEQDDF 2061
            SKP  +S + WHP K  + VGW DG +    +  NVS+  +  +  P     WS  G+ LM+       HLY++ +      S + I     N  I     R+        YD  + +K +V+ D+  +D   + +K S   +    S +     F   G    I   ++ +   I  L   ++ + Y E   ++I  T D  +    +  S+    E +KVKL  ++   SL       L +  GE  IR+WD+ +EEN  +    + G+     ++VV     +  I A ++   I  WK        +  N E+ W L P+T  HV+ QVS      +++++  +    T  +++ I E    ++    G +   + +S  F  L+++   S D K+                      +I     I L +   + L++ +  TV  Y+++   + LA++ C  F   T  + I  QN+Y  EK ++  R  QG ++Q + L  ++G    +++N  +M   T    +RIY+LS +D +     K   E +       ++ IN  G  V++  +E       +L  ++ E D++ YF+F  G+ +  ++
Sbjct:   44 SKPGSVSCVRWHPKKQFVVVGWKDGGVCFIPKGGNVSHTVVETYPFPNQGVDWSHDGTVLMTLHNPSSVHLYSYMVIGE-EISTSNIMQIELNDQITLWCKRLS-------YDKFKPSKISVTDDDSGVDESPFGSKESLAERRDEKSTVPKGTEFLFAGKSGTIYGVDNDRQRTIHKLDSEILFMGYCETISIIIVFTRDCFIFHLAKGTSEMRCAERVKVKLGGKSEKYSL-ELDDGILVMCYGEKEIRVWDLIKEENGTIALDVNKGFQPDETINVVTVNGKRGVITAATSLNNIAEWK-----RKRTDTNVESAWNLSPST--HVDSQVSLIRWSPILSTAALI----TEEDLVLIGENS--LTVKMRGKMAAIQTSSNSFTLLHATSGVSQDLKL----------------------SIPSAKGICLGE---KQLVVWNEDTVVTYDVQ---TSLATIQCTSFSCNTTSVAIVNQNLYCIEKDKIFARTLQGTLRQEISLPEIEGDPEILEVNRCWMAVATTNGFIRIYNLSAKDAQQEHNSKYIIENVKNFYKFHTIRINHTGNKVAVSYLEDVSTVAERLLVYDAELDAVSYFSFDRGMTDTQEY 605          
BLAST of Intraflagellar transport protein 140 vs. Ensembl Celegans
Match: dyf-2 (WD repeat-containing protein dyf-2 [Source:UniProtKB/Swiss-Prot;Acc:G5ECZ4])

HSP 1 Score: 60.8474 bits (146), Expect = 8.568e-9
Identity = 67/274 (24.45%), Postives = 114/274 (41.61%), Query Frame = 1
Query: 2776 SELVWRNMARMCVKTRRLDVATVCLGKMNYACAAMQLREARQNLPELDAKV-----AMLALHLDMKEEAIKLLEKSQRYDILNELYQAMEEWNKALDVAEKHDRIHLKTTYYNYAKYLEEEKRYSEALENFVKSGTHAFEVPRML--FNQPDELEKFIRERPEKALRKWWAQYMECCGEMKAALEFYAAA---QDNFSLVRAYWLLGMEKKATEVCNDTGDRAACYHLARQFEATNNVDQAIHYYSRAKAYNSAIRLCKENKKDDHLVNLALLC 3567
            +E+    +ARM +KT                     LR   Q   +L+ +V     A++   +    EA +L E    YD    +      W K   V E  D +     +  Y K +E+EK+Y  A++ +     +  +V  +L   N PDE  + +RE       K  A++    G+  +A++F   +   Q+ F L      +    KA E     G+ +    LA  +   N++  A  +Y++A  YN+AI L  +N  D++ V LA+ C
Sbjct:  855 NEICQSGIARMAIKTG-------------------DLRRGVQLAKQLEGRVVKRDCAIILEQMKQYTEAAQLYEVGLFYDRAAAVCLKANAWAK---VGELLDHVKSPKIHIQYGKIMEKEKKYKVAVKCYETGRDYDNQVRLLLDPLNDPDEAVRVVRESRSIEGAKLVAKFFVKLGDYNSAIQFLVMSQCVQEAFELAEKNNAVREYAKAIE---QHGNISQALELAEYYNRVNDMFMAAKFYTQAGQYNNAINLLFKNGDDENCVALAVDC 1103          
BLAST of Intraflagellar transport protein 140 vs. Ensembl Celegans
Match: dyf-2 (WD repeat-containing protein dyf-2 [Source:UniProtKB/Swiss-Prot;Acc:G5ECZ4])

HSP 1 Score: 59.6918 bits (143), Expect = 1.676e-8
Identity = 67/274 (24.45%), Postives = 113/274 (41.24%), Query Frame = 1
Query: 2776 SELVWRNMARMCVKTRRLDVATVCLGKMNYACAAMQLREARQNLPELDAKV-----AMLALHLDMKEEAIKLLEKSQRYDILNELYQAMEEWNKALDVAEKHDRIHLKTTYYNYAKYLEEEKRYSEALENFVKSGTHAFEVPRML--FNQPDELEKFIRERPEKALRKWWAQYMECCGEMKAALEFYA---AAQDNFSLVRAYWLLGMEKKATEVCNDTGDRAACYHLARQFEATNNVDQAIHYYSRAKAYNSAIRLCKENKKDDHLVNLALLC 3567
            +E+    +ARM +KT                     LR   Q   +L+ +V     A++   +    EA +L E    YD    +      W K   V E  D +     +  Y K +E+EK+Y  A++ +     +  +V  +L   N PDE  + +RE       K  A++    G+  +A++F       Q+ F L      +    KA E     G+ +    LA  +   N++  A  +Y++A  YN+AI L  +N  D++ V LA+ C
Sbjct:   48 NEICQSGIARMAIKTG-------------------DLRRGVQLAKQLEGRVVKRDCAIILEQMKQYTEAAQLYEVGLFYDRAAAVCLKANAWAK---VGELLDHVKSPKIHIQYGKIMEKEKKYKVAVKCYETGRDYDNQVRLLLDPLNDPDEAVRVVRESRSIEGAKLVAKFFVKLGDYNSAIQFLVMSQCVQEAFELAEKNNAVREYAKAIE---QHGNISQALELAEYYNRVNDMFMAAKFYTQAGQYNNAINLLFKNGDDENCVALAVDC 296          
BLAST of Intraflagellar transport protein 140 vs. Ensembl Celegans
Match: dyf-2 (WD repeat-containing protein dyf-2 [Source:UniProtKB/Swiss-Prot;Acc:G5ECZ4])

HSP 1 Score: 59.6918 bits (143), Expect = 1.676e-8
Identity = 67/274 (24.45%), Postives = 113/274 (41.24%), Query Frame = 1
Query: 2776 SELVWRNMARMCVKTRRLDVATVCLGKMNYACAAMQLREARQNLPELDAKV-----AMLALHLDMKEEAIKLLEKSQRYDILNELYQAMEEWNKALDVAEKHDRIHLKTTYYNYAKYLEEEKRYSEALENFVKSGTHAFEVPRML--FNQPDELEKFIRERPEKALRKWWAQYMECCGEMKAALEFYA---AAQDNFSLVRAYWLLGMEKKATEVCNDTGDRAACYHLARQFEATNNVDQAIHYYSRAKAYNSAIRLCKENKKDDHLVNLALLC 3567
            +E+    +ARM +KT                     LR   Q   +L+ +V     A++   +    EA +L E    YD    +      W K   V E  D +     +  Y K +E+EK+Y  A++ +     +  +V  +L   N PDE  + +RE       K  A++    G+  +A++F       Q+ F L      +    KA E     G+ +    LA  +   N++  A  +Y++A  YN+AI L  +N  D++ V LA+ C
Sbjct:   48 NEICQSGIARMAIKTG-------------------DLRRGVQLAKQLEGRVVKRDCAIILEQMKQYTEAAQLYEVGLFYDRAAAVCLKANAWAK---VGELLDHVKSPKIHIQYGKIMEKEKKYKVAVKCYETGRDYDNQVRLLLDPLNDPDEAVRVVRESRSIEGAKLVAKFFVKLGDYNSAIQFLVMSQCVQEAFELAEKNNAVREYAKAIE---QHGNISQALELAEYYNRVNDMFMAAKFYTQAGQYNNAINLLFKNGDDENCVALAVDC 296          
BLAST of Intraflagellar transport protein 140 vs. Ensembl Fly
Match: rempA (gene:FBgn0260933 transcript:FBtr0303763)

HSP 1 Score: 485.723 bits (1249), Expect = 2.758e-145
Identity = 281/779 (36.07%), Postives = 442/779 (56.74%), Query Frame = 1
Query: 2308 KDVSSSLPVSHFWDKIDHRLIVVEIRSFDDKELNFNFTNISSIGEKVKKNNRVLVSLFATQDDGILMFDNIICDEEYE-RLIGFDAPYYFFAIRNDIAYKKQAKDGLTCSFITPRVMRDFVGLEDSDGINKQALLNFSYYLTIGNMDEAFKSMKLIKSELVWRNMARMCVKTRRLDVATVCLGKMNYACAAMQLREARQNLP-ELDAKVAMLALHLDMKEEAIKLLEKSQRYDILNELYQAMEEWNKALDVAEKHDRIHLKTTYYNYAKYLEEEKRYSEALENFVKSGTHAFEVPRMLFNQPDELEKFIRERPEKALRKWWAQYMECCGEMKAALEFYAAAQDNFSLVRAYWLLGMEKKATEVCNDTGDRAACYHLARQFEATNNVDQAIHYYSRAKAYNSAIRLCKENKKDDHLVNLALLCKPEEQVEAASYLQTRNGYQDKAVILFHKAGQVSRAIDLACKTKQFGALQHISNDLSDKVHPDLLQKCASFFMENNQFDRAVDMLASSKQLWEALKLCVDYNVPMTEELAEKLSPPRLNENIEHTQTSISRINSSPHEYTEAERLRLLEGIAEIALSQRQYHLACKKFTQAGNQMMAMKSLLKSGDTEKIIRFANISKTKEVYVLAANYLQNLDWRRDPDIMKNIITFYTKGKALERLATFYEACSQSEIEEYQNYSKAIGALGEAYKYWSKMKFESENQKNVKLDSIRNKCTLMKKFLATIEMFETSPDEAIHQCQLLLDEPNIDVAIRYGDIYSHMIQYFIHQSKFKAAYACLDEM 4638
            K+ S+SLPV  FWD  + RL+  E++S   K L               + N +  S F      +L +    C    E + +          + N I  K    +         + ++DFV L+  + + ++ +LNFS Y+  GNMD A++S++ I+S+++W N+A+MCV T RLDVA VC+G +  A +   LR+A ++   E +AKVA+LA+ L M EEA  L  + +R+D+LN+L Q++   ++A+++AE  DRIHLK TYY  A+ L E      ALE F K+   A  + ++L   P  ++++I+   +  L KWW QY+E  G+M AAL  Y  A+D FS V+    LG   KA  +   +GDRAACYHLAR +E      +AI +++RA+ +++AIR+CKEN   + L  +A   +  ++  AA+Y +    ++  AV L+H+AG + +A+++A +++Q   L+ I++DL+     +L+ +CA FF    QF +AV +LA ++ L  AL +C +  VP+TEEL+E L+P +                    E+ EA R+ +L  + E    Q  YH A KKFTQAG+++ AMKSLLKSG+T+KII FAN+S+ +EVY++AANYLQ LDW+ DP ++K+I+TFYTKG+A + LA FY  C+Q EIEE+Q+Y KA+ A+ EA K   K+        N++      K  L  +      + E      I  C+ +L +P +   IR+  I + +I+  ++   +  A   L E+
Sbjct:  652 KESSTSLPVRIFWDAEEPRLLATEVKSMIQKTL--------------PQKNSLQPSHFVQSKVVLLFYSEKGCLNVLETQSMSPGCQLLNLCVPNVIRLKINTME--------EQPLQDFVDLQQCNPVTRKQVLNFSLYVAEGNMDMAYRSIRSIQSKVIWTNLAKMCVHTNRLDVAKVCMGHLEQARSVRALRQAIEDDDLETEAKVAVLAIELGMIEEAKDLYRRCKRFDLLNKLLQSIGHLDEAVELAEAEDRIHLKHTYYQKAQELRERGDIKGALEYFEKTQNPAQNITQLLLENPGAMKRYIQTTSDPKLLKWWGQYIESSGDMDAALAVYHKAEDWFSQVKILCYLGKISKADAIARQSGDRAACYHLARHYENVGKFQEAIMFFTRAQTFSNAIRICKENDFQEELWTVASSSRQRDKAIAAAYFEECGNFK-HAVELYHRAGMLHKALEMAFESQQPEILEIIASDLAPDSDAELINRCADFFCSIEQFQKAVHLLAKTRHLERALGICSEKGVPVTEELSEMLTPEK-------------------GEFEEATRVHILVQLGEFLQQQGDYHSATKKFTQAGDKIRAMKSLLKSGNTDKIIFFANMSRQREVYIMAANYLQALDWQSDPQVLKHIVTFYTKGQAFDSLANFYAICAQIEIEEFQDYGKALTAMQEASKCLEKLSHAQHVYNNLQRTVADVKAILEIQ----QALREGDHQLVIGSCRSMLIKPELP-PIRHAHILAMLIRALVYVKDYSEAGRALKEL 1383          

HSP 2 Score: 137.117 bits (344), Expect = 6.568e-32
Identity = 146/665 (21.95%), Postives = 272/665 (40.90%), Query Frame = 1
Query:  262 SAILWHPSKAQLAVGWSDGQISLFDETQNVSNESLHLHCLPIASFAWSSHGSKLMSADIEGHLYAWKIDARGSFSQNPIFNFSANCPINCILLRMPKLKGSDVYD-IRELAKAAVSGDERALD-LMSWTKSSSGIKLTGYSYMEVSNFFAGLGDGRVILINEDGKTTNITSLSG--SVVRLLYHEERDVLIATTDIGMLTQHQLLSDGSSKEVMKVKLASRTPNPS--LIWAGPSTLAISLGESMIRMWDIDREENYML--------QPSEDMGYTKMGLLS--------------------------------VVDYCASQRTIVAGSNKGQIVMWKMMGNEESYSKENPENRWCLQPATELHVNGQVSAGSIEKLVASSTNVIAAGTSSNIMYILEEKPMISAFYNGIVITQKGASELFIQL-YSSCKESNDNKMFTNEPVLDEQYQETTEKKMECFTIAVEHLITLMDCTRENLIISDGKTVFVYELKLRSSDL-------------------------ASLCGQFESPTFILKIHQQNIYVSEKSQLQIRNFQGIIKQVVDLGNMDGKLSHIDINNNFMVCTTDKCCLRIYDLSRRDPKPI-------GIIKDFGECIPAVTMIASVSINCNGTVVSLIVEKQKETD-PKLYFWNIETDSI 2016
            +A+ WHP KA LA GW  G I ++             H   I    +S  G ++++AD  G +  W+ D +  F    +  FS +     +L+       S+V + +  LAKAAV+GDE ALD L +W   ++   +T     +   F+A    G V  IN+ G    +        +V++L+H  +D +I   +   +T   + S G   E+ +VK++ R       + W+G S LAI  G+  +R+WDI+R +NY+L        QP   M     G +S                                 + Y ++ +T+ AG+++G +  WK  G+    +   PE+ W L   + +    +       +L   +   +     SN+ ++L+E+P+++     +   Q+ A    +QL + S +E+                            +  E  +T M  +  +L++S+G+++  Y L+     L                           L   F +    L +  QNI+    S + + +  G++   +   +++GK+  +D++  ++   T    ++ YD+SR DPK +        I  DFGE I        V  N +G+ +++++     T    L+ W+ E  ++
Sbjct:   22 TALCWHPEKALLASGWEHGDIHVWFAGHREFASVNAPHKAAIVLLQFSEQGGRMVTADAMGLVTGWRCDGQYQF----LTMFSHDLREVLLLICFRLTVESEVREEMANLAKAAVAGDENALDTLTNWRPRTAARSMTHSGVRDNHCFYACTQGGVVYYINQGGACVEVMKCGSLPPIVQMLWHPRKDAVICLMEDLTVTLFLVESTGILTELDRVKMSGRGGGRQGGIAWSGNS-LAIITGDFFVRIWDIERSDNYLLKMDLPSGNQPGSSMTTLSNGTMSSSNQFFSHDSSESSGVLRKTPKYGQLNGEMFTCLAYSSTGQTLCAGTSQGNVYTWKRSGSRLVGA---PEDAWQLTNISSVRGAIRSCEWGYNEL---AKPCMLVNCLSNV-FMLKEQPLLAVHTRELWAVQRSAKS--VQLTHCSGREA---------------------------IVQSEFAVTAMALSELSLVMSNGRSISSYSLQKVEKSLDEFEEILQTVEGTTPTTESTTTPLSLKLLQTFAAECLALNLCNQNIFCLGSSDVFVYSVGGVVLHRIQASDIEGKIIGMDLSGCYLSVFTMNGYVKAYDVSRHDPKLLFPSKSGHDIFDDFGEFIL-------VKCNSSGSHLAMVIASSNFTPISTLFCWDFERSNL 638          
BLAST of Intraflagellar transport protein 140 vs. Ensembl Fly
Match: rempA (gene:FBgn0260933 transcript:FBtr0078078)

HSP 1 Score: 486.108 bits (1250), Expect = 4.310e-145
Identity = 281/779 (36.07%), Postives = 442/779 (56.74%), Query Frame = 1
Query: 2308 KDVSSSLPVSHFWDKIDHRLIVVEIRSFDDKELNFNFTNISSIGEKVKKNNRVLVSLFATQDDGILMFDNIICDEEYE-RLIGFDAPYYFFAIRNDIAYKKQAKDGLTCSFITPRVMRDFVGLEDSDGINKQALLNFSYYLTIGNMDEAFKSMKLIKSELVWRNMARMCVKTRRLDVATVCLGKMNYACAAMQLREARQNLP-ELDAKVAMLALHLDMKEEAIKLLEKSQRYDILNELYQAMEEWNKALDVAEKHDRIHLKTTYYNYAKYLEEEKRYSEALENFVKSGTHAFEVPRMLFNQPDELEKFIRERPEKALRKWWAQYMECCGEMKAALEFYAAAQDNFSLVRAYWLLGMEKKATEVCNDTGDRAACYHLARQFEATNNVDQAIHYYSRAKAYNSAIRLCKENKKDDHLVNLALLCKPEEQVEAASYLQTRNGYQDKAVILFHKAGQVSRAIDLACKTKQFGALQHISNDLSDKVHPDLLQKCASFFMENNQFDRAVDMLASSKQLWEALKLCVDYNVPMTEELAEKLSPPRLNENIEHTQTSISRINSSPHEYTEAERLRLLEGIAEIALSQRQYHLACKKFTQAGNQMMAMKSLLKSGDTEKIIRFANISKTKEVYVLAANYLQNLDWRRDPDIMKNIITFYTKGKALERLATFYEACSQSEIEEYQNYSKAIGALGEAYKYWSKMKFESENQKNVKLDSIRNKCTLMKKFLATIEMFETSPDEAIHQCQLLLDEPNIDVAIRYGDIYSHMIQYFIHQSKFKAAYACLDEM 4638
            K+ S+SLPV  FWD  + RL+  E++S   K L               + N +  S F      +L +    C    E + +          + N I  K    +         + ++DFV L+  + + ++ +LNFS Y+  GNMD A++S++ I+S+++W N+A+MCV T RLDVA VC+G +  A +   LR+A ++   E +AKVA+LA+ L M EEA  L  + +R+D+LN+L Q++   ++A+++AE  DRIHLK TYY  A+ L E      ALE F K+   A  + ++L   P  ++++I+   +  L KWW QY+E  G+M AAL  Y  A+D FS V+    LG   KA  +   +GDRAACYHLAR +E      +AI +++RA+ +++AIR+CKEN   + L  +A   +  ++  AA+Y +    ++  AV L+H+AG + +A+++A +++Q   L+ I++DL+     +L+ +CA FF    QF +AV +LA ++ L  AL +C +  VP+TEEL+E L+P +                    E+ EA R+ +L  + E    Q  YH A KKFTQAG+++ AMKSLLKSG+T+KII FAN+S+ +EVY++AANYLQ LDW+ DP ++K+I+TFYTKG+A + LA FY  C+Q EIEE+Q+Y KA+ A+ EA K   K+        N++      K  L  +      + E      I  C+ +L +P +   IR+  I + +I+  ++   +  A   L E+
Sbjct:  697 KESSTSLPVRIFWDAEEPRLLATEVKSMIQKTL--------------PQKNSLQPSHFVQSKVVLLFYSEKGCLNVLETQSMSPGCQLLNLCVPNVIRLKINTME--------EQPLQDFVDLQQCNPVTRKQVLNFSLYVAEGNMDMAYRSIRSIQSKVIWTNLAKMCVHTNRLDVAKVCMGHLEQARSVRALRQAIEDDDLETEAKVAVLAIELGMIEEAKDLYRRCKRFDLLNKLLQSIGHLDEAVELAEAEDRIHLKHTYYQKAQELRERGDIKGALEYFEKTQNPAQNITQLLLENPGAMKRYIQTTSDPKLLKWWGQYIESSGDMDAALAVYHKAEDWFSQVKILCYLGKISKADAIARQSGDRAACYHLARHYENVGKFQEAIMFFTRAQTFSNAIRICKENDFQEELWTVASSSRQRDKAIAAAYFEECGNFK-HAVELYHRAGMLHKALEMAFESQQPEILEIIASDLAPDSDAELINRCADFFCSIEQFQKAVHLLAKTRHLERALGICSEKGVPVTEELSEMLTPEK-------------------GEFEEATRVHILVQLGEFLQQQGDYHSATKKFTQAGDKIRAMKSLLKSGNTDKIIFFANMSRQREVYIMAANYLQALDWQSDPQVLKHIVTFYTKGQAFDSLANFYAICAQIEIEEFQDYGKALTAMQEASKCLEKLSHAQHVYNNLQRTVADVKAILEIQ----QALREGDHQLVIGSCRSMLIKPELP-PIRHAHILAMLIRALVYVKDYSEAGRALKEL 1428          

HSP 2 Score: 140.198 bits (352), Expect = 7.745e-33
Identity = 158/731 (21.61%), Postives = 291/731 (39.81%), Query Frame = 1
Query:   76 MAIYLTKQLNLDDVQILDI--KFHQKLELLAISVIRESSHGHVIIANNKGEIFNSCK--ISKPQPISAILWHPSKAQLAVGWSDGQISLFDETQNVSNESLHLHCLPIASFAWSSHGSKLMSADIEGHLYAWKIDARGSFSQNPIFNFSANCPINCILLRMPKLKGSDVYD-IRELAKAAVSGDERALD-LMSWTKSSSGIKLTGYSYMEVSNFFAGLGDGRVILINEDGKTTNITSLSG--SVVRLLYHEERDVLIATTDIGMLTQHQLLSDGSSKEVMKVKLASRTPNPS--LIWAGPSTLAISLGESMIRMWDIDREENYML--------QPSEDMGYTKMGLLS--------------------------------VVDYCASQRTIVAGSNKGQIVMWKMMGNEESYSKENPENRWCLQPATELHVNGQVSAGSIEKLVASSTNVIAAGTSSNIMYILEEKPMISAFYNGIVITQKGASELFIQL-YSSCKESNDNKMFTNEPVLDEQYQETTEKKMECFTIAVEHLITLMDCTRENLIISDGKTVFVYELKLRSSDL-------------------------ASLCGQFESPTFILKIHQQNIYVSEKSQLQIRNFQGIIKQVVDLGNMDGKLSHIDINNNFMVCTTDKCCLRIYDLSRRDPKPI-------GIIKDFGECIPAVTMIASVSINCNGTVVSLIVEKQKETD-PKLYFWNIETDSI 2016
            M +Y   ++   D   +     +H    L A++       G V I  + GE        +      +A+ WHP KA LA GW  G I ++             H   I    +S  G ++++AD  G +  W+ D +  F    +  FS +     +L+       S+V + +  LAKAAV+GDE ALD L +W   ++   +T     +   F+A    G V  IN+ G    +        +V++L+H  +D +I   +   +T   + S G   E+ +VK++ R       + W+G S LAI  G+  +R+WDI+R +NY+L        QP   M     G +S                                 + Y ++ +T+ AG+++G +  WK  G   S     PE+ W L   + +    +       +L   +   +     SN+ ++L+E+P+++     +   Q+ A    +QL + S +E+                            +  E  +T M  +  +L++S+G+++  Y L+     L                           L   F +    L +  QNI+    S + + +  G++   +   +++GK+  +D++  ++   T    ++ YD+SR DPK +        I  DFGE I        V  N +G+ +++++     T    L+ W+ E  ++
Sbjct:    1 MTLYFDTKIEFLDSDAVSTISSWHPSEPLFAVASFSPERGGSVTIFADTGEPQRDVTYPVHATSQATALCWHPEKALLASGWEHGDIHVWFAGHREFASVNAPHKAAIVLLQFSEQGGRMVTADAMGLVTGWRCDGQYQF----LTMFSHDLREVLLLICFRLTVESEVREEMANLAKAAVAGDENALDTLTNWRPRTAARSMTHSGVRDNHCFYACTQGGVVYYINQGGACVEVMKCGSLPPIVQMLWHPRKDAVICLMEDLTVTLFLVESTGILTELDRVKMSGRGGGRQGGIAWSGNS-LAIITGDFFVRIWDIERSDNYLLKMDLPSGNQPGSSMTTLSNGTMSSSNQFFSHDSSESSGVLRKTPKYGQLNGEMFTCLAYSSTGQTLCAGTSQGNVYTWKRSG---SRLVGAPEDAWQLTNISSVRGAIRSCEWGYNEL---AKPCMLVNCLSNV-FMLKEQPLLAVHTRELWAVQRSAKS--VQLTHCSGREA---------------------------IVQSEFAVTAMALSELSLVMSNGRSISSYSLQKVEKSLDEFEEILQTVEGTTPTTESTTTPLSLKLLQTFAAECLALNLCNQNIFCLGSSDVFVYSVGGVVLHRIQASDIEGKIIGMDLSGCYLSVFTMNGYVKAYDVSRHDPKLLFPSKSGHDIFDDFGEFIL-------VKCNSSGSHLAMVIASSNFTPISTLFCWDFERSNL 683          
BLAST of Intraflagellar transport protein 140 vs. Ensembl Zebrafish
Match: ift140 (intraflagellar transport 140 homolog (Chlamydomonas) [Source:ZFIN;Acc:ZDB-GENE-040724-165])

HSP 1 Score: 702.59 bits (1812), Expect = 0.000e+0
Identity = 368/812 (45.32%), Postives = 541/812 (66.63%), Query Frame = 1
Query: 2308 KDVSSSLPVSHFWDKIDHRLIVVEIRSFDDKELNFNFTNISSIGEKVKKNNRVLVSLFATQDDGILMFDNIICDEEYERLIGFDAPYYFFAIR------NDIAYKKQAKDGLTCSFITPRVMRDFVGLEDSDGINKQALLNFSYYLTIGNMDEAFKSMKLIKSELVWRNMARMCVKTRRLDVATVCLGKMNYACAAMQLREARQNLPELDAKVAMLALHLDMKEEAIKLLEKSQRYDILNELYQAMEEWNKALDVAEKHDRIHLKTTYYNYAKYLEEEKRYSEALENFVKSGTHAFEVPRMLFNQPDELEKFIRERPEKALRKWWAQYMECCGEMKAALEFYAAAQDNFSLVRAYWLLGMEKKATEVCNDTGDRAACYHLARQFEATNNVDQAIHYYSRAKAYNSAIRLCKENKKDDHLVNLALLCKPEEQVEAASYLQTRNGYQDKAVILFHKAGQVSRAIDLACKTKQFGALQHISNDLSDKVHPDLLQKCASFFMENNQFDRAVDMLASSKQLWEALKLCVDYNVPMTEELAEKLSPPRLNENIEHTQTSISRINSSPHEYTEAERLRLLEGIAEIALSQRQYHLACKKFTQAGNQMMAMKSLLKSGDTEKIIRFANISKTKEVYVLAANYLQNLDWRRDPDIMKNIITFYTKGKALERLATFYEACSQSEIEEYQNYSKAIGALGEAYKYWSKMKFESENQKNVKLDSIRNKCTLMKKFLATIEMFETSPDEAIHQCQLLLDEPNIDVAIRYGDIYSHMIQYFIHQSKFKAAYACLDEMKRRIRNPSI-VTAYIDVATLEFLHKSLGI 4722
            +++++  PVS FWD+ + RL V E  S +  +L+       S   + +K + ++V+ F TQ+ G+L+ D+         L+  D PYY++  +              +    +   +  + +RDFVGLE  +   + A+LNFS+YLTIG+MDEAFK++KLIKSE VW NMARMCVK+RRLDVA VCLG M  A AA  LR+A +  PE++A+VA+LA  L M E+A +L +   R+D+LN+ YQA  +W +A++ AE HDRIHL+TTYY+YAK+LE     + AL  F KS TH FEVPRML      LE +I +  +K L KWW  Y+E   +M+AAL +Y  AQD  S VR +  LG  +KA+E+ N+TG+RAA YH+ARQ+E  + + Q++H+Y+RA+AYN+AIRLCKEN  DD L+NLALL  PE+ ++ A Y + +  + D+AV+L+HKAG VS+A++LA  T+QFGALQ I+ DL++   P LL +C+ FF+++ Q+ +AV++L ++K+  EAL+LC+D ++ +TE+LAE L+ P+ +  +                 +EA R  LLE IA+  + Q  YHLA KK+TQAGN++ AM++LLKSGDTEKI+ FA +S+ KE+YV+AANYLQ+LDWR D +IMKNII+FYTKG+ALE LA FYEAC++ EI++YQNY KA GAL EA K  +K K  S  + + KL  + ++  L+K+F+    M E  P EA+  C+ LL+E ++D+A+R GD+Y  +++++ H   F  A++ ++E+  R  +P I ++ Y+   +LE L  + GI
Sbjct:  635 EELAARCPVSQFWDENEPRLFVCETVSVN-SDLH------GSRQRQTEKEDVMVVTFFVTQEHGLLLQDSQPKPAALLGLLALDTPYYYYICKLGESGDQGSVVPSSSAQSSSPQMVVRQALRDFVGLESCEKQTRDAMLNFSFYLTIGDMDEAFKAIKLIKSEAVWENMARMCVKSRRLDVARVCLGNMGNARAARALRDAEKE-PEVEAQVAVLATQLGMLEDAEQLYKSCGRFDLLNKFYQAAGQWQQAVETAETHDRIHLRTTYYSYAKHLEAMGDKNLALVYFEKSDTHRFEVPRMLMEDNVSLEIYINKMRDKDLYKWWGHYLESQSDMEAALHYYDLAQDYLSQVRVHCYLGSIQKASEIANETGNRAASYHVARQYEGQDEISQSVHFYTRAQAYNNAIRLCKENNLDDQLMNLALLSNPEDMMDTAMYYEEKGTHMDRAVMLYHKAGHVSKALELAFATEQFGALQLIAEDLNEASDPALLARCSDFFIKHAQYQKAVELLVAAKKYHEALQLCLDQSLTITEDLAESLTVPKDSTLL-----------------SEAGRKELLEKIADCCMRQGNYHLATKKYTQAGNKIKAMRALLKSGDTEKIVFFAGVSRQKEIYVMAANYLQSLDWRNDAEIMKNIISFYTKGRALELLAGFYEACAEVEIDDYQNYEKAYGALTEACKCLTKAKGRSGEEADGKLLILTHRLGLIKRFIQARRMHEEDPVEAVRLCESLLEEKDLDLAVRVGDVYGFLVEHYCHHGNFTQAWSKIEEL--RSTHPKINLSMYVSQTSLEALQNAAGI 1419          

HSP 2 Score: 313.153 bits (801), Expect = 1.900e-86
Identity = 196/664 (29.52%), Postives = 334/664 (50.30%), Query Frame = 1
Query:   76 MAIYLTKQLNLDD---VQILDIKFHQKLELLAISVIRESSHGHVIIANNKGEIFNSCKISKPQPISAILWHPSKAQLAVGWSDGQISLFD----ETQNVSNESLHLHCLPIASFAWSSHGSKLMSADIEGHLYAWKIDARGSFSQNPIFNFSANCPINCILLRMPKLKGSDVYDIRELAKAAVSGDERALDLMSWTKSSSGIKLTGYSYMEVSNFFAGLGDGRVILINEDGKTTNITSLSGSVVRLLYHEERDVLIATTDIGMLTQHQLLSDGSSKEVMKVKLASRT-PNPSLIWAGPSTLAISLGESMIRMWDIDREENYMLQPSEDMGYTKMGLLSVVDYCASQRTIVAGSNKGQIVMWKMMGNEESYSKENPENRWCLQPATELHVNGQVSAGSIEKLVASSTNVIAAGTSSNIMYILEEKPMISAFYNGIVITQKGASELFIQLYSSCKESNDNKMFTNEPVLDEQYQETTEKKMECFTIAVEHLITLMDCTRENLIISDGKTVFVYELKLRSSDLASLCGQFESPTFILKIHQQNIYVSEKSQLQIRNFQGIIKQVVDLGNMDGKLSHIDINNNFMVCTTDKCCLRIYDLSRRDPKPIGIIKDFGECIPAVTMIASVSINCNGTVVS-LIVEKQKETDPKLYFWNIETDSIQYFNFSTG 2040
            MA+Y   +    D   V +L I +H  + +LA+  +  S+ G V +   +GE    C + +    S + WHP+K  LAVGW  G+  L      E   + N + H  C+ +    WSS+GS+L++ D  G +  WK+DARG    +P+     + P+ C + R P        D+  LA+AAVSGDE ALD+ +W KSS G      S  E   F+    DG V  ++E  K+  + S+  +V ++ Y + R  L   TD   L+Q  L  +G ++E+ KVKL+ R  PN  ++W     L  + GE  IR+W ++ +++Y L   E +G+ K   L+ V +C S++ + AG+++G++ +W M+    S  K + + +W LQ   E+        G+I +L   S+  + A  SS+ + IL E  M S +   +   Q   ++L +  ++    SN +  F  +                         I  +  T+  + + +GK + VYE    S       G F+  +  L +H++NIY  E +++QIR  QG +KQ++     +G  + + +  +++   TD C +R++DL+RR+ KP+G+ K+  E I  +  + SV  N +G+ +S LI +     D ++YF++IE D++ YF+F TG
Sbjct:    1 MAVYFDHRAEAPDSSGVPVL-ISWHSSVCVLAVGSVNPSTGGCVDLYLQQGEHVELCHVERGFSPSLLQWHPNKPLLAVGWETGETILLSHPSGEHTPLPNNT-HTACITV--LEWSSNGSRLVTGDQAGVMAVWKVDARGKLQGSPLIKHDYSRPLTCCIFRPPP----PAEDVAMLARAAVSGDENALDMFNWKKSSKGAAFALGS-QEGLAFYISTADGSVYSVDEQVKSVPLLSVESAVHKMWYSKRRSALAVVTDSLQLSQFSLGPEGFAQEISKVKLSGRGGPNADVVWTEGGLLITASGELHIRLWHVELDDHYALSLDESLGFEKGERLNCVSFCTSKQVLAAGTSRGRVALWHML--TVSDQKGDSKTQWKLQTPAEVE-------GNISQLQWGSSAHLLAVCSSSSVVILSEHVMCSHYSQQMAAVQLTPTQLSLANFT----SNTHITFNTDT-----------------------HIRAVQLTKNMVAVWNGKMITVYE---PSGQTLHSTGSFQCESPALALHEENIYTIEPNRVQIRTPQGTVKQLLVFSEAEGNPTLLSVCGSYLAVGTDTCHIRVFDLTRREAKPLGVTKNLSELISDLGALRSVKCNASGSQISVLITQINGRPDNRVYFYDIELDTLSYFDFFTG 616          
BLAST of Intraflagellar transport protein 140 vs. Ensembl Zebrafish
Match: ift140 (intraflagellar transport 140 homolog (Chlamydomonas) [Source:ZFIN;Acc:ZDB-GENE-040724-165])

HSP 1 Score: 702.59 bits (1812), Expect = 0.000e+0
Identity = 368/812 (45.32%), Postives = 541/812 (66.63%), Query Frame = 1
Query: 2308 KDVSSSLPVSHFWDKIDHRLIVVEIRSFDDKELNFNFTNISSIGEKVKKNNRVLVSLFATQDDGILMFDNIICDEEYERLIGFDAPYYFFAIR------NDIAYKKQAKDGLTCSFITPRVMRDFVGLEDSDGINKQALLNFSYYLTIGNMDEAFKSMKLIKSELVWRNMARMCVKTRRLDVATVCLGKMNYACAAMQLREARQNLPELDAKVAMLALHLDMKEEAIKLLEKSQRYDILNELYQAMEEWNKALDVAEKHDRIHLKTTYYNYAKYLEEEKRYSEALENFVKSGTHAFEVPRMLFNQPDELEKFIRERPEKALRKWWAQYMECCGEMKAALEFYAAAQDNFSLVRAYWLLGMEKKATEVCNDTGDRAACYHLARQFEATNNVDQAIHYYSRAKAYNSAIRLCKENKKDDHLVNLALLCKPEEQVEAASYLQTRNGYQDKAVILFHKAGQVSRAIDLACKTKQFGALQHISNDLSDKVHPDLLQKCASFFMENNQFDRAVDMLASSKQLWEALKLCVDYNVPMTEELAEKLSPPRLNENIEHTQTSISRINSSPHEYTEAERLRLLEGIAEIALSQRQYHLACKKFTQAGNQMMAMKSLLKSGDTEKIIRFANISKTKEVYVLAANYLQNLDWRRDPDIMKNIITFYTKGKALERLATFYEACSQSEIEEYQNYSKAIGALGEAYKYWSKMKFESENQKNVKLDSIRNKCTLMKKFLATIEMFETSPDEAIHQCQLLLDEPNIDVAIRYGDIYSHMIQYFIHQSKFKAAYACLDEMKRRIRNPSI-VTAYIDVATLEFLHKSLGI 4722
            +++++  PVS FWD+ + RL V E  S +  +L+       S   + +K + ++V+ F TQ+ G+L+ D+         L+  D PYY++  +              +    +   +  + +RDFVGLE  +   + A+LNFS+YLTIG+MDEAFK++KLIKSE VW NMARMCVK+RRLDVA VCLG M  A AA  LR+A +  PE++A+VA+LA  L M E+A +L +   R+D+LN+ YQA  +W +A++ AE HDRIHL+TTYY+YAK+LE     + AL  F KS TH FEVPRML      LE +I +  +K L KWW  Y+E   +M+AAL +Y  AQD  S VR +  LG  +KA+E+ N+TG+RAA YH+ARQ+E  + + Q++H+Y+RA+AYN+AIRLCKEN  DD L+NLALL  PE+ ++ A Y + +  + D+AV+L+HKAG VS+A++LA  T+QFGALQ I+ DL++   P LL +C+ FF+++ Q+ +AV++L ++K+  EAL+LC+D ++ +TE+LAE L+ P+ +  +                 +EA R  LLE IA+  + Q  YHLA KK+TQAGN++ AM++LLKSGDTEKI+ FA +S+ KE+YV+AANYLQ+LDWR D +IMKNII+FYTKG+ALE LA FYEAC++ EI++YQNY KA GAL EA K  +K K  S  + + KL  + ++  L+K+F+    M E  P EA+  C+ LL+E ++D+A+R GD+Y  +++++ H   F  A++ ++E+  R  +P I ++ Y+   +LE L  + GI
Sbjct:  635 EELAARCPVSQFWDENEPRLFVCETVSVN-SDLH------GSRQRQTEKEDVMVVTFFVTQEHGLLLQDSQPKPAALLGLLALDTPYYYYICKLGESGDQGSVVPSSSAQSSSPQMVVRQALRDFVGLESCEKQTRDAMLNFSFYLTIGDMDEAFKAIKLIKSEAVWENMARMCVKSRRLDVARVCLGNMGNARAARALRDAEKE-PEVEAQVAVLATQLGMLEDAEQLYKSCGRFDLLNKFYQAAGQWQQAVETAETHDRIHLRTTYYSYAKHLEAMGDKNLALVYFEKSDTHRFEVPRMLMEDNVSLEIYINKMRDKDLYKWWGHYLESQSDMEAALHYYDLAQDYLSQVRVHCYLGSIQKASEIANETGNRAASYHVARQYEGQDEISQSVHFYTRAQAYNNAIRLCKENNLDDQLMNLALLSNPEDMMDTAMYYEEKGTHMDRAVMLYHKAGHVSKALELAFATEQFGALQLIAEDLNEASDPALLARCSDFFIKHAQYQKAVELLVAAKKYHEALQLCLDQSLTITEDLAESLTVPKDSTLL-----------------SEAGRKELLEKIADCCMRQGNYHLATKKYTQAGNKIKAMRALLKSGDTEKIVFFAGVSRQKEIYVMAANYLQSLDWRNDAEIMKNIISFYTKGRALELLAGFYEACAEVEIDDYQNYEKAYGALTEACKCLTKAKGRSGEEADGKLLILTHRLGLIKRFIQARRMHEEDPVEAVRLCESLLEEKDLDLAVRVGDVYGFLVEHYCHHGNFTQAWSKIEEL--RSTHPKINLSMYVSQTSLEALQNAAGI 1419          

HSP 2 Score: 313.153 bits (801), Expect = 1.900e-86
Identity = 196/664 (29.52%), Postives = 334/664 (50.30%), Query Frame = 1
Query:   76 MAIYLTKQLNLDD---VQILDIKFHQKLELLAISVIRESSHGHVIIANNKGEIFNSCKISKPQPISAILWHPSKAQLAVGWSDGQISLFD----ETQNVSNESLHLHCLPIASFAWSSHGSKLMSADIEGHLYAWKIDARGSFSQNPIFNFSANCPINCILLRMPKLKGSDVYDIRELAKAAVSGDERALDLMSWTKSSSGIKLTGYSYMEVSNFFAGLGDGRVILINEDGKTTNITSLSGSVVRLLYHEERDVLIATTDIGMLTQHQLLSDGSSKEVMKVKLASRT-PNPSLIWAGPSTLAISLGESMIRMWDIDREENYMLQPSEDMGYTKMGLLSVVDYCASQRTIVAGSNKGQIVMWKMMGNEESYSKENPENRWCLQPATELHVNGQVSAGSIEKLVASSTNVIAAGTSSNIMYILEEKPMISAFYNGIVITQKGASELFIQLYSSCKESNDNKMFTNEPVLDEQYQETTEKKMECFTIAVEHLITLMDCTRENLIISDGKTVFVYELKLRSSDLASLCGQFESPTFILKIHQQNIYVSEKSQLQIRNFQGIIKQVVDLGNMDGKLSHIDINNNFMVCTTDKCCLRIYDLSRRDPKPIGIIKDFGECIPAVTMIASVSINCNGTVVS-LIVEKQKETDPKLYFWNIETDSIQYFNFSTG 2040
            MA+Y   +    D   V +L I +H  + +LA+  +  S+ G V +   +GE    C + +    S + WHP+K  LAVGW  G+  L      E   + N + H  C+ +    WSS+GS+L++ D  G +  WK+DARG    +P+     + P+ C + R P        D+  LA+AAVSGDE ALD+ +W KSS G      S  E   F+    DG V  ++E  K+  + S+  +V ++ Y + R  L   TD   L+Q  L  +G ++E+ KVKL+ R  PN  ++W     L  + GE  IR+W ++ +++Y L   E +G+ K   L+ V +C S++ + AG+++G++ +W M+    S  K + + +W LQ   E+        G+I +L   S+  + A  SS+ + IL E  M S +   +   Q   ++L +  ++    SN +  F  +                         I  +  T+  + + +GK + VYE    S       G F+  +  L +H++NIY  E +++QIR  QG +KQ++     +G  + + +  +++   TD C +R++DL+RR+ KP+G+ K+  E I  +  + SV  N +G+ +S LI +     D ++YF++IE D++ YF+F TG
Sbjct:    1 MAVYFDHRAEAPDSSGVPVL-ISWHSSVCVLAVGSVNPSTGGCVDLYLQQGEHVELCHVERGFSPSLLQWHPNKPLLAVGWETGETILLSHPSGEHTPLPNNT-HTACITV--LEWSSNGSRLVTGDQAGVMAVWKVDARGKLQGSPLIKHDYSRPLTCCIFRPPP----PAEDVAMLARAAVSGDENALDMFNWKKSSKGAAFALGS-QEGLAFYISTADGSVYSVDEQVKSVPLLSVESAVHKMWYSKRRSALAVVTDSLQLSQFSLGPEGFAQEISKVKLSGRGGPNADVVWTEGGLLITASGELHIRLWHVELDDHYALSLDESLGFEKGERLNCVSFCTSKQVLAAGTSRGRVALWHML--TVSDQKGDSKTQWKLQTPAEVE-------GNISQLQWGSSAHLLAVCSSSSVVILSEHVMCSHYSQQMAAVQLTPTQLSLANFT----SNTHITFNTDT-----------------------HIRAVQLTKNMVAVWNGKMITVYE---PSGQTLHSTGSFQCESPALALHEENIYTIEPNRVQIRTPQGTVKQLLVFSEAEGNPTLLSVCGSYLAVGTDTCHIRVFDLTRREAKPLGVTKNLSELISDLGALRSVKCNASGSQISVLITQINGRPDNRVYFYDIELDTLSYFDFFTG 616          
BLAST of Intraflagellar transport protein 140 vs. Ensembl Zebrafish
Match: BX294098.2 (intraflagellar transport 140 homolog (Chlamydomonas) [Source:NCBI gene;Acc:553213])

HSP 1 Score: 675.626 bits (1742), Expect = 0.000e+0
Identity = 341/697 (48.92%), Postives = 489/697 (70.16%), Query Frame = 1
Query: 2635 FITPRVMRDFVGLEDSDGINKQALLNFSYYLTIGNMDEAFKSMKLIKSELVWRNMARMCVKTRRLDVATVCLGKMNYACAAMQLREARQNLPELDAKVAMLALHLDMKEEAIKLLEKSQRYDILNELYQAMEEWNKALDVAEKHDRIHLKTTYYNYAKYLEEEKRYSEALENFVKSGTHAFEVPRMLFNQPDELEKFIRERPEKALRKWWAQYMECCGEMKAALEFYAAAQDNFSLVRAYWLLGMEKKATEVCNDTGDRAACYHLARQFEATNNVDQAIHYYSRAKAYNSAIRLCKENKKDDHLVNLALLCKPEEQVEAASYLQTRNGYQDKAVILFHKAGQVSRAIDLACKTKQFGALQHISNDLSDKVHPDLLQKCASFFMENNQFDRAVDMLASSKQLWEALKLCVDYNVPMTEELAEKLSPPRLNENIEHTQTSISRINSSPHEYTEAERLRLLEGIAEIALSQRQYHLACKKFTQAGNQMMAMKSLLKSGDTEKIIRFANISKTKEVYVLAANYLQNLDWRRDPDIMKNIITFYTKGKALERLATFYEACSQSEIEEYQNYSKAIGALGEAYKYWSKMKFESENQKNVKLDSIRNKCTLMKKFLATIEMFETSPDEAIHQCQLLLDEPNIDVAIRYGDIYSHMIQYFIHQSKFKAAYACLDEMKRRIRNPSI-VTAYIDVATLEFLHKSLGI 4722
             +  + +RDFVGLE  +   + A+LNFS+YLTIG+MDEAFK++KLIKSE VW NMARMCVK+RRLDVA VCLG M  A AA  LR+A +  PE++A+VA+LA  L M E+A +L +   R+D+LN+ YQA  +W +A++ AE HDRIHL+TTYY+YAK+LE     + AL  F KS TH FEVPRML      LE +I +  +K L KWW  Y+E   +M+AAL +Y  AQD  S VR +  LG  +KA+E+ N+TG+RAA YH+ARQ+E  + + Q++H+Y+RA+AYN+AIRLCKEN  DD L+NLALL  PE+ ++ A Y + +  + D+AV+L+HKAG VS+A++LA  T+QFGALQ I+ DL++   P LL +C+ FF+++ Q+ +AV++L ++K+  EAL+LC+D ++ +TE+LAE L+ P+ +  +                 +EA R  LLE IA+  + Q  YHLA KK+TQAGN++ AM++LLKSGDTEKI+ FA +S+ KE+YV+AANYLQ+LDWR D +IMKNII+FYTKG+ALE LA FYEAC++ EI++YQNY KA GAL EA K  +K K  S  + + KL  + ++  L+K+F+    M E  P EA+  C+ LL+E ++D+A+R GD++  +++++ H   F  A++ ++E+  R  +P I ++ Y+   +LE L  + GI
Sbjct:  712 MVVRQALRDFVGLEGCEKQTRDAMLNFSFYLTIGDMDEAFKAIKLIKSEAVWENMARMCVKSRRLDVARVCLGNMGNARAARALRDAEKE-PEVEAQVAVLATQLGMLEDAEQLYKSCGRFDLLNKFYQAAGQWQQAVETAETHDRIHLRTTYYSYAKHLEAMGDKNLALVYFEKSDTHRFEVPRMLMEDNVSLEIYINKMKDKDLYKWWGHYLESQSDMEAALHYYDLAQDYLSQVRVHCYLGSIQKASEIANETGNRAASYHVARQYEGQDEISQSVHFYTRAQAYNNAIRLCKENNLDDQLMNLALLSNPEDMIDTAMYYEEKGTHMDRAVMLYHKAGHVSKALELAFATEQFGALQLIAEDLNEASDPALLARCSDFFIKHAQYQKAVELLVAAKKYHEALQLCLDQSLTITEDLAESLTVPKDSTLL-----------------SEAGRKELLEKIADCCMRQGNYHLATKKYTQAGNKIKAMRALLKSGDTEKIVFFAGVSRQKEIYVMAANYLQSLDWRNDAEIMKNIISFYTKGRALELLAGFYEACAEVEIDDYQNYEKAYGALTEACKCLTKAKGRSGEEADGKLLILTHRLGLIKRFIQARRMHEEDPVEAVRLCESLLEEKDLDLAVRVGDVFGFLVEHYCHHGNFTQAWSKIEEL--RSTHPKINLSMYVSQTSLEALQNAAGI 1388          

HSP 2 Score: 312.768 bits (800), Expect = 2.459e-86
Identity = 196/664 (29.52%), Postives = 334/664 (50.30%), Query Frame = 1
Query:   76 MAIYLTKQLNLDD---VQILDIKFHQKLELLAISVIRESSHGHVIIANNKGEIFNSCKISKPQPISAILWHPSKAQLAVGWSDGQISLFD----ETQNVSNESLHLHCLPIASFAWSSHGSKLMSADIEGHLYAWKIDARGSFSQNPIFNFSANCPINCILLRMPKLKGSDVYDIRELAKAAVSGDERALDLMSWTKSSSGIKLTGYSYMEVSNFFAGLGDGRVILINEDGKTTNITSLSGSVVRLLYHEERDVLIATTDIGMLTQHQLLSDGSSKEVMKVKLASRT-PNPSLIWAGPSTLAISLGESMIRMWDIDREENYMLQPSEDMGYTKMGLLSVVDYCASQRTIVAGSNKGQIVMWKMMGNEESYSKENPENRWCLQPATELHVNGQVSAGSIEKLVASSTNVIAAGTSSNIMYILEEKPMISAFYNGIVITQKGASELFIQLYSSCKESNDNKMFTNEPVLDEQYQETTEKKMECFTIAVEHLITLMDCTRENLIISDGKTVFVYELKLRSSDLASLCGQFESPTFILKIHQQNIYVSEKSQLQIRNFQGIIKQVVDLGNMDGKLSHIDINNNFMVCTTDKCCLRIYDLSRRDPKPIGIIKDFGECIPAVTMIASVSINCNGTVVS-LIVEKQKETDPKLYFWNIETDSIQYFNFSTG 2040
            MA+Y   +    D   V +L I +H  + +LA+  +  S+ G V +   +GE    C + +    S + WHP+K  LAVGW  G+  L      E   + N + H  C+ +    WSS+GS+L++ D  G +  WK+DARG    +P+     + P+ C + R P        D+  LA+AAVSGDE ALD+ +W KSS G      S  E   F+    DG V  ++E  K+  + S+  +V ++ Y + R  L   TD   L+Q  L  +G ++E+ KVKL+ R  PN  ++W     L  + GE  IR+W ++ +++Y L   E +G+ K   L+ V +C S++ + AG+++G++ +W M+    S  K + + +W LQ   E+        G+I +L   S+  + A  SS+ + IL E  M S +   +   Q   ++L +  ++    SN +  F  +                         I  +  T+  + + +GK + VYE    S       G F+  +  L +H++NIY  E +++QIR  QG +KQ++     +G  + + +  +++   TD C +R++DL+RR+ KP+G+ K+  E I  +  + SV  N +G+ +S LI +     D ++YF++IE D++ YF+F TG
Sbjct:    1 MAVYFDHRAEAPDSSGVPVL-ISWHSSVCVLAVGSVNPSTGGCVDLYLQQGEHVELCHVERGFSPSLLQWHPNKPLLAVGWETGETILLSHPSGEHTPLPNNT-HTACITV--LEWSSNGSRLVTGDQAGVMAVWKVDARGKLQGSPLIKHDYSRPLTCCIFRPPP----PAEDVAMLARAAVSGDENALDMFNWKKSSKGAAFALGS-QEGLAFYISTADGSVYSVDEQVKSVPLLSVESAVHKMWYSKRRSALAVVTDSLQLSQFSLGPEGFAQEISKVKLSGRGGPNADVVWTEGGLLITASGELHIRLWHVELDDHYALSLDESLGFEKGERLNCVSFCTSKQVLAAGTSRGRVALWHML--TVSDQKGDSKTQWKLQTPAEVE-------GNISQLQWGSSAHLLAVCSSSSVVILSEHVMCSHYSQQMAAVQLTPTQLSLANFT----SNTHITFNTDT-----------------------HIRAVQLTKNMVAVWNGKMITVYE---PSGQTLHSTGSFQCESPALALHEENIYTIEPNRVQIRTPQGTVKQLLVFSEAEGNPTLLSVCGSYLAVGTDTCHIRVFDLTRREAKPLGVTKNLSELISDLGALRSVKCNASGSQISVLITQINGRPDNRVYFYDIELDTLSYFDFFTG 616          
BLAST of Intraflagellar transport protein 140 vs. Ensembl Zebrafish
Match: BX322565.1 (intraflagellar transport 140 homolog (Chlamydomonas) [Source:NCBI gene;Acc:553213])

HSP 1 Score: 617.846 bits (1592), Expect = 0.000e+0
Identity = 320/660 (48.48%), Postives = 458/660 (69.39%), Query Frame = 1
Query: 2746 EAFKSMKLIKSELVWRNMARMCVKTRRLDVATVCLGKMNYACAAMQLREARQNLPELDAKVAMLALHLDMKEEAIKLLEKSQRYDILNELYQAMEEWNKALDVAEKHDRIHLKTTYYNYAKYLEEEKRYSEALENFVKSGTHAFEVPRMLFNQPDELEKFIRERPEKALRKWWAQYMECCGEMKAALEFYAAAQDNFSLVRAYWLLGMEKKATEVCNDTGDRAACYHLARQFEATNNVDQAIHYYSRAKAYNSAIRLCKENKKDDHLVNLALLCKPEEQVEAASYLQTRNGYQDKAVILFHKAGQVSRAIDLACKTKQFGALQHISNDLSDKVHPDLLQKCASFFMENNQFDRAVDMLASSKQLWEALKLCVDYNVPMTEELAEKLSPPRLNENIEHTQTSISRINSSPHEYTEAERLRLLEGIAEIALSQRQYHLACKKFTQAGNQMMAMKSLLKSGDTEKIIRFANISKTKEVYVLAANYLQNLDWRRDPDIMKNIITFYTKGKALERLATFYEACSQSEIEEYQNYSKAIGALGEAYKYWSKMKFESENQKNVKLDSIRNKCTLMKKFLATIEMFETSPDEAIHQCQLLLDEPNIDVAIRYGDIYSHMIQYFIHQSKFKAAYACLDEMKRRIRNPSI-VTAYIDVATLEFLHKSLGI 4722
            +A KS+KL+    VW NMARMCVK+RRLDVA VCLG M  A AA  LR+A +  PE++A+VA+LA  L M E+A +L +   R+D+LN+ YQA  +W +A++ AE HDRIHL+TTYY+YAK+LE     + AL  F KS TH FEVPRML      LE +I +  +K L KWW  Y+E   +M+AAL +Y  AQD  S VR +  LG  +KA+E+ N+TG+RAA YH+ARQ+E  + + Q++H+Y+RA+AYN+AIRLCKEN  DD L+NLALL  PE+ ++ A Y + +  + D+AV+L+HKAG VS+A++LA  T+QFGALQ I+ DL++   P LL +C+ FF+++ Q+ +AV++L ++K+  EAL+LC+D ++ +TE+LAE L+ P+         T +S          EA R  LLE IA+  + Q  YHLA KK+TQAGN++ AM++LLKSGDTEKI+ FA +S+ KE+YV+AANYLQ+LDWR D +IMKNII+FYTKG+ALE LA FYEAC++ EI++YQNY KA GAL EA K  +K K  S  + + KL  + ++  L+K+F+    M E  P EA+  C+ LL+E ++D+A+R GD+Y  +++++ H   F  A++ ++E+  R  +P I ++ Y+   +LE L  + GI
Sbjct:    3 KAIKSIKLLIEFAVWENMARMCVKSRRLDVARVCLGNMGNARAARALRDAEKE-PEVEAQVAVLATQLGMLEDAEQLYKSCGRFDLLNKFYQAAGQWQQAVETAETHDRIHLRTTYYSYAKHLEAMGDKNLALVYFEKSDTHRFEVPRMLMEDNVSLEIYINKMKDKDLYKWWGHYLESQSDMEAALHYYDLAQDYLSQVRVHCYLGSIQKASEIANETGNRAASYHVARQYEGQDEISQSVHFYTRAQAYNNAIRLCKENNLDDQLMNLALLSNPEDMMDTAMYYEEKGTHMDRAVMLYHKAGHVSKALELAFATEQFGALQLIAEDLNEASDPALLARCSDFFIKHAQYQKAVELLVAAKKYHEALQLCLDQSLTITEDLAESLTVPK-------DSTLLS----------EAGRKELLEKIADCCMRQGNYHLATKKYTQAGNKIKAMRALLKSGDTEKIVFFAGVSRQKEIYVMAANYLQSLDWRNDAEIMKNIISFYTKGRALELLAGFYEACAEVEIDDYQNYEKAYGALTEACKCLTKAKGRSGEEADGKLLILTHRLGLIKRFIQARRMHEEDPVEAVRLCESLLEEKDLDLAVRVGDVYGFLVEHYCHHGNFTQAWSKIEEL--RSTHPKINLSMYVSQTSLEALQNAAGI 642          
BLAST of Intraflagellar transport protein 140 vs. Ensembl Zebrafish
Match: ift140 (intraflagellar transport 140 homolog (Chlamydomonas) [Source:ZFIN;Acc:ZDB-GENE-040724-165])

HSP 1 Score: 91.6633 bits (226), Expect = 8.939e-21
Identity = 47/99 (47.47%), Postives = 66/99 (66.67%), Query Frame = 1
Query: 2959 EEAIKLLEKSQRYDILNELYQAMEEWNKALDVAEKHDRIHLKTTYYNYAKYLEEEKRYSEALENFVKSGTHAFEVPRMLFNQPDELEKFIRERPEKALR 3255
            E+A +L +   R+D+LN+ YQA  +W +A++ AE HDRIHL+TTYY+YAK+LE     + AL  F KS TH FEVPRML      LE +I +  +K ++
Sbjct:    2 EDAEQLYKSCGRFDLLNKFYQAAGQWQQAVETAETHDRIHLRTTYYSYAKHLEAMGDKNLALVYFEKSDTHRFEVPRMLMEDNVSLEIYINKMRDKRVK 100          
BLAST of Intraflagellar transport protein 140 vs. Ensembl Xenopus
Match: ift140 (intraflagellar transport 140 [Source:NCBI gene;Acc:100144437])

HSP 1 Score: 800.045 bits (2065), Expect = 0.000e+0
Identity = 386/809 (47.71%), Postives = 568/809 (70.21%), Query Frame = 1
Query: 2326 LPVSHFWDKIDHRLIVVEIRSFDDKELNFNFTNISSIGEKVKKN---NRVLVSLFATQDDGILMFDNIICDEEYERLIGFDAPYYFFAIRNDIAYKKQAKDGLTCSFITPRVMRDFVGLEDSDGINKQALLNFSYYLTIGNMDEAFKSMKLIKSELVWRNMARMCVKTRRLDVATVCLGKMNYACAAMQLREARQNLPELDAKVAMLALHLDMKEEAIKLLEKSQRYDILNELYQAMEEWNKALDVAEKHDRIHLKTTYYNYAKYLEEEKRYSEALENFVKSGTHAFEVPRMLFNQPDELEKFIRERPEKALRKWWAQYMECCGEMKAALEFYAAAQDNFSLVRAYWLLGMEKKATEVCNDTGDRAACYHLARQFEATNNVDQAIHYYSRAKAYNSAIRLCKENKKDDHLVNLALLCKPEEQVEAASYLQTRNGYQDKAVILFHKAGQVSRAIDLACKTKQFGALQHISNDLSDKVHPDLLQKCASFFMENNQFDRAVDMLASSKQLWEALKLCVDYNVPMTEELAEKLSPPRLNENIEHTQTSISRINSSPHEYTEAERLRLLEGIAEIALSQRQYHLACKKFTQAGNQMMAMKSLLKSGDTEKIIRFANISKTKEVYVLAANYLQNLDWRRDPDIMKNIITFYTKGKALERLATFYEACSQSEIEEYQNYSKAIGALGEAYKYWSKMKFESENQKNVKLDSIRNKCTLMKKFLATIEMFETSPDEAIHQCQLLLDEPNIDVAIRYGDIYSHMIQYFIHQSKFKAAYACLDEMKRRIRNPSI-VTAYIDVATLEFLHKSLGIPFRQPS 4740
            +P++HFWD+ + RL+V E      K  N +  + S    ++ +    + +++SLF+TQ+ G+L+ ++       + L+G + P+Y+F  + + A + + +       +  R +RDF+GLE+ D   ++A+LNFS+YLT+G+MDEAFKS+KLIKSE VW NMARMCVKT+RLDVA VCLG M +A  A  LREA Q  PE++A+VAMLA+ L M EEA +L +   RYD+LN+LYQA  +W KA++ AE HDRIHL++TYYNYAK+LE    ++E+L  + KS TH FEVPRML + P  LE++I +  +K L KWWAQY+E    + AAL++Y  AQD  SLVR +  LG  ++A E+ N+TG+ AA YHLAR +E+   V QA+H+Y+RA+AYN+ IRLCKEN  DD L+NLALL  PE+ +EAA Y + +    D+AV+L+HKAG  S+A++LA  T+QFGALQ I+ DL +K  P LL +C+ FFM+++QF++AV++L ++K+ +EAL+LC++ N+ +TEE+AEK++                 ++ +  ++++  R  LL+ IA+  + Q  YHLA KK+TQAG+++ AMKSLLKSGDTEKI+ FA +S+ KE+Y++AANYLQ+LDWR+DP+IMKNII+FYTKG+ALE LA FY+AC+Q EI+EYQ+Y KA+GA  EAYK  SK K  S  ++  +L  ++ K TL+K+F+     +     EA+ QC+LLL+EP++D AIR GD+Y  +++++  Q  F+ AY CL+EM+ ++  PS+ +T Y+   T+E +H++L IPF + S
Sbjct:  617 IPINHFWDQSEPRLVVCEAMLAVPKSANTSPKHQSDQQTEIHQGKVCDILVISLFSTQEHGLLIQESFPRPAALQSLLGIEVPHYYFTKKEEKASETEVQAPQIPQMVAKRPLRDFIGLEECDKTTREAMLNFSFYLTVGDMDEAFKSIKLIKSEAVWENMARMCVKTKRLDVAKVCLGNMGHARGAKALREAEQE-PEVEARVAMLAIQLGMLEEAEQLYKSCLRYDLLNKLYQAWNQWQKAIETAENHDRIHLRSTYYNYAKHLEAIGEHNESLLLYEKSDTHRFEVPRMLLDDPQALEEYINKNKDKGLWKWWAQYLESQSNLDAALKYYEMAQDYLSLVRVHCFLGNIQRAAEIANETGNGAASYHLARHYESQEEVKQAVHFYTRAQAYNNGIRLCKENNMDDQLMNLALLSSPEDMMEAARYYEEKGEQMDRAVMLYHKAGHFSKALELAFTTEQFGALQLIAEDLDEKSDPALLARCSDFFMQHSQFEKAVELLLAAKKYYEALQLCMEQNLVITEEMAEKMT-----------------VSKNSKDFSDEARRELLQRIADCCMRQGNYHLATKKYTQAGDKLKAMKSLLKSGDTEKIVFFAGVSRQKEIYIMAANYLQSLDWRKDPEIMKNIISFYTKGRALELLAGFYDACAQVEIDEYQSYEKALGAFTEAYKCLSKAKMRSPEEQERRLSDMQAKMTLVKRFIQARRAYSVDSQEAVKQCELLLEEPDLDSAIRIGDVYGLLVEHYTQQGDFQKAYQCLEEMRSKM--PSVNLTYYVPQGTIEAVHRALSIPFNRHS 1405          

HSP 2 Score: 296.204 bits (757), Expect = 7.227e-81
Identity = 190/639 (29.73%), Postives = 322/639 (50.39%), Query Frame = 1
Query:  130 IKFHQKLELLAISVIRESSHGHVIIANNKGEIFNSCKISKPQPISAILWHPSKAQLAVGWSDGQISLFDETQNVSNESLHLHCLPIASFAWSSHGSKLMSADI--EGHLYAWKIDARGSFSQNPIFNFSANCPINCILLRMPKLKGSDVYDIRELAKAAVSGDERALDLMSWTKSSSGIKLTGYSYMEVSNFFAGLGDGRVILINEDGKTTNITSLSGSVVRLLYHEERDVLIATTDIGMLTQHQLLSDGSSKEVMKVKLASRTPNPSLI-WAGPSTLAISLGESMIRMWDIDREENYMLQPSEDMGYTKMGLLSVVDYCASQRTIVAGSNKGQIVMW-KMMGNEESYSKENPENRWCLQPATELHVN-GQVSAGSIEKLVASSTNVIAAGTSSNIMYILEEKPMISAFYNGIVITQKGASELFIQLYSSCKESNDNKMFTNEPVLDEQYQETTEKKMECFTIAVEHLITLMDCTRENLIISDGKTVFVYELKLRSSDLASLCGQFESPTFILKIHQQNIYVSEKSQLQIRNFQGIIKQVVDLGNMDGKLSHIDINNNFMVCTTDKCCLRIYDLSRRDPKPIGIIKDFGECIPAVTMIASVSINCNGTVVSLIVEKQKETDPKLYFWNIETDSIQYFNF 2031
            I +H+   LLA+  I     G V I +         + S P  +S   WHP+K  L  GW+ G++ +F+E           H   I    WSS  S+L+SAD+     L  W++D RG    +P+     + P+   L +   L   +  D+ +LAKAAVSGDE+ALD+ +W KS     +   S  E  +FF    DG V  +NE  K + I +L   V RL + E++ +L+  T+  +L+Q  +  +G+++E+ KVKL+ +T   + I W   S L  + GE++IR+WD++RE+NY+L   + +GY     L+ + YC+++  + AG+NKG++ MW ++  + +   + + +  W LQ  TEL  N  Q+  GS       S N +A    S+++ +L E+ M + F   +   Q   ++L +  +S+                     ETT        +  +  I  +  T++ + + +GK V VYEL   S       G F   + +L +H+ NIY  E +++QI   QG +KQ++     +G    +DI  +F+   TD    +I+DLSRR+ K     K+  + +P V  I SV  N NG+ VS++ ++    D ++YF++ E D++ +++F
Sbjct:   21 ISWHKHHALLAVGYISSGDGGSVDIYSEL------VRTSHPTVLS---WHPTKRTLVTGWTTGELVVFNEQDKEEYTLQTTHTAEITVLEWSSGNSRLVSADMVSANLLLLWRLDQRGRIQVSPLLTNMYHKPLTHCLFK--PLAPDE--DLAQLAKAAVSGDEKALDMFNWNKSGKWTPMKSVSQQEF-HFFLSAKDGSVYFVNEQLKNSQIVTLDSPVKRLFFMEKKSILVIVTENLLLSQFFISQEGNAEEISKVKLSGKTGQAADIHWVDNSLLITATGENVIRLWDLEREDNYVLSLDDQLGYDFAETLNCISYCSAKAILAAGTNKGRVAMWSRVTSHGQKAIRTDGKGTWKLQTPTELEENIMQIQWGS-------SKNFLAINNFSSVV-VLSEQVMSAHFSQQVAAIQVAPTQLNLTYFST---------------------ETTH------NLQTDMYIKGVFVTKDTIAVWNGKMVTVYEL---SGPTLRNTGSFSCESPVLVMHEDNIYTVETNRVQIWTLQGTVKQLLPFSEAEGNPCGLDICGHFLAVATDTAHFKIFDLSRREAKAHINCKNLSQMVPGVGSIVSVKCNVNGSKVSILSDRN--LDSRMYFYDAELDTVTFYDF 605          
BLAST of Intraflagellar transport protein 140 vs. Ensembl Xenopus
Match: ift140 (intraflagellar transport 140 [Source:NCBI gene;Acc:100144437])

HSP 1 Score: 798.119 bits (2060), Expect = 0.000e+0
Identity = 394/836 (47.13%), Postives = 580/836 (69.38%), Query Frame = 1
Query: 2257 SLSPTVTNEH--EDSLLLAKDVSSSLPVSHFWDKIDHRLIVVEIRSFDDKELNFNFTNISSIGEKVK--KNNRVLVSLFATQDDGILMFDNIICDEEYERLIGFDAPYYFFAIRN---DIAYKKQAKDGLTCSFITPRVMRDFVGLEDSDGINKQALLNFSYYLTIGNMDEAFKSMKLIKSELVWRNMARMCVKTRRLDVATVCLGKMNYACAAMQLREARQNLPELDAKVAMLALHLDMKEEAIKLLEKSQRYDILNELYQAMEEWNKALDVAEKHDRIHLKTTYYNYAKYLEEEKRYSEALENFVKSGTHAFEVPRMLFNQPDELEKFIRERPEKALRKWWAQYMECCGEMKAALEFYAAAQDNFSLVRAYWLLGMEKKATEVCNDTGDRAACYHLARQFEATNNVDQAIHYYSRAKAYNSAIRLCKENKKDDHLVNLALLCKPEEQVEAASYLQTRNGYQDKAVILFHKAGQVSRAIDLACKTKQFGALQHISNDLSDKVHPDLLQKCASFFMENNQFDRAVDMLASSKQLWEALKLCVDYNVPMTEELAEKLSPPRLNENIEHTQTSISRINSSPHEYTEAERLRLLEGIAEIALSQRQYHLACKKFTQAGNQMMAMKSLLKSGDTEKIIRFANISKTKEVYVLAANYLQNLDWRRDPDIMKNIITFYTKGKALERLATFYEACSQSEIEEYQNYSKAIGALGEAYKYWSKMKFESENQKNVKLDSIRNKCTLMKKFLATIEMFETSPDEAIHQCQLLLDEPNIDVAIRYGDIYSHMIQYFIHQSKFKAAYACLDEMKRRIRNPSI-VTAYIDVATLEFLHKSLGIPFRQPS 4740
            S+S    +EH  E+ +LL +     +P++HFWD+ + RL+V E      K  N +  + S    ++   K + +++SLF+TQ+ G+L+ ++       + L+G + P+Y+F  +    + A + + +       +  R +RDF+GLE+ D   ++A+LNFS+YLT+G+MDEAFKS+KLIKSE VW NMARMCVKT+RLDVA VCLG M +A  A  LREA Q  PE++A+VAMLA+ L M EEA +L +   RYD+LN+LYQA  +W KA++ AE HDRIHL++TYYNYAK+LE    ++E+L  + KS TH FEVPRML + P  LE++I +  +K L KWWAQY+E    + AAL++Y  AQD  SLVR +  LG  ++A E+ N+TG+ AA YHLAR +E+   V QA+H+Y+RA+AYN+ IRLCKEN  DD L+NLALL  PE+ +EAA Y + +    D+AV+L+HKAG  S+A++LA  T+QFGALQ I+ DL +K  P LL +C+ FFM+++QF++AV++L ++K+ +EAL+LC++ N+ +TEE+AEK++                 ++ +  ++++  R  LL+ IA+  + Q  YHLA KK+TQAG+++ AMKSLLKSGDTEKI+ FA +S+ KE+Y++AANYLQ+LDWR+DP+IMKNII+FYTKG+ALE LA FY+AC+Q EI+EYQ+Y KA+GA  EAYK  SK K  S  ++  +L  ++ K TL+K+F+     +     EA+ QC+LLL+EP++D AIR GD+Y  +++++  Q  F+ AY CL+EM+ ++  PS+ +T Y+   T+E +H++L IPF + S
Sbjct:  625 SISNNDPDEHDAENRVLLDR-----IPINHFWDQSEPRLVVCEAMLAVPKSANTSPKHQSDQQTEIHQGKEDILVISLFSTQEHGLLIQESFPRPAALQSLLGIEVPHYYFTKKRGEEEKASETEVQAPQIPQMVAKRPLRDFIGLEECDKTTREAMLNFSFYLTVGDMDEAFKSIKLIKSEAVWENMARMCVKTKRLDVAKVCLGNMGHARGAKALREAEQE-PEVEARVAMLAIQLGMLEEAEQLYKSCLRYDLLNKLYQAWNQWQKAIETAENHDRIHLRSTYYNYAKHLEAIGEHNESLLLYEKSDTHRFEVPRMLLDDPQALEEYINKNKDKGLWKWWAQYLESQSNLDAALKYYEMAQDYLSLVRVHCFLGNIQRAAEIANETGNGAASYHLARHYESQEEVKQAVHFYTRAQAYNNGIRLCKENNMDDQLMNLALLSSPEDMMEAARYYEEKGEQMDRAVMLYHKAGHFSKALELAFTTEQFGALQLIAEDLDEKSDPALLARCSDFFMQHSQFEKAVELLLAAKKYYEALQLCMEQNLVITEEMAEKMT-----------------VSKNSKDFSDEARRELLQRIADCCMRQGNYHLATKKYTQAGDKLKAMKSLLKSGDTEKIVFFAGVSRQKEIYIMAANYLQSLDWRKDPEIMKNIISFYTKGRALELLAGFYDACAQVEIDEYQSYEKALGAFTEAYKCLSKAKMRSPEEQERRLSDMQAKMTLVKRFIQARRAYSVDSQEAVKQCELLLEEPDLDSAIRIGDVYGLLVEHYTQQGDFQKAYQCLEEMRSKM--PSVNLTYYVPQGTIEAVHRALSIPFNRHS 1435          

HSP 2 Score: 319.701 bits (818), Expect = 2.483e-88
Identity = 193/647 (29.83%), Postives = 329/647 (50.85%), Query Frame = 1
Query:  130 IKFHQKLELLAISVIRESSHGHVIIANNKGEIFNSCKISKPQPISAILWHPSKAQLAVGWSDGQISLFDETQNVSNESLHLHCLPIASFAWSSHGSKLMSADIEGHLYAWKIDARGSFSQNPIFNFSANCPINCILLRMPKLKGSDVYDIRELAKAAVSGDERALDLMSWTKSSSGIKLTGYSYMEVSNFFAGLGDGRVILINEDGKTTNITSLSGSVVRLLYHEERDVLIATTDIGMLTQHQLLSDGSSKEVMKVKLASRTPNPSLI-WAGPSTLAISLGESMIRMWDIDREENYMLQPSEDMGYTKMGLLSVVDYCASQRTIVAGSNKGQIVMW-KMMGNEESYSKENPENRWCLQPATELHVN-GQVSAGSIEKLVASSTNVIAAGTSSNIMYILEEKPMISAFYNGIVITQKGASELFIQLYSSCKESNDNKMFTNEPVLDEQYQETTEKKMECFTIAVEHLITLMDCTRENLIISDGKTVFVYELKLRSSDLASLCGQFESPTFILKIHQQNIYVSEKSQLQIRNFQGIIKQVVDLGNMDGKLSHIDINNNFMVCTTDKCCLRIYDLSRRDPKPIGIIKDFGECIPAVTMIASVSINCNGTVVSLIVEKQ-KETDPKLYFWNIETDSIQYFNFSTGLGEQDD 2058
            I +H+   LLA+  I     G V I +  G+     +I +    + + WHP+K  L  GW+ G++ +F+E           H   I    WSS  S+L+SAD+ G +  W++D RG    +P+     + P+   L + P        D+ +LAKAAVSGDE+ALD+ +W KS     +   S  E  +FF    DG V  +NE  K + I +L   V RL + E++ +L+  T+  +L+Q  +  +G+++E+ KVKL+ +T   + I W   S L  + GE++IR+WD++RE+NY+L   + +GY     L+ + YC+++  + AG+NKG++ MW ++  + +   + + +  W LQ  TEL  N  Q+  G       SS N +A    S+++ +L E+ M + F   +   Q   ++L +  +S+                     ETT        +  +  I  +  T++ + + +GK V VYEL   S       G F   + +L +H+ NIY  E +++QI   QG +KQ++     +G    +DI  +F+   TD    +I+DLSRR+ K     K+  + +P V  I SV  N NG+ VS++  +  +  D ++YF++ E D++ +++F +G  EQ D
Sbjct:   21 ISWHKHHALLAVGYISSGDGGSVDIYSELGDHVQDAQIKRTSHPTVLSWHPTKRTLVTGWTTGELVVFNEQDKEEYTLQTTHTAEITVLEWSSGNSRLVSADMSGTVAVWRLDQRGRIQVSPLLTNMYHKPLTHCLFK-PLAPDE---DLAQLAKAAVSGDEKALDMFNWNKSGKWTPMKSVSQQEF-HFFLSAKDGSVYFVNEQLKNSQIVTLDSPVKRLFFMEKKSILVIVTENLLLSQFFISQEGNAEEISKVKLSGKTGQAADIHWVDNSLLITATGENVIRLWDLEREDNYVLSLDDQLGYDFAETLNCISYCSAKAILAAGTNKGRVAMWSRVTSHGQKAIRTDGKGTWKLQTPTELEENIMQIQWG-------SSKNFLAINNFSSVV-VLSEQVMSAHFSQQVAAIQVAPTQLNLTYFST---------------------ETTH------NLQTDMYIKGVFVTKDTIAVWNGKMVTVYEL---SGPTLRNTGSFSCESPVLVMHEDNIYTVETNRVQIWTLQGTVKQLLPFSEAEGNPCGLDICGHFLAVATDTAHFKIFDLSRREAKAHINCKNLSQMVPGVGSIVSVKCNVNGSKVSILANRSDRNLDSRMYFYDAELDTVTFYDFWSGQAEQGD 624          
BLAST of Intraflagellar transport protein 140 vs. Ensembl Xenopus
Match: ift140 (intraflagellar transport 140 [Source:NCBI gene;Acc:100144437])

HSP 1 Score: 795.423 bits (2053), Expect = 0.000e+0
Identity = 390/822 (47.45%), Postives = 572/822 (69.59%), Query Frame = 1
Query: 2326 LPVSHFWDKIDHRLIVVEIRSFD-DKELNFNFTNISSIGEKVKKNNRVLVSLFATQDDGILMFDNIICDEEYERLIGFDAPYYFFAIRN---DIAYKKQAKDGLTCSFITPRVMRDFVGLEDSDGINKQALLNFSYYLTIGNMDEAFKSMKLIKSELVWRNMARMCVKTRRLDVATVCLGKMNYACAAMQLREARQNLPELDAKVAMLALHLDMKEEAIKLLEKSQRYDILNELYQAMEEWNKALDVAEKHDRIHLKTTYYNYAKYLEEEKRYSEALENFVKSGTHAFEVPRMLFNQPDELEKFIRERPEKALRKWWAQYMECCGEMKAALEFYAAAQDNFSLVRAYWLLGMEKKATEVCNDTGDRAACYHLARQFEATNNVDQAIHYYSRAKAYNSAIRLCKENKKDDHLVNLALLCKPEEQVEAASYLQTRNGYQDKAVILFHKAGQVSRAIDLACKTKQFGALQHISNDLSDKVHPDLLQKCASFFMENNQFDRAVDMLASSKQLWEALKLCVDYNVPMTEELAEKLSPPRLNENIEHTQTSISRINSSPHEYTEAERLRLLEGIAEIALSQRQYHLACKKFTQAGNQMMAMKSLLKSGDTEKIIRFANISKTKEVYVLAANYLQNLDWRRDPDIMKNIITFYTKGKALERLATFYEACSQSEIEEYQNYSKAIGALGEAYKYWSKMKFESENQKNVKLDSIRNKCTLMKKFLATIEMFETSPDEAIHQCQLLLDEPNIDVAIRYGDIYSHMIQYFIHQSKFKAAYACLDEMKRRIRNPSI-VTAYIDVATLEFLHKSLGIPFRQPS---QIETEKKQF 4767
            +P++HFWD+ + RL+V E   F+         +N S I   + + + +++SLF+TQ+ G+L+ ++       + L+G + P+Y+F  +    + A + + +       +  R +RDF+GLE+ D   ++A+LNFS+YLT+G+MDEAFKS+KLIKSE VW NMARMCVKT+RLDVA VCLG M +A  A  LREA Q  PE++A+VAMLA+ L M EEA +L +   RYD+LN+LYQA  +W KA++ AE HDRIHL++TYYNYAK+LE    ++E+L  + KS TH FEVPRML + P  LE++I +  +K L KWWAQY+E    + AAL++Y  AQD  SLVR +  LG  ++A E+ N+TG+ AA YHLAR +E+   V QA+H+Y+RA+AYN+ IRLCKEN  DD L+NLALL  PE+ +EAA Y + +    D+AV+L+HKAG  S+A++LA  T+QFGALQ I+ DL +K  P LL +C+ FFM+++QF++AV++L ++K+ +EAL+LC++ N+ +TEE+AEK++                 ++ +  ++++  R  LL+ IA+  + Q  YHLA KK+TQAG+++ AMKSLLKSGDTEKI+ FA +S+ KE+Y++AANYLQ+LDWR+DP+IMKNII+FYTKG+ALE LA FY+AC+Q EI+EYQ+Y KA+GA  EAYK  SK K  S  ++  +L  ++ K TL+K+F+     +     EA+ QC+LLL+EP++D AIR GD+Y  +++++  Q  F+ AY CL+EM+ ++  PS+ +T Y+   T+E +H++L IPF + S    + TE   F
Sbjct:  591 IPINHFWDQSEPRLVVCEAMLFNVSVHQACALSNCSLI--ILLQEDILVISLFSTQEHGLLIQESFPRPAALQSLLGIEVPHYYFTKKRGEEEKASETEVQAPQIPQMVAKRPLRDFIGLEECDKTTREAMLNFSFYLTVGDMDEAFKSIKLIKSEAVWENMARMCVKTKRLDVAKVCLGNMGHARGAKALREAEQE-PEVEARVAMLAIQLGMLEEAEQLYKSCLRYDLLNKLYQAWNQWQKAIETAENHDRIHLRSTYYNYAKHLEAIGEHNESLLLYEKSDTHRFEVPRMLLDDPQALEEYINKNKDKGLWKWWAQYLESQSNLDAALKYYEMAQDYLSLVRVHCFLGNIQRAAEIANETGNGAASYHLARHYESQEEVKQAVHFYTRAQAYNNGIRLCKENNMDDQLMNLALLSSPEDMMEAARYYEEKGEQMDRAVMLYHKAGHFSKALELAFTTEQFGALQLIAEDLDEKSDPALLARCSDFFMQHSQFEKAVELLLAAKKYYEALQLCMEQNLVITEEMAEKMT-----------------VSKNSKDFSDEARRELLQRIADCCMRQGNYHLATKKYTQAGDKLKAMKSLLKSGDTEKIVFFAGVSRQKEIYIMAANYLQSLDWRKDPEIMKNIISFYTKGRALELLAGFYDACAQVEIDEYQSYEKALGAFTEAYKCLSKAKMRSPEEQERRLSDMQAKMTLVKRFIQARRAYSVDSQEAVKQCELLLEEPDLDSAIRIGDVYGLLVEHYTQQGDFQKAYQCLEEMRSKM--PSVNLTYYVPQGTIEAVHRALSIPFNRHSLSEHMSTESNGF 1390          

HSP 2 Score: 262.692 bits (670), Expect = 2.483e-70
Identity = 182/635 (28.66%), Postives = 307/635 (48.35%), Query Frame = 1
Query:   76 MAIYLTKQLN--LDDVQILDIKFHQKLELLAISVIRESSHGHVIIANNKGEIFNSCKISKPQPISAILWHPSKAQLAVGWSDGQISLFDETQNVSNESLHLHCLPIASFAWSSHGSKLMSADIEGHLYAWKIDARGSFSQNPIFNFSANCPINCILLRMPKLKGSDVYDIRELAKAAVSGDERALDLMSWTKSSSGIKLTGYSYMEVSNFFAGL-GDGRVILINEDGKTTNITSLSGSVVRLLYHEERDVLIATTDIGMLTQHQLLSDGSSKEVMKVKLASRTPNPSLI-WAGPSTLAISLGESMIRMWDIDREENYMLQPSEDMGYTKMGLLSVVDYCASQRTIVAGSNKGQIVMW-KMMGNEESYSKENPENRWCLQPATELHVN-GQVSAGSIEKLVASSTNVIAAGTSSNIMYILEEKPMISAFYNGIVITQKGASELFIQLYSSCKESNDNKMFTNEPVLDEQYQETTEKKMECFTIAVEHLITLMDCTRENLIISDGKTVFVYELKLRSSDLASLCGQFESPTFILKIHQQNIYVSEKSQLQIRNFQGIIKQVVDLGNMDGKLSHIDINNNFMVCTTDKCCLRIYDLSRRDPKPIGIIKDFGECIPAVTMIASVSINCNGTVVSLIVEK 1962
            MA+Y   ++           I +H+   LLA+  I     G V I +         + S P  +S   WHP+K  L  GW+ G++ +F+E           H   I    WSS  S+L+SAD+ G +  W++D RG    +P+     + P+  + L   KL    +Y I         GDE+ALD+ +W KS    K T    ++ +N F  L   G V  +NE  K + I +L   V RL + E++ +L+  T+  +L+Q  +  +G+++E+ KVKL+ +T   + I W   S L  + GE++IR+WD++RE+NY+L   + +GY     L+ + YC+++  + AG+NKG++ MW ++  + +   + + +  W LQ  TEL  N  Q+  GS       S N +A    S+++ +L E+ M + F   +   Q   ++L +  +S+                     ETT        +  +  I  +  T++ + + +GK V VYEL   S       G F   + +L +H+ NIY  E +++QI   QG +KQ++     +G    +DI  +F+   TD    +I+DLSRR+ K     K+  + +P V  I SV  N NG+ VS++  +
Sbjct:    1 MAVYFDHRIQAPFPSASPSHISWHKHHALLAVGYISSGDGGSVDIYSEL------VRTSHPTVLS---WHPTKRTLVTGWTTGELVVFNEQDKEEYTLQTTHTAEITVLEWSSGNSRLVSADMSGTVAVWRLDQRGRIQVSPLLTNMYHKPLTHLTLF--KLH---IYPI-----IINYGDEKALDMFNWNKSG---KWTPMKSVQFTNGFHWLLVTGSVYFVNEQLKNSQIVTLDSPVKRLFFMEKKSILVIVTENLLLSQFFISQEGNAEEISKVKLSGKTGQAADIHWVDNSLLITATGENVIRLWDLEREDNYVLSLDDQLGYDFAETLNCISYCSAKAILAAGTNKGRVAMWSRVTSHGQKAIRTDGKGTWKLQTPTELEENIMQIQWGS-------SKNFLAINNFSSVV-VLSEQVMSAHFSQQVAAIQVAPTQLNLTYFST---------------------ETTH------NLQTDMYIKGVFVTKDTIAVWNGKMVTVYEL---SGPTLRNTGSFSCESPVLVMHEDNIYTVETNRVQIWTLQGTVKQLLPFSEAEGNPCGLDICGHFLAVATDTAHFKIFDLSRREAKAHINCKNLSQMVPGVGSIVSVKCNVNGSKVSILANR 575          
BLAST of Intraflagellar transport protein 140 vs. Ensembl Xenopus
Match: ift140 (intraflagellar transport 140 [Source:NCBI gene;Acc:100144437])

HSP 1 Score: 766.148 bits (1977), Expect = 0.000e+0
Identity = 379/804 (47.14%), Postives = 550/804 (68.41%), Query Frame = 1
Query: 2269 TVTNEHEDSLLLAKDVSSSLPVSHFWDKIDHRLIVVEIRSFDDKELNFNFTNISSIGEKVKKNNRVLV-SLFATQDDGILMFDNIICDEEYERLIGFDAPYYFFAIRNDIAYKKQAKDGLTCSFITPRVMRDFVGLEDSDGINKQALLNFSYYLTIGNMDEAFKSMKLIKSELVWRNMARMCVKTRRLDVATVCLGKMNYACAAMQLREARQNLPELDAKVAMLALHLDMKEEAIKLLEKSQRYDILNELYQAMEEWNKALDVAEKHDRIHLKTTYYNYAKYLEEEKRYSEALENFVKSGTHAFEVPRMLFNQPDELEKFIRERPEKALRKWWAQYMECCGEMKAALEFYAAAQDNFSLVRAYWLLGMEKKATEVCNDTGDRAACYHLARQFEATNNVDQAIHYYSRAKAYNSAIRLCKENKKDDHLVNLALLCKPEEQVEAASYLQTRNGYQDKAVILFHKAGQVSRAIDLACKTKQFGALQHISNDLSDKVHPDLLQKCASFFMENNQFDRAVDMLASSKQLWEALKLCVDYNVPMTEELAEKLSPPRLNENIEHTQTSISRINSSPHEYTEAERLRLLEGIAEIALSQRQYHLACKKFTQAGNQMMAMKSLLKSGDTEKIIRFANISKTKEVYVLAANYLQNLDWRRDPDIMKNIITFYTKGKALERLATFYEACSQSEIEEYQNYSKAIGALGEAYKYWSKMKFESENQKNVKLDSIRNKCTLMKKFLATIEMFETSPDEAIHQCQLLLDEPNIDVAIRYGDIYSHMIQYFIHQSKFKAAYACLDEMKRRIRNPSIVTAY 4677
            +++N   D +LL +     +P++HFWD+ + RL+V E      K  N +  + S    ++ +   +LV SLF+TQ+ G+L+ ++       + L+G + P+Y+F  +     K QA        +  R +RDF+GLE+ D   ++A+LNFS+YLT+G+MDEAFKS+KLIKSE VW NMARMCVKT+RLDVA VCLG M +A  A  LREA Q  PE++A+VAMLA+ L M EEA +L +   RYD+LN+LYQA  +W KA++ AE HDRIHL++TYYNYAK+LE    ++E+L  + KS TH FEVPRML + P  LE++I +  +K L KWWAQY+E    + AAL++Y  AQD  SLVR +  LG  ++A E+ N+TG+ AA YHLAR +E+   V QA+H+Y+RA+AYN+ IRLCKEN  DD L+NLALL  PE+ +EAA Y + +    D+AV+L+HKAG  S+A++LA  T+QFGALQ I+ DL +K  P LL +C+ FFM+++QF++AV++L ++K+ +EAL+LC++ N+ +TEE+AEK++                 ++ +  ++++  R  LL+ IA+  + Q  YHLA KK+TQAG+++ AMKSLLKSGDTEKI+ FA +S+ KE+Y++AANYLQ+LDWR+DP+IMKNII+FYTKG+ALE LA FY+AC+Q EI+EYQ+Y KA+GA  EAYK  SK K  S  ++  +L  ++ K TL+K+F+     +     EA+ QC+LLL+EP++D AIR GD+Y  +++++  Q  F+           ++R P  +  Y
Sbjct:  622 SISNNDPDEVLLDR-----IPINHFWDQSEPRLVVCEAMLAVPKSANTSPKHQSDQQTEIHQGKDILVISLFSTQEHGLLIQESFPRPAALQSLLGIEVPHYYFTKK----VKVQAPQ--IPQMVAKRPLRDFIGLEECDKTTREAMLNFSFYLTVGDMDEAFKSIKLIKSEAVWENMARMCVKTKRLDVAKVCLGNMGHARGAKALREAEQE-PEVEARVAMLAIQLGMLEEAEQLYKSCLRYDLLNKLYQAWNQWQKAIETAENHDRIHLRSTYYNYAKHLEAIGEHNESLLLYEKSDTHRFEVPRMLLDDPQALEEYINKNKDKGLWKWWAQYLESQSNLDAALKYYEMAQDYLSLVRVHCFLGNIQRAAEIANETGNGAASYHLARHYESQEEVKQAVHFYTRAQAYNNGIRLCKENNMDDQLMNLALLSSPEDMMEAARYYEEKGEQMDRAVMLYHKAGHFSKALELAFTTEQFGALQLIAEDLDEKSDPALLARCSDFFMQHSQFEKAVELLLAAKKYYEALQLCMEQNLVITEEMAEKMT-----------------VSKNSKDFSDEARRELLQRIADCCMRQGNYHLATKKYTQAGDKLKAMKSLLKSGDTEKIVFFAGVSRQKEIYIMAANYLQSLDWRKDPEIMKNIISFYTKGRALELLAGFYDACAQVEIDEYQSYEKALGAFTEAYKCLSKAKMRSPEEQERRLSDMQAKMTLVKRFIQARRAYSVDSQEAVKQCELLLEEPDLDSAIRIGDVYGLLVEHYTQQGDFQ-----------KVRRPLCLPVY 1385          

HSP 2 Score: 318.161 bits (814), Expect = 4.790e-88
Identity = 193/646 (29.88%), Postives = 330/646 (51.08%), Query Frame = 1
Query:  130 IKFHQKLELLAISVIRESSHGHVIIANNKGEIFNSCKISKPQPISAILWHPSKAQLAVGWSDGQISLFDETQNVSNESLHLHCLPIASFAWSSHGSKLMSADIEGHLYAWKIDARGSFSQNPIFNFSANCPINCILLRMPKLKGSDVYDIRELAKAAVSGDERALDLMSWTKSSSGIKLTGYSYMEVSNFFAGLGDGRVILINEDGKTTNITSLSGSVVRLLYHEERDVLIATTDIGMLTQHQLLSDGSSKEVMKVKLASRTPNPSLI-WAGPSTLAISLGESMIRMWDIDREENYMLQPSEDMGYTKMGLLSVVDYCASQRTIVAGSNKGQIVMW-KMMGNEESYSKENPENRWCLQPATELHVN-GQVSAGSIEKLVASSTNVIAAGTSSNIMYILEEKPMISAFYNGIVITQKGASELFIQLYSSCKESNDNKMFTNEPVLDEQYQETTEKKMECFTIAVEHLITLMDCTRENLIISDGKTVFVYELKLRSSDLASLCGQFESPTFILKIHQQNIYVSEKSQLQIRNFQGIIKQVVDLGNMDGKLSHIDINNNFMVCTTDKCCLRIYDLSRRDPKPIGIIKDFGECIPAVTMIASVSINCNGTVVSLIVEKQKETDPKLYFWNIETDSIQYFNFSTGLGEQDD 2058
            I +H+   LLA+  I     G V I +  G+     +I +    + + WHP+K  L  GW+ G++ +F+E           H   I    WSS  S+L+SAD+ G +  W++D RG    +P+     + P+   L +   L   +  D+ +LAKAAVSGDE+ALD+ +W KS     +   S  E  +FF    DG V  +NE  K + I +L   V RL + E++ +L+  T+  +L+Q  +  +G+++E+ KVKL+ +T   + I W   S L  + GE++IR+WD++RE+NY+L   + +GY     L+ + YC+++  + AG+NKG++ MW ++  + +   + + +  W LQ  TEL  N  Q+  GS       S N +A    S+++ +L E+ M + F   +   Q   ++L +  +S+                     ETT        +  +  I  +  T++ + + +GK V VYEL   S       G F   + +L +H+ NIY  E +++QI   QG +KQ++     +G    +DI  +F+   TD    +I+DLSRR+ K     K+  + +P V  I SV  N NG+ VS++ ++    D ++YF++ E D++ +++F +G  EQ D
Sbjct:   21 ISWHKHHALLAVGYISSGDGGSVDIYSELGDHVQDAQIKRTSHPTVLSWHPTKRTLVTGWTTGELVVFNEQDKEEYTLQTTHTAEITVLEWSSGNSRLVSADMSGTVAVWRLDQRGRIQVSPLLTNMYHKPLTHCLFK--PLAPDE--DLAQLAKAAVSGDEKALDMFNWNKSGKWTPMKSVSQQEF-HFFLSAKDGSVYFVNEQLKNSQIVTLDSPVKRLFFMEKKSILVIVTENLLLSQFFISQEGNAEEISKVKLSGKTGQAADIHWVDNSLLITATGENVIRLWDLEREDNYVLSLDDQLGYDFAETLNCISYCSAKAILAAGTNKGRVAMWSRVTSHGQKAIRTDGKGTWKLQTPTELEENIMQIQWGS-------SKNFLAINNFSSVV-VLSEQVMSAHFSQQVAAIQVAPTQLNLTYFST---------------------ETTH------NLQTDMYIKGVFVTKDTIAVWNGKMVTVYEL---SGPTLRNTGSFSCESPVLVMHEDNIYTVETNRVQIWTLQGTVKQLLPFSEAEGNPCGLDICGHFLAVATDTAHFKIFDLSRREAKAHINCKNLSQMVPGVGSIVSVKCNVNGSKVSILSDRN--LDSRMYFYDAELDTVTFYDFWSGQAEQGD 621          
BLAST of Intraflagellar transport protein 140 vs. Ensembl Xenopus
Match: ift140 (intraflagellar transport 140 [Source:NCBI gene;Acc:100144437])

HSP 1 Score: 607.446 bits (1565), Expect = 0.000e+0
Identity = 291/593 (49.07%), Postives = 425/593 (71.67%), Query Frame = 1
Query: 2965 AIKLLEKSQRYDILNELYQAMEEWNKALDVAEKHDRIHLKTTYYNYAKYLEEEKRYSEALENFVKSGTHAFEVPRMLFNQPDELEKFIRERPEKALRKWWAQYMECCGEMKAALEFYAAAQDNFSLVRAYWLLGMEKKATEVCNDTGDRAACYHLARQFEATNNVDQAIHYYSRAKAYNSAIRLCKENKKDDHLVNLALLCKPEEQVEAASYLQTRNGYQDKAVILFHKAGQVSRAIDLACKTKQFGALQHISNDLSDKVHPDLLQKCASFFMENNQFDRAVDMLASSKQLWEALKLCVDYNVPMTEELAEKLSPPRLNENIEHTQTSISRINSSPHEYTEAERLRLLEGIAEIALSQRQYHLACKKFTQAGNQMMAMKSLLKSGDTEKIIRFANISKTKEVYVLAANYLQNLDWRRDPDIMKNIITFYTKGKALERLATFYEACSQSEIEEYQNYSKAIGALGEAYKYWSKMKFESENQKNVKLDSIRNKCTLMKKFLATIEMFETSPDEAIHQCQLLLDEPNIDVAIRYGDIYSHMIQYFIHQSKFKAAYACLDEMKRRIRNPSI-VTAYIDVATLEFLHKSLGIPFRQPS 4740
            A +L +   RYD+LN+LYQA  +W KA++ AE HDRIHL++TYYNYAK+LE    ++E+L  + KS TH FEVPRML + P  LE++I +  +K L KWWAQY+E    + AAL++Y  AQD  SLVR +  LG  ++A E+ N+TG+ AA YHLAR +E+   V QA+H+Y+RA+AYN+ IRLCKEN  DD L+NLALL  PE+ +EAA Y + +    D+AV+L+HKAG  S+A++LA  T+QFGALQ I+ DL +K  P LL +C+ FFM+++QF++AV++L ++K+ +EAL+LC++ N+ +TEE+AEK++                 ++ +  ++++  R  LL+ IA+  + Q  YHLA KK+TQAG+++ AMKSLLKSGDTEKI+ FA +S+ KE+Y++AANYLQ+LDWR+DP+IMKNII+FYTKG+ALE LA FY+AC+Q EI+EYQ+Y KA+GA  EAYK  SK K  S  ++  +L  ++ K TL+K+F+     +     EA+ QC+LLL+EP++D AIR GD+Y  +++++  Q  F+ AY CL+EM+ ++  PS+ +T Y+   T+E +H++L IPF + S
Sbjct:    6 AEQLYKSCLRYDLLNKLYQAWNQWQKAIETAENHDRIHLRSTYYNYAKHLEAIGEHNESLLLYEKSDTHRFEVPRMLLDDPQALEEYINKNKDKGLWKWWAQYLESQSNLDAALKYYEMAQDYLSLVRVHCFLGNIQRAAEIANETGNGAASYHLARHYESQEEVKQAVHFYTRAQAYNNGIRLCKENNMDDQLMNLALLSSPEDMMEAARYYEEKGEQMDRAVMLYHKAGHFSKALELAFTTEQFGALQLIAEDLDEKSDPALLARCSDFFMQHSQFEKAVELLLAAKKYYEALQLCMEQNLVITEEMAEKMT-----------------VSKNSKDFSDEARRELLQRIADCCMRQGNYHLATKKYTQAGDKLKAMKSLLKSGDTEKIVFFAGVSRQKEIYIMAANYLQSLDWRKDPEIMKNIISFYTKGRALELLAGFYDACAQVEIDEYQSYEKALGAFTEAYKCLSKAKMRSPEEQERRLSDMQAKMTLVKRFIQARRAYSVDSQEAVKQCELLLEEPDLDSAIRIGDVYGLLVEHYTQQGDFQKAYQCLEEMRSKM--PSVNLTYYVPQGTIEAVHRALSIPFNRHS 579          
BLAST of Intraflagellar transport protein 140 vs. Ensembl Mouse
Match: Ift140 (intraflagellar transport 140 [Source:MGI Symbol;Acc:MGI:2146906])

HSP 1 Score: 770.385 bits (1988), Expect = 0.000e+0
Identity = 387/824 (46.97%), Postives = 555/824 (67.35%), Query Frame = 1
Query: 2299 LLAKDVSSSLPVSHFWDKIDHRLIVVEIRSFDDKELNFNFTNISSIGEKVKKNNRVLV-SLFATQDDGILMFDNIICDEEYERLIGFDAPYYFFAIRNDIAYKKQAKDG---LTCSFITPRVMRDFVGLEDSDGINKQALLNFSYYLTIGNMDEAFKSMKLIKSELVWRNMARMCVKTRRLDVATVCLGKMNYACAAMQLREARQNLPELDAKVAMLALHLDMKEEAIKLLEKSQRYDILNELYQAMEEWNKALDVAEKHDRIHLKTTYYNYAKYLEEEKRYSEALENFVKSGTHAFEVPRMLFNQPDELEKFIRERPEKALRKWWAQYMECCGEMKAALEFYAAAQDNFSLVRAYWLLGMEKKATEVCNDTGDRAACYHLARQFEATNNVDQAIHYYSRAKAYNSAIRLCKENKKDDHLVNLALLCKPEEQVEAASYLQTRNGYQDKAVILFHKAGQVSRAIDLACKTKQFGALQHISNDLSDKVHPDLLQKCASFFMENNQFDRAVDMLASSKQLWEALKLCVDYNVPMTEELAEKLSPPRLNENIEHTQTSISRINSSPHEYTEAERLRLLEGIAEIALSQRQYHLACKKFTQAGNQMMAMKSLLKSGDTEKIIRFANISKTKEVYVLAANYLQNLDWRRDPDIMKNIITFYTKGKALERLATFYEACSQSEIEEYQNYSKAIGALGEAYKYWSKMKFESENQKNVKLDSIRNKCTLMKKFLATIEMFETSPDEAIHQCQLLLDEPNIDVAIRYGDIYSHMIQYFIHQSKFKAAYACLDEMKRRIRNPSIVTAYIDVATLEFLHKSLGIPFRQPSQIETEK 4758
             + K ++   PV+HFWD+ + RL V E                  + E       VL+ S FA+++ G L+ D+      Y+ L+G + P+Y+F  +   A K+   D         +  R +RDFVGLED D   + A+LNFS+++TIG+MDEAFKS+KLIKSE VW NMARMCVKT+RLDVA VCLG M +A  A  LREA Q  PEL+A+VAMLA+ L M EEA +L +K +RYD+LN+ YQA ++W KA++VAE HDR+HL+TTYYNYAK+LE      +AL  + KS TH FEVPRML      LE +I    +K L +WWAQY+E   EM  AL +Y  AQD FSLVR +   G  +KA E+ N+TGD AA YHLARQ+E+ + V QA+H+Y+RA+A+N+AIRLCKEN  DD L+NLALL  PE+ +EAA Y + +    D+AV+L+HKAG  S+A++LA  T+QF ALQ I+ DL +K  P LL +C+ F +E+ QF++AV++L ++K+  EAL+LC++ N+ +TE++AEK++                 ++    + +E  R  LLE IA   + Q  YHLA KK+TQAGN++ AM++LLKSGDTEKI+ FA +S+ KE+Y++AANYLQ+LDWR++P+IMK+II+FYTKG+AL+ LA FY+AC+Q EI+EYQNY KA GAL EAYK  SK K ++   +  KL  +++K TL+K+F+     +   P E++ QC+LLL+EP++D  IR GD+Y  ++++ +   +++ AY  L+EM++R+ + ++ + Y+D  T++ +H+ LG+    PS+I  E+
Sbjct:  638 FMDKSLAGYTPVNHFWDQSEPRLFVCEALQEAPGAQPQAVDKQPRVEEGTCHKEEVLILSFFASEEHGFLLHDSFPRPSTYQSLLGMEVPHYYFTKKPGEADKEDRVDSGYYHIPQMVAKRPLRDFVGLEDCDKSTRDAMLNFSFFVTIGDMDEAFKSIKLIKSEAVWENMARMCVKTQRLDVAKVCLGNMGHARGARALREAEQE-PELEARVAMLAIQLGMLEEAEQLYKKCKRYDLLNKFYQASDQWQKAVEVAELHDRVHLRTTYYNYAKHLEASADCGQALSYYEKSDTHRFEVPRMLSEDLQSLELYINRMKDKTLWRWWAQYLESQAEMDTALRYYELAQDYFSLVRIHCFQGNIQKAAEIANETGDWAASYHLARQYESQDEVKQAVHFYTRAQAFNNAIRLCKENGLDDQLMNLALLSSPEDMIEAARYYEEKGEQMDRAVMLYHKAGHFSKALELAFTTQQFAALQLIAEDLDEKSDPALLARCSDFCIEHRQFEKAVELLLAAKKYHEALQLCLEQNMTITEDMAEKMT-----------------VSKDSKDMSEESRRELLEQIANCCMRQGNYHLATKKYTQAGNKLKAMRALLKSGDTEKIVFFAGVSRQKEIYIMAANYLQSLDWRKEPEIMKSIISFYTKGRALDLLAGFYDACAQVEIDEYQNYDKAHGALTEAYKCLSKAKTKNPLDQETKLAQLQSKMTLVKRFIQARRTYTEDPKESLRQCELLLEEPDLDSTIRVGDVYGFLVEHHVQMEEYQMAYKYLEEMRKRLPSANM-SYYVDQRTVDTVHQGLGL--LPPSRIMPER 1440          

HSP 2 Score: 314.309 bits (804), Expect = 9.910e-87
Identity = 198/660 (30.00%), Postives = 330/660 (50.00%), Query Frame = 1
Query:   76 MAIYLTKQLNLDDV--QILDIKFHQKLELLAISVIRESSHGHVIIANNKGEIFNSCKISKPQPISAILWHPSKAQLAVGWSDGQISLFDETQNVSNESLHLHCLPIASFAWSSHGSKLMSADIEGHLYAWKIDARGSFSQNPIFNFSANCPINCILLRMPKLKGSDVYDIRELAKAAVSGDERALDLMSWTKSSSGIKLTGYSYMEVSNFFAGLGDGRVILINEDGKTTNITSLSGSVVRLLYHEERDVLIATTDIGMLTQHQLLSDGSSKEVMKVKLASRTP-NPSLIWAGPSTLAISLGESMIRMWDIDREENYMLQPSEDMGYTKMGLLSVVDYCASQRTIVAGSNKGQIVMWKMMGNEESYSKENPENRWCLQPATELHVN-GQVSAGSIEKLVASSTNVIAAGTSSNIMYILEEKPMISAFYNGIVITQKGASELFIQLYSSCKESNDNKMFTNEPVLDEQYQETTEKKMECFTIAVEHLITLMDCTRENLIISDGKTVFVYELKLRSSDLASLCGQFESPTFILKIHQQNIYVSEKSQLQIRNFQGIIKQVVDLGNMDGKLSHIDINNNFMVCTTDKCCLRIYDLSRRDPKPIGIIKDFGECIPAVTMIASVSINCNGTVVSLIVEK-QKETDPKLYFWNIETDSIQYFNFSTG 2040
            MA+Y   ++   D       I +H     LA++ I  SS G+V I   +GE      I +    +++ WHP++  LA+GW  G++ +F++     +     H   IA  +WS+ GS L+S D  G L  W++D RG     P+        +   + R+P   G D+    +LAKAAVSGDE+ALD+ +W KSS G  L   S  E  +FF  L DG V  ++E GKT  + S   S+  L Y E R+ L+  T+  +L+ + +  +G ++EVMKVKL+ +T     +     S L  ++GE ++R WD++R ENY+L   E  G+ K   ++ V +C ++  + AG+NKG++ MWK + +  +      ++ W LQ  TEL  N  Q+  GS + L+A S        S+  + IL E+ M S F+  +   Q   S + +   S+                               ++  +  I+ +  T++ + + +GK V ++E    S       G F   T +L +H+++IY  E ++LQ+R +QG +KQ++     +G    +D+   F+V  TD    + +DLSRR+ K     K+  + +P V  I S+  N NG  +S+++ K     D K+Y +++E D++  FNF+TG
Sbjct:    1 MALYFDHRIKAPDTPSSPSHITWHPTHPFLAVASISPSSGGNVDIYLEQGEPVPDTHIERSFQATSLCWHPTRLILAIGWETGEVIMFNKQDKEQHTVPLPHTTDIAILSWSTSGSCLVSGDKLGVLLLWRLDQRGRVQGTPLLKHEYGKALTHCIFRLPP-PGEDLV---QLAKAAVSGDEKALDMFNWRKSSFGSFLKTGS-QEGLSFFVSLMDGTVHYVDEKGKTAQVASTDSSIQTLFYIERREALVVVTENLLLSLYVVTPEGEAEEVMKVKLSGKTGCRADITLIEGSLLVTAIGEPVLRFWDLERGENYILSLQEKFGFEKGESINCVCFCKAKGLLAAGTNKGRVAMWKKVPSFPNGRGAEGKDMWALQTPTELEGNITQIKWGSRKNLLAVS--------STESVSILSEQAMSSHFHQQVAAVQISPSLVNVSFLSTGG---------------------------THSLHTDMHISGVFATKDAVAVWNGKQVAIFE---PSGSTLRNAGTFLCETSVLAMHEESIYTVEPNRLQVRTWQGTVKQLLLFSETEGSPCFLDVCGTFLVAGTDLAHFKSFDLSRREAKVHCSCKNLAQLVPDVGSITSLRCNANGNKISILLSKVNNSPDSKIYIYDVEMDTVNVFNFTTG 617          
BLAST of Intraflagellar transport protein 140 vs. Ensembl Mouse
Match: Ift140 (intraflagellar transport 140 [Source:MGI Symbol;Acc:MGI:2146906])

HSP 1 Score: 743.806 bits (1919), Expect = 0.000e+0
Identity = 371/775 (47.87%), Postives = 523/775 (67.48%), Query Frame = 1
Query: 2299 LLAKDVSSSLPVSHFWDKIDHRLIVVEIRSFDDKELNFNFTNISSIGEKVKKNNRVLV-SLFATQDDGILMFDNIICDEEYERLIGFDAPYYFFAIRNDIAYKKQAKDG---LTCSFITPRVMRDFVGLEDSDGINKQALLNFSYYLTIGNMDEAFKSMKLIKSELVWRNMARMCVKTRRLDVATVCLGKMNYACAAMQLREARQNLPELDAKVAMLALHLDMKEEAIKLLEKSQRYDILNELYQAMEEWNKALDVAEKHDRIHLKTTYYNYAKYLEEEKRYSEALENFVKSGTHAFEVPRMLFNQPDELEKFIRERPEKALRKWWAQYMECCGEMKAALEFYAAAQDNFSLVRAYWLLGMEKKATEVCNDTGDRAACYHLARQFEATNNVDQAIHYYSRAKAYNSAIRLCKENKKDDHLVNLALLCKPEEQVEAASYLQTRNGYQDKAVILFHKAGQVSRAIDLACKTKQFGALQHISNDLSDKVHPDLLQKCASFFMENNQFDRAVDMLASSKQLWEALKLCVDYNVPMTEELAEKLSPPRLNENIEHTQTSISRINSSPHEYTEAERLRLLEGIAEIALSQRQYHLACKKFTQAGNQMMAMKSLLKSGDTEKIIRFANISKTKEVYVLAANYLQNLDWRRDPDIMKNIITFYTKGKALERLATFYEACSQSEIEEYQNYSKAIGALGEAYKYWSKMKFESENQKNVKLDSIRNKCTLMKKFLATIEMFETSPDEAIHQCQLLLDEPNIDVAIRYGDIYSHMIQYFIHQSKFK 4611
             + K ++   PV+HFWD+ + RL V E                  + E       VL+ S FA+++ G L+ D+      Y+ L+G + P+Y+F  +   A K+   D         +  R +RDFVGLED D   + A+LNFS+++TIG+MDEAFKS+KLIKSE VW NMARMCVKT+RLDVA VCLG M +A  A  LREA Q  PEL+A+VAMLA+ L M EEA +L +K +RYD+LN+ YQA ++W KA++VAE HDR+HL+TTYYNYAK+LE      +AL  + KS TH FEVPRML      LE +I    +K L +WWAQY+E   EM  AL +Y  AQD FSLVR +   G  +KA E+ N+TGD AA YHLARQ+E+ + V QA+H+Y+RA+A+N+AIRLCKEN  DD L+NLALL  PE+ +EAA Y + +    D+AV+L+HKAG  S+A++LA  T+QF ALQ I+ DL +K  P LL +C+ F +E+ QF++AV++L ++K+  EAL+LC++ N+ +TE++AEK++                 ++    + +E  R  LLE IA   + Q  YHLA KK+TQAGN++ AM++LLKSGDTEKI+ FA +S+ KE+Y++AANYLQ+LDWR++P+IMK+II+FYTKG+AL+ LA FY+AC+Q EI+EYQNY KA GAL EAYK  SK K ++   +  KL  +++K TL+K+F+     +   P E++ QC+LLL+EP++D  IR GD+Y  ++++ +   +++
Sbjct:  638 FMDKSLAGYTPVNHFWDQSEPRLFVCEALQEAPGAQPQAVDKQPRVEEGTCHKEEVLILSFFASEEHGFLLHDSFPRPSTYQSLLGMEVPHYYFTKKPGEADKEDRVDSGYYHIPQMVAKRPLRDFVGLEDCDKSTRDAMLNFSFFVTIGDMDEAFKSIKLIKSEAVWENMARMCVKTQRLDVAKVCLGNMGHARGARALREAEQE-PELEARVAMLAIQLGMLEEAEQLYKKCKRYDLLNKFYQASDQWQKAVEVAELHDRVHLRTTYYNYAKHLEASADCGQALSYYEKSDTHRFEVPRMLSEDLQSLELYINRMKDKTLWRWWAQYLESQAEMDTALRYYELAQDYFSLVRIHCFQGNIQKAAEIANETGDWAASYHLARQYESQDEVKQAVHFYTRAQAFNNAIRLCKENGLDDQLMNLALLSSPEDMIEAARYYEEKGEQMDRAVMLYHKAGHFSKALELAFTTQQFAALQLIAEDLDEKSDPALLARCSDFCIEHRQFEKAVELLLAAKKYHEALQLCLEQNMTITEDMAEKMT-----------------VSKDSKDMSEESRRELLEQIANCCMRQGNYHLATKKYTQAGNKLKAMRALLKSGDTEKIVFFAGVSRQKEIYIMAANYLQSLDWRKEPEIMKSIISFYTKGRALDLLAGFYDACAQVEIDEYQNYDKAHGALTEAYKCLSKAKTKNPLDQETKLAQLQSKMTLVKRFIQARRTYTEDPKESLRQCELLLEEPDLDSTIRVGDVYGFLVEHHVQMEEYQ 1394          

HSP 2 Score: 313.923 bits (803), Expect = 1.169e-86
Identity = 198/660 (30.00%), Postives = 330/660 (50.00%), Query Frame = 1
Query:   76 MAIYLTKQLNLDDV--QILDIKFHQKLELLAISVIRESSHGHVIIANNKGEIFNSCKISKPQPISAILWHPSKAQLAVGWSDGQISLFDETQNVSNESLHLHCLPIASFAWSSHGSKLMSADIEGHLYAWKIDARGSFSQNPIFNFSANCPINCILLRMPKLKGSDVYDIRELAKAAVSGDERALDLMSWTKSSSGIKLTGYSYMEVSNFFAGLGDGRVILINEDGKTTNITSLSGSVVRLLYHEERDVLIATTDIGMLTQHQLLSDGSSKEVMKVKLASRTP-NPSLIWAGPSTLAISLGESMIRMWDIDREENYMLQPSEDMGYTKMGLLSVVDYCASQRTIVAGSNKGQIVMWKMMGNEESYSKENPENRWCLQPATELHVN-GQVSAGSIEKLVASSTNVIAAGTSSNIMYILEEKPMISAFYNGIVITQKGASELFIQLYSSCKESNDNKMFTNEPVLDEQYQETTEKKMECFTIAVEHLITLMDCTRENLIISDGKTVFVYELKLRSSDLASLCGQFESPTFILKIHQQNIYVSEKSQLQIRNFQGIIKQVVDLGNMDGKLSHIDINNNFMVCTTDKCCLRIYDLSRRDPKPIGIIKDFGECIPAVTMIASVSINCNGTVVSLIVEK-QKETDPKLYFWNIETDSIQYFNFSTG 2040
            MA+Y   ++   D       I +H     LA++ I  SS G+V I   +GE      I +    +++ WHP++  LA+GW  G++ +F++     +     H   IA  +WS+ GS L+S D  G L  W++D RG     P+        +   + R+P   G D+    +LAKAAVSGDE+ALD+ +W KSS G  L   S  E  +FF  L DG V  ++E GKT  + S   S+  L Y E R+ L+  T+  +L+ + +  +G ++EVMKVKL+ +T     +     S L  ++GE ++R WD++R ENY+L   E  G+ K   ++ V +C ++  + AG+NKG++ MWK + +  +      ++ W LQ  TEL  N  Q+  GS + L+A S        S+  + IL E+ M S F+  +   Q   S + +   S+                               ++  +  I+ +  T++ + + +GK V ++E    S       G F   T +L +H+++IY  E ++LQ+R +QG +KQ++     +G    +D+   F+V  TD    + +DLSRR+ K     K+  + +P V  I S+  N NG  +S+++ K     D K+Y +++E D++  FNF+TG
Sbjct:    1 MALYFDHRIKAPDTPSSPSHITWHPTHPFLAVASISPSSGGNVDIYLEQGEPVPDTHIERSFQATSLCWHPTRLILAIGWETGEVIMFNKQDKEQHTVPLPHTTDIAILSWSTSGSCLVSGDKLGVLLLWRLDQRGRVQGTPLLKHEYGKALTHCIFRLPP-PGEDLV---QLAKAAVSGDEKALDMFNWRKSSFGSFLKTGS-QEGLSFFVSLMDGTVHYVDEKGKTAQVASTDSSIQTLFYIERREALVVVTENLLLSLYVVTPEGEAEEVMKVKLSGKTGCRADITLIEGSLLVTAIGEPVLRFWDLERGENYILSLQEKFGFEKGESINCVCFCKAKGLLAAGTNKGRVAMWKKVPSFPNGRGAEGKDMWALQTPTELEGNITQIKWGSRKNLLAVS--------STESVSILSEQAMSSHFHQQVAAVQISPSLVNVSFLSTGG---------------------------THSLHTDMHISGVFATKDAVAVWNGKQVAIFE---PSGSTLRNAGTFLCETSVLAMHEESIYTVEPNRLQVRTWQGTVKQLLLFSETEGSPCFLDVCGTFLVAGTDLAHFKSFDLSRREAKVHCSCKNLAQLVPDVGSITSLRCNANGNKISILLSKVNNSPDSKIYIYDVEMDTVNVFNFTTG 617          
BLAST of Intraflagellar transport protein 140 vs. Ensembl Mouse
Match: Ift140 (intraflagellar transport 140 [Source:MGI Symbol;Acc:MGI:2146906])

HSP 1 Score: 565.459 bits (1456), Expect = 2.525e-176
Identity = 291/613 (47.47%), Postives = 401/613 (65.42%), Query Frame = 1
Query: 2299 LLAKDVSSSLPVSHFWDKIDHRLIVVEIRSFDDKELNFNFTNISSIGEKVKKNNRVLV-SLFATQDDGILMFDNIICDEEYERLIGFDAPYYFFAIRNDIAYKKQAKDG---LTCSFITPRVMRDFVGLEDSDGINKQALLNFSYYLTIGNMDEAFKSMKLIKSELVWRNMARMCVKTRRLDVATVCLGKMNYACAAMQLREARQNLPELDAKVAMLALHLDMKEEAIKLLEKSQRYDILNELYQAMEEWNKALDVAEKHDRIHLKTTYYNYAKYLEEEKRYSEALENFVKSGTHAFEVPRMLFNQPDELEKFIRERPEKALRKWWAQYMECCGEMKAALEFYAAAQDNFSLVRAYWLLGMEKKATEVCNDTGDRAACYHLARQFEATNNVDQAIHYYSRAKAYNSAIRLCKENKKDDHLVNLALLCKPEEQVEAASYLQTRNGYQDKAVILFHKAGQVSRAIDLACKTKQFGALQHISNDLSDKVHPDLLQKCASFFMENNQFDRAVDMLASSKQLWEALKLCVDYNVPMTEELAEKLSPPRLNENIEHTQTSISRINSSPHEYTEAERLRLLEGIAEIALSQRQYHLACKKFTQAGNQMMAMKSLLKSGDT 4125
             + K ++   PV+HFWD+ + RL V E                  + E       VL+ S FA+++ G L+ D+      Y+ L+G + P+Y+F  +   A K+   D         +  R +RDFVGLED D   + A+LNFS+++TIG+MDEAFKS+KLIKSE VW NMARMCVKT+RLDVA VCLG M +A  A  LREA Q  PEL+A+VAMLA+ L M EEA +L +K +RYD+LN+ YQA ++W KA++VAE HDR+HL+TTYYNYAK+LE      +AL  + KS TH FEVPRML      LE +I    +K L +WWAQY+E   EM  AL +Y  AQD FSLVR +   G  +KA E+ N+TGD AA YHLARQ+E+ + V QA+H+Y+RA+A+N+AIRLCKEN  DD L+NLALL  PE+ +EAA Y + +    D+AV+L+HKAG  S+A++LA  T+QF ALQ I+ DL +K  P LL +C+ F +E+ QF++AV++L ++K+  EAL+LC++ N+ +TE++AEK++                 ++    + +E  R  LLE IA   + Q  YHLA KK+TQAGN++ AM++LLKSGDT
Sbjct:  638 FMDKSLAGYTPVNHFWDQSEPRLFVCEALQEAPGAQPQAVDKQPRVEEGTCHKEEVLILSFFASEEHGFLLHDSFPRPSTYQSLLGMEVPHYYFTKKPGEADKEDRVDSGYYHIPQMVAKRPLRDFVGLEDCDKSTRDAMLNFSFFVTIGDMDEAFKSIKLIKSEAVWENMARMCVKTQRLDVAKVCLGNMGHARGARALREAEQE-PELEARVAMLAIQLGMLEEAEQLYKKCKRYDLLNKFYQASDQWQKAVEVAELHDRVHLRTTYYNYAKHLEASADCGQALSYYEKSDTHRFEVPRMLSEDLQSLELYINRMKDKTLWRWWAQYLESQAEMDTALRYYELAQDYFSLVRIHCFQGNIQKAAEIANETGDWAASYHLARQYESQDEVKQAVHFYTRAQAFNNAIRLCKENGLDDQLMNLALLSSPEDMIEAARYYEEKGEQMDRAVMLYHKAGHFSKALELAFTTQQFAALQLIAEDLDEKSDPALLARCSDFCIEHRQFEKAVELLLAAKKYHEALQLCLEQNMTITEDMAEKMT-----------------VSKDSKDMSEESRRELLEQIANCCMRQGNYHLATKKYTQAGNKLKAMRALLKSGDT 1232          

HSP 2 Score: 312.768 bits (800), Expect = 5.688e-87
Identity = 198/660 (30.00%), Postives = 330/660 (50.00%), Query Frame = 1
Query:   76 MAIYLTKQLNLDDV--QILDIKFHQKLELLAISVIRESSHGHVIIANNKGEIFNSCKISKPQPISAILWHPSKAQLAVGWSDGQISLFDETQNVSNESLHLHCLPIASFAWSSHGSKLMSADIEGHLYAWKIDARGSFSQNPIFNFSANCPINCILLRMPKLKGSDVYDIRELAKAAVSGDERALDLMSWTKSSSGIKLTGYSYMEVSNFFAGLGDGRVILINEDGKTTNITSLSGSVVRLLYHEERDVLIATTDIGMLTQHQLLSDGSSKEVMKVKLASRTP-NPSLIWAGPSTLAISLGESMIRMWDIDREENYMLQPSEDMGYTKMGLLSVVDYCASQRTIVAGSNKGQIVMWKMMGNEESYSKENPENRWCLQPATELHVN-GQVSAGSIEKLVASSTNVIAAGTSSNIMYILEEKPMISAFYNGIVITQKGASELFIQLYSSCKESNDNKMFTNEPVLDEQYQETTEKKMECFTIAVEHLITLMDCTRENLIISDGKTVFVYELKLRSSDLASLCGQFESPTFILKIHQQNIYVSEKSQLQIRNFQGIIKQVVDLGNMDGKLSHIDINNNFMVCTTDKCCLRIYDLSRRDPKPIGIIKDFGECIPAVTMIASVSINCNGTVVSLIVEK-QKETDPKLYFWNIETDSIQYFNFSTG 2040
            MA+Y   ++   D       I +H     LA++ I  SS G+V I   +GE      I +    +++ WHP++  LA+GW  G++ +F++     +     H   IA  +WS+ GS L+S D  G L  W++D RG     P+        +   + R+P   G D+    +LAKAAVSGDE+ALD+ +W KSS G  L   S  E  +FF  L DG V  ++E GKT  + S   S+  L Y E R+ L+  T+  +L+ + +  +G ++EVMKVKL+ +T     +     S L  ++GE ++R WD++R ENY+L   E  G+ K   ++ V +C ++  + AG+NKG++ MWK + +  +      ++ W LQ  TEL  N  Q+  GS + L+A S        S+  + IL E+ M S F+  +   Q   S + +   S+                               ++  +  I+ +  T++ + + +GK V ++E    S       G F   T +L +H+++IY  E ++LQ+R +QG +KQ++     +G    +D+   F+V  TD    + +DLSRR+ K     K+  + +P V  I S+  N NG  +S+++ K     D K+Y +++E D++  FNF+TG
Sbjct:    1 MALYFDHRIKAPDTPSSPSHITWHPTHPFLAVASISPSSGGNVDIYLEQGEPVPDTHIERSFQATSLCWHPTRLILAIGWETGEVIMFNKQDKEQHTVPLPHTTDIAILSWSTSGSCLVSGDKLGVLLLWRLDQRGRVQGTPLLKHEYGKALTHCIFRLPP-PGEDLV---QLAKAAVSGDEKALDMFNWRKSSFGSFLKTGS-QEGLSFFVSLMDGTVHYVDEKGKTAQVASTDSSIQTLFYIERREALVVVTENLLLSLYVVTPEGEAEEVMKVKLSGKTGCRADITLIEGSLLVTAIGEPVLRFWDLERGENYILSLQEKFGFEKGESINCVCFCKAKGLLAAGTNKGRVAMWKKVPSFPNGRGAEGKDMWALQTPTELEGNITQIKWGSRKNLLAVS--------STESVSILSEQAMSSHFHQQVAAVQISPSLVNVSFLSTGG---------------------------THSLHTDMHISGVFATKDAVAVWNGKQVAIFE---PSGSTLRNAGTFLCETSVLAMHEESIYTVEPNRLQVRTWQGTVKQLLLFSETEGSPCFLDVCGTFLVAGTDLAHFKSFDLSRREAKVHCSCKNLAQLVPDVGSITSLRCNANGNKISILLSKVNNSPDSKIYIYDVEMDTVNVFNFTTG 617          
BLAST of Intraflagellar transport protein 140 vs. UniProt/SwissProt
Match: sp|E9PY46|IF140_MOUSE (Intraflagellar transport protein 140 homolog OS=Mus musculus OX=10090 GN=Ift140 PE=1 SV=1)

HSP 1 Score: 770.385 bits (1988), Expect = 0.000e+0
Identity = 387/824 (46.97%), Postives = 555/824 (67.35%), Query Frame = 1
Query: 2299 LLAKDVSSSLPVSHFWDKIDHRLIVVEIRSFDDKELNFNFTNISSIGEKVKKNNRVLV-SLFATQDDGILMFDNIICDEEYERLIGFDAPYYFFAIRNDIAYKKQAKDG---LTCSFITPRVMRDFVGLEDSDGINKQALLNFSYYLTIGNMDEAFKSMKLIKSELVWRNMARMCVKTRRLDVATVCLGKMNYACAAMQLREARQNLPELDAKVAMLALHLDMKEEAIKLLEKSQRYDILNELYQAMEEWNKALDVAEKHDRIHLKTTYYNYAKYLEEEKRYSEALENFVKSGTHAFEVPRMLFNQPDELEKFIRERPEKALRKWWAQYMECCGEMKAALEFYAAAQDNFSLVRAYWLLGMEKKATEVCNDTGDRAACYHLARQFEATNNVDQAIHYYSRAKAYNSAIRLCKENKKDDHLVNLALLCKPEEQVEAASYLQTRNGYQDKAVILFHKAGQVSRAIDLACKTKQFGALQHISNDLSDKVHPDLLQKCASFFMENNQFDRAVDMLASSKQLWEALKLCVDYNVPMTEELAEKLSPPRLNENIEHTQTSISRINSSPHEYTEAERLRLLEGIAEIALSQRQYHLACKKFTQAGNQMMAMKSLLKSGDTEKIIRFANISKTKEVYVLAANYLQNLDWRRDPDIMKNIITFYTKGKALERLATFYEACSQSEIEEYQNYSKAIGALGEAYKYWSKMKFESENQKNVKLDSIRNKCTLMKKFLATIEMFETSPDEAIHQCQLLLDEPNIDVAIRYGDIYSHMIQYFIHQSKFKAAYACLDEMKRRIRNPSIVTAYIDVATLEFLHKSLGIPFRQPSQIETEK 4758
             + K ++   PV+HFWD+ + RL V E                  + E       VL+ S FA+++ G L+ D+      Y+ L+G + P+Y+F  +   A K+   D         +  R +RDFVGLED D   + A+LNFS+++TIG+MDEAFKS+KLIKSE VW NMARMCVKT+RLDVA VCLG M +A  A  LREA Q  PEL+A+VAMLA+ L M EEA +L +K +RYD+LN+ YQA ++W KA++VAE HDR+HL+TTYYNYAK+LE      +AL  + KS TH FEVPRML      LE +I    +K L +WWAQY+E   EM  AL +Y  AQD FSLVR +   G  +KA E+ N+TGD AA YHLARQ+E+ + V QA+H+Y+RA+A+N+AIRLCKEN  DD L+NLALL  PE+ +EAA Y + +    D+AV+L+HKAG  S+A++LA  T+QF ALQ I+ DL +K  P LL +C+ F +E+ QF++AV++L ++K+  EAL+LC++ N+ +TE++AEK++                 ++    + +E  R  LLE IA   + Q  YHLA KK+TQAGN++ AM++LLKSGDTEKI+ FA +S+ KE+Y++AANYLQ+LDWR++P+IMK+II+FYTKG+AL+ LA FY+AC+Q EI+EYQNY KA GAL EAYK  SK K ++   +  KL  +++K TL+K+F+     +   P E++ QC+LLL+EP++D  IR GD+Y  ++++ +   +++ AY  L+EM++R+ + ++ + Y+D  T++ +H+ LG+    PS+I  E+
Sbjct:  638 FMDKSLAGYTPVNHFWDQSEPRLFVCEALQEAPGAQPQAVDKQPRVEEGTCHKEEVLILSFFASEEHGFLLHDSFPRPSTYQSLLGMEVPHYYFTKKPGEADKEDRVDSGYYHIPQMVAKRPLRDFVGLEDCDKSTRDAMLNFSFFVTIGDMDEAFKSIKLIKSEAVWENMARMCVKTQRLDVAKVCLGNMGHARGARALREAEQE-PELEARVAMLAIQLGMLEEAEQLYKKCKRYDLLNKFYQASDQWQKAVEVAELHDRVHLRTTYYNYAKHLEASADCGQALSYYEKSDTHRFEVPRMLSEDLQSLELYINRMKDKTLWRWWAQYLESQAEMDTALRYYELAQDYFSLVRIHCFQGNIQKAAEIANETGDWAASYHLARQYESQDEVKQAVHFYTRAQAFNNAIRLCKENGLDDQLMNLALLSSPEDMIEAARYYEEKGEQMDRAVMLYHKAGHFSKALELAFTTQQFAALQLIAEDLDEKSDPALLARCSDFCIEHRQFEKAVELLLAAKKYHEALQLCLEQNMTITEDMAEKMT-----------------VSKDSKDMSEESRRELLEQIANCCMRQGNYHLATKKYTQAGNKLKAMRALLKSGDTEKIVFFAGVSRQKEIYIMAANYLQSLDWRKEPEIMKSIISFYTKGRALDLLAGFYDACAQVEIDEYQNYDKAHGALTEAYKCLSKAKTKNPLDQETKLAQLQSKMTLVKRFIQARRTYTEDPKESLRQCELLLEEPDLDSTIRVGDVYGFLVEHHVQMEEYQMAYKYLEEMRKRLPSANM-SYYVDQRTVDTVHQGLGL--LPPSRIMPER 1440          

HSP 2 Score: 314.309 bits (804), Expect = 6.932e-86
Identity = 198/660 (30.00%), Postives = 330/660 (50.00%), Query Frame = 1
Query:   76 MAIYLTKQLNLDDV--QILDIKFHQKLELLAISVIRESSHGHVIIANNKGEIFNSCKISKPQPISAILWHPSKAQLAVGWSDGQISLFDETQNVSNESLHLHCLPIASFAWSSHGSKLMSADIEGHLYAWKIDARGSFSQNPIFNFSANCPINCILLRMPKLKGSDVYDIRELAKAAVSGDERALDLMSWTKSSSGIKLTGYSYMEVSNFFAGLGDGRVILINEDGKTTNITSLSGSVVRLLYHEERDVLIATTDIGMLTQHQLLSDGSSKEVMKVKLASRTP-NPSLIWAGPSTLAISLGESMIRMWDIDREENYMLQPSEDMGYTKMGLLSVVDYCASQRTIVAGSNKGQIVMWKMMGNEESYSKENPENRWCLQPATELHVN-GQVSAGSIEKLVASSTNVIAAGTSSNIMYILEEKPMISAFYNGIVITQKGASELFIQLYSSCKESNDNKMFTNEPVLDEQYQETTEKKMECFTIAVEHLITLMDCTRENLIISDGKTVFVYELKLRSSDLASLCGQFESPTFILKIHQQNIYVSEKSQLQIRNFQGIIKQVVDLGNMDGKLSHIDINNNFMVCTTDKCCLRIYDLSRRDPKPIGIIKDFGECIPAVTMIASVSINCNGTVVSLIVEK-QKETDPKLYFWNIETDSIQYFNFSTG 2040
            MA+Y   ++   D       I +H     LA++ I  SS G+V I   +GE      I +    +++ WHP++  LA+GW  G++ +F++     +     H   IA  +WS+ GS L+S D  G L  W++D RG     P+        +   + R+P   G D+    +LAKAAVSGDE+ALD+ +W KSS G  L   S  E  +FF  L DG V  ++E GKT  + S   S+  L Y E R+ L+  T+  +L+ + +  +G ++EVMKVKL+ +T     +     S L  ++GE ++R WD++R ENY+L   E  G+ K   ++ V +C ++  + AG+NKG++ MWK + +  +      ++ W LQ  TEL  N  Q+  GS + L+A S        S+  + IL E+ M S F+  +   Q   S + +   S+                               ++  +  I+ +  T++ + + +GK V ++E    S       G F   T +L +H+++IY  E ++LQ+R +QG +KQ++     +G    +D+   F+V  TD    + +DLSRR+ K     K+  + +P V  I S+  N NG  +S+++ K     D K+Y +++E D++  FNF+TG
Sbjct:    1 MALYFDHRIKAPDTPSSPSHITWHPTHPFLAVASISPSSGGNVDIYLEQGEPVPDTHIERSFQATSLCWHPTRLILAIGWETGEVIMFNKQDKEQHTVPLPHTTDIAILSWSTSGSCLVSGDKLGVLLLWRLDQRGRVQGTPLLKHEYGKALTHCIFRLPP-PGEDLV---QLAKAAVSGDEKALDMFNWRKSSFGSFLKTGS-QEGLSFFVSLMDGTVHYVDEKGKTAQVASTDSSIQTLFYIERREALVVVTENLLLSLYVVTPEGEAEEVMKVKLSGKTGCRADITLIEGSLLVTAIGEPVLRFWDLERGENYILSLQEKFGFEKGESINCVCFCKAKGLLAAGTNKGRVAMWKKVPSFPNGRGAEGKDMWALQTPTELEGNITQIKWGSRKNLLAVS--------STESVSILSEQAMSSHFHQQVAAVQISPSLVNVSFLSTGG---------------------------THSLHTDMHISGVFATKDAVAVWNGKQVAIFE---PSGSTLRNAGTFLCETSVLAMHEESIYTVEPNRLQVRTWQGTVKQLLLFSETEGSPCFLDVCGTFLVAGTDLAHFKSFDLSRREAKVHCSCKNLAQLVPDVGSITSLRCNANGNKISILLSKVNNSPDSKIYIYDVEMDTVNVFNFTTG 617          
BLAST of Intraflagellar transport protein 140 vs. UniProt/SwissProt
Match: sp|Q96RY7|IF140_HUMAN (Intraflagellar transport protein 140 homolog OS=Homo sapiens OX=9606 GN=IFT140 PE=1 SV=1)

HSP 1 Score: 743.036 bits (1917), Expect = 0.000e+0
Identity = 373/839 (44.46%), Postives = 557/839 (66.39%), Query Frame = 1
Query: 2245 NENISLSPTVTNEHEDSLLLAKDVSSSLPVSHFWDKIDHRLIVVEIRSFDDKELNFNFTNISSIGEKVKKNNRVLVSLFATQDDGILMFDNIICDEEYERLIGFDAPYYFFAIRNDIAYKK-QAKDGL--TCSFITPRVMRDFVGLEDSDGINKQALLNFSYYLTIGNMDEAFKSMKLIKSELVWRNMARMCVKTRRLDVATVCLGKMNYACAAMQLREARQNLPELDAKVAMLALHLDMKEEAIKLLEKSQRYDILNELYQAMEEWNKALDVAEKHDRIHLKTTYYNYAKYLEEEKRYSEALENFVKSGTHAFEVPRMLFNQPDELEKFIRERPEKALRKWWAQYMECCGEMKAALEFYAAAQDNFSLVRAYWLLGMEKKATEVCNDTGDRAACYHLARQFEATNNVDQAIHYYSRAKAYNSAIRLCKENKKDDHLVNLALLCKPEEQVEAASYLQTRNGYQDKAVILFHKAGQVSRAIDLACKTKQFGALQHISNDLSDKVHPDLLQKCASFFMENNQFDRAVDMLASSKQLWEALKLCVDYNVPMTEELAEKLSPPRLNENIEHTQTSISRINSSPHEYTEAERLRLLEGIAEIALSQRQYHLACKKFTQAGNQMMAMKSLLKSGDTEKIIRFANISKTKEVYVLAANYLQNLDWRRDPDIMKNIITFYTKGKALERLATFYEACSQSEIEEYQNYSKAIGALGEAYKYWSKMKFESENQKNVKLDSIRNKCTLMKKFLATIEMFETSPDEAIHQCQLLLDEPNIDVAIRYGDIYSHMIQYFIHQSKFKAAYACLDEMKRRIRNPSIVTAYIDVATLEFLHKSLGIPFRQ--PSQI 4746
             E +S +   TN+    L + + + + +PV+HFWD+ + RL V E      +    +       G      + +++S F +++ G L+ ++         L+G + PYY+F  + + A ++ + + G       ++ R +RDFVGLED D   + A+L+FS+++TIG+MDEAFKS+KLIKSE VW NMARMCVKT+RLDVA VCLG M +A  A  LREA Q  PEL+A+VA+LA  L M E+A +L  K +R+D+LN+ YQA   W +AL VAE HDR+HL++TY+ YA +LE     S AL  + KS TH FEVPRML      LE ++ +  +K L +WWAQY+E  GEM AAL +Y  A+D+FSLVR +   G  +KA ++ N+TG+ AA YHLARQ+E+   V QA+H+Y+RA+A+ +AIRLCKEN  DD L+NLALL  PE+ +EAA Y + +    D+AV+L+HKAG  S+A++LA  T+QF ALQ I+ DL +   P LL +C+ FF+E++Q++RAV++L ++++  EAL+LC+  N+ +TEE+AEK++                 +     +  E  R  LLE IA+  + Q  YHLA KK+TQAGN++ AM++LLKSGDTEKI  FA++S+ KE+Y++AANYLQ+LDWR++P+IMKNII FYTKG+AL+ LA FY+AC+Q EI+EYQNY KA GAL EAYK  +K K +S   +  +L  ++++  L+K+F+     +   P E+I QC+LLL+EP++D  IR GD+Y  ++++++ + +++ AY  L+EM+RR+   ++ + Y+    ++ +H+ LG+P  +  P Q+
Sbjct:  622 RETLSFNEQETNK--SHLFVDEGLKNYVPVNHFWDQSEPRLFVCEAVQETPRSQPQSANGQPQDGRAGPAADVLILSFFISEEHGFLLHESFPRPATSHSLLGMEVPYYYFTRKPEEADREDEVEPGCHHIPQMVSRRPLRDFVGLEDCDKATRDAMLHFSFFVTIGDMDEAFKSIKLIKSEAVWENMARMCVKTQRLDVAKVCLGNMGHARGARALREAEQE-PELEARVAVLATQLGMLEDAEQLYRKCKRHDLLNKFYQAAGRWQEALQVAEHHDRVHLRSTYHRYAGHLEASADCSRALSYYEKSDTHRFEVPRMLSEDLPSLELYVNKMKDKTLWRWWAQYLESQGEMDAALHYYELARDHFSLVRIHCFQGNVQKAAQIANETGNLAASYHLARQYESQEEVGQAVHFYTRAQAFKNAIRLCKENGLDDQLMNLALLSSPEDMIEAARYYEEKGVQMDRAVMLYHKAGHFSKALELAFATQQFVALQLIAEDLDETSDPALLARCSDFFIEHSQYERAVELLLAARKYQEALQLCLGQNMSITEEMAEKMT-----------------VAKDSSDLPEESRRELLEQIADCCMRQGSYHLATKKYTQAGNKLKAMRALLKSGDTEKITFFASVSRQKEIYIMAANYLQSLDWRKEPEIMKNIIGFYTKGRALDLLAGFYDACAQVEIDEYQNYDKAHGALTEAYKCLAKAKAKSPLDQETRLAQLQSRMALVKRFIQARRTYTEDPKESIKQCELLLEEPDLDSTIRIGDVYGFLVEHYVRKEEYQTAYRFLEEMRRRLPLANM-SYYVSPQAVDAVHRGLGLPLPRTVPEQV 1439          

HSP 2 Score: 322.783 bits (826), Expect = 1.235e-88
Identity = 200/660 (30.30%), Postives = 336/660 (50.91%), Query Frame = 1
Query:   76 MAIYLTKQLNLDDVQILD--IKFHQKLELLAISVIRESSHGHVIIANNKGEIFNSCKISKPQPISAILWHPSKAQLAVGWSDGQISLFDETQNVSNESLHLHCLPIASFAWSSHGSKLMSADIEGHLYAWKIDARGSFSQNPIFNFSANCPINCILLRMPKLKGSDVYDIRELAKAAVSGDERALDLMSWTKSSSGIKLTGYSYMEVSNFFAGLGDGRVILINEDGKTTNITSLSGSVVRLLYHEERDVLIATTDIGMLTQHQLLSDGSSKEVMKVKLASRTPNPS-LIWAGPSTLAISLGESMIRMWDIDREENYMLQPSEDMGYTKMGLLSVVDYCASQRTIVAGSNKGQIVMWKMMGNEESYSKENPENRWCLQPATELHVN-GQVSAGSIEKLVASSTNVIAAGTSSNIMYILEEKPMISAFYNGIVITQKGASELFIQLYSSCKESNDNKMFTNEPVLDEQYQETTEKKMECFTIAVEHLITLMDCTRENLIISDGKTVFVYELKLRSSDLASLCGQFESPTFILKIHQQNIYVSEKSQLQIRNFQGIIKQVVDLGNMDGKLSHIDINNNFMVCTTDKCCLRIYDLSRRDPKPIGIIKDFGECIPAVTMIASVSINCNGTVVSLIVEKQKET-DPKLYFWNIETDSIQYFNFSTG 2040
            MA+Y   Q+   D       I +H     LA++ I  +S G V I   +GE      + +P  ++++ WHP++  LAVGW  G++++F++     +     H   I    WS  G+ L+S D  G L  W++D RG     P+        +   + R+P   G D+    +LAKAAVSGDE+ALD+ +W KSSSG  L   S+ E   FF  L DG V  ++E GKTT + S   ++  L Y E+R+ L+  T+   L+ + +  +G ++EVMKVKL+ +T   + +     S L +++GE+ +R WDI+R ENY+L P E  G+ K   ++ V YC  +  + AG+++G++ MW+ + +         ++RW LQ  TEL  N  Q+  GS + L+A ++ +  A        IL E+ M S F+  +   Q   S L             N  F +  V                ++  +  I+ +  T++ + + +G+ V ++EL   S       G F   T +L +H++N+Y  E +++Q+R +QG +KQ++     +G    +DI  NF+V  TD    + +DLSRR+ K     +   E +P V  IAS+  + +G+ +S++  K   + D K+ F+++E D++  F+F TG
Sbjct:    1 MALYYDHQIEAPDAAGSPSFISWHPVHPFLAVAYISTTSTGSVDIYLEQGECVPDTHVERPFRVASLCWHPTRLVLAVGWETGEVTVFNKQDKEQHTMPLTHTADITVLRWSPSGNCLLSGDRLGVLLLWRLDQRGRVQGTPLLKHEYGKHLTHCIFRLPP-PGEDLV---QLAKAAVSGDEKALDMFNWKKSSSGSLLKMGSH-EGLLFFVSLMDGTVHYVDEKGKTTQVVSADSTIQMLFYMEKREALVVVTENLRLSLYTVPPEGKAEEVMKVKLSGKTGRRADIALIEGSLLVMAVGEAALRFWDIERGENYILSPDEKFGFEKGENMNCVCYCKVKGLLAAGTDRGRVAMWRKVPDFLGSPGAEGKDRWALQTPTELQGNITQIQWGSRKNLLAVNSVISVA--------ILSERAMSSHFHQQVAAMQVSPSLL-------------NVCFLSTGV--------------AHSLRTDMHISGVFATKDAVAVWNGRQVAIFEL---SGAAIRSAGTFLCETPVLAMHEENVYTVESNRVQVRTWQGTVKQLLLFSETEGNPCFLDICGNFLVVGTDLAHFKSFDLSRREAKAHCSCRSLAELVPGVGGIASLRCSSSGSTISILPSKADNSPDSKICFYDVEMDTVTVFDFKTG 617          
BLAST of Intraflagellar transport protein 140 vs. UniProt/SwissProt
Match: sp|G5ECZ4|DYF2_CAEEL (WD repeat-containing protein dyf-2 OS=Caenorhabditis elegans OX=6239 GN=dyf-2 PE=1 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 1.090e-7
Identity = 67/274 (24.45%), Postives = 114/274 (41.61%), Query Frame = 1
Query: 2776 SELVWRNMARMCVKTRRLDVATVCLGKMNYACAAMQLREARQNLPELDAKV-----AMLALHLDMKEEAIKLLEKSQRYDILNELYQAMEEWNKALDVAEKHDRIHLKTTYYNYAKYLEEEKRYSEALENFVKSGTHAFEVPRML--FNQPDELEKFIRERPEKALRKWWAQYMECCGEMKAALEFYAAA---QDNFSLVRAYWLLGMEKKATEVCNDTGDRAACYHLARQFEATNNVDQAIHYYSRAKAYNSAIRLCKENKKDDHLVNLALLC 3567
            +E+    +ARM +KT                     LR   Q   +L+ +V     A++   +    EA +L E    YD    +      W K   V E  D +     +  Y K +E+EK+Y  A++ +     +  +V  +L   N PDE  + +RE       K  A++    G+  +A++F   +   Q+ F L      +    KA E     G+ +    LA  +   N++  A  +Y++A  YN+AI L  +N  D++ V LA+ C
Sbjct:  855 NEICQSGIARMAIKTG-------------------DLRRGVQLAKQLEGRVVKRDCAIILEQMKQYTEAAQLYEVGLFYDRAAAVCLKANAWAK---VGELLDHVKSPKIHIQYGKIMEKEKKYKVAVKCYETGRDYDNQVRLLLDPLNDPDEAVRVVRESRSIEGAKLVAKFFVKLGDYNSAIQFLVMSQCVQEAFELAEKNNAVREYAKAIE---QHGNISQALELAEYYNRVNDMFMAAKFYTQAGQYNNAINLLFKNGDDENCVALAVDC 1103          
BLAST of Intraflagellar transport protein 140 vs. TrEMBL
Match: K1QP23 (Uncharacterized protein OS=Crassostrea gigas OX=29159 GN=CGI_10020334 PE=4 SV=1)

HSP 1 Score: 1209.51 bits (3128), Expect = 0.000e+0
Identity = 645/1571 (41.06%), Postives = 956/1571 (60.85%), Query Frame = 1
Query:   76 MAIYLTKQLNLDDVQI-LDIKFHQKLELLAISVIRESSHGHVIIANNKGEIFNSCKISKPQPISAILWHPSKAQLAVGWSDGQISLFDETQNVSNESLHLHCLPIASFAWSSHGSKLMSADIEGHLYAWKIDARGSFSQNPIFNFSANCPINCILLRMPKLKGSDVYDIRELAKAAVSGDERALDLMSWTKSSSGIKLTG-YSYMEVSNFFAGLGDGRVILINEDGKTTNITSLSGSVVRLLYHEERDVLIATTDIGMLTQHQLLSDGSSKEVMKVKLASRTPNPSLIWAGPSTLAISLGESMIRMWDIDREENYMLQPSEDMGYTKMGLLSVVDYCASQRTIVAGSNKGQIVMWKMMGNEESYSKE------NPENRWCLQ-PATELHVNGQVSAGSIEKLVASSTNVIAAGTSSNIMYILEEKPMISAFYNGIVITQKGASELFIQLYSSCKESNDNKMFTNEPVLDEQYQETTEKKMECFTIAVEHLITLMDCTRENLIISDGKTVFVYELKLRSSDLASLCGQFESPTFILKIHQQNIYVSEKSQLQIRNFQGIIKQVVDLGNMDGKLSHIDINNNFMVCTTDKCCLRIYDLSRRDPKPIGIIKDFGECIPAVTMIASVSINCNGTVVSLIVEKQKET-DPKLYFWNIETDSIQYFNFSTGLGEQDDFTIKNSIXXXXXXXXXXXXXXXXXXXXXXNFIEQSDTPFSVTQSILYNDEDDENNETASDSDNENISLSPTVTNEHEDSLLLAKDVSSSLPVSHFWDKIDHRLIVVEIRSFDD--KELNFNFTNISSIGEKVKKN--NRVLVSLFATQDDGILMFDNIICDEEYERLIGFDAPYYFFAIRNDIAYKKQAK-DGLTCSFITPRV-----MRDFVGLEDSDGINKQALLNFSYYLTIGNMDEAFKSMKLIKSELVWRNMARMCVKTRRLDVATVCLGKMNYACAAMQLREARQNLPELDAKVAMLALHLDMKEEAIKLLEKSQRYDILNELYQAMEEWNKALDVAEKHDRIHLKTTYYNYAKYLEEEKRYSEALENFVKSGTHAFEVPRMLFNQPDELEKFIRERPEKALRKWWAQYMECCGEMKAALEFYAAAQDNFSLVRAYWLLGMEKKATEVCNDTGDRAACYHLARQFEATNNVDQAIHYYSRAKAYNSAIRLCKENKKDDHLVNLALLCKPEEQVEAASYLQTRNGYQDKAVILFHKAGQVSRAIDLACKTKQFGALQHISNDLSDKVHPDLLQKCASFFMENNQFDRAVDMLASSKQLWEALKLCVDYNVPMTEELAEKLSPPRLNENIEHTQTSISRINSSPHEYTEAERLRLLEGIAEIALSQRQYHLACKKFTQAGNQMMAMKSLLKSGDTEKIIRFANISKTKEVYVLAANYLQNLDWRRDPDIMKNIITFYTKGKALERLATFYEACSQSEIEEYQNYSKAIGALGEAYKYWSKMKFESENQKNVKLDSIRNKCTLMKKFLATIEMFETSPDEAIHQCQLLLDEPNIDVAIRYGDIYSHMIQYFIHQSKFKAAYACLDEMKRRIRNPSIVTAYIDVATLEFLHKSLGIPF 4728
            MA+Y   +L+ D   I +D +++    +LA++   + + G V +  ++GE   +  +++    +A+ WHP+K  LAVGW +G++ +++E  +  +ESL LH   I    WSS G++L S D  G L  WK DA+G   QNP+       P+  +L R          DI +LA+AAVSGDE ALD+ +W K  +  +    +   E   FF G   G V  +N+ G+   I ++ G V+ LL+++E+++LI  T+  +LTQH +  +G ++EV+KVK++ R  + +++WAG   LA SLGE ++RMWD++ E+NY+L       Y     ++ + YC  + T+  G+N G + +WK       YS        + E +W LQ PAT      Q+  GS + L+A   N IA       +++L E+ M + F     + Q G S L ++++S+        M  ++   D               I V+ + T    T++ L + +G+ V  YE     S + +  G F + T  + +H+QN+Y  E  ++Q+R  QG +KQ ++    +G+   ID+  N++V  T+   +R+YDLSRR+ KP    ++ GE IP    I S   NC+GT VS++V+   +  DPKLYFW+ E D + YFNF TG GEQD                                    D P    + +  +  D E  +T +                       AKD++   P++H+WD  D +LIV E +   D   +       I S+ + +       ++VSLF+T ++GIL+ D+    E+Y+ L+G + PY++F  +++       + DG     ++PR+     MRDFVGLEDSD   K A+LNFSYYLTIGNMDEAFK++KLIKSE VW NMA+MCVK+RRLDVA+VCLG M +A  A  LREA +  PELDAKVA+LA+ L +KE+A +LL+  +RYD+LNE YQ++ +W KAL+ AE +DRIHL+TTY+N+AK+LE +  YSEA+ N+ KS TH FEVPRMLF++P+ LE +I    +KAL KWWAQYME  G+M+ AL++Y  AQD  SLVR Y   G   KA E+CN+TGDRAACYHL RQ+E  + + +AIH+++RA+AY +AIRLCKE+  +D L+NLAL+ +PE+ +EAA Y + + G QDKAV+L+HKA   S+A+DL+ + +QFGALQ IS +L ++  P+LL++C  FFMEN Q+D+AVD+LA  K+ WEALK+C+D  V + E+LAEKL+P + +  I+                   ER+++LE IAE+ + Q +YHLA KKFTQAGN++ AMK+LLKSGDTEKI  FAN+S+ KE+Y++AANYLQ+LDWR+DP+IMKNII FYTKG+AL+ LA FY+AC+Q EI+EYQ+Y KA+ ALGEAYK  +K K   E     +L  ++NK  L+KKF+     FE +P+E I QCQ+LL+EP+++  +R GD+Y  MI+Y+  + ++KAA+A ++EMK RI N SI   Y+++ T+E ++++L IP 
Sbjct:    1 MAVYFDHRLDTDRSGINIDTQWYDGSPILAVNTYSDDTGGSVNLFLDEGEKLLNIPLTRTCQATAMAWHPTKKILAVGWDNGELLVWNEHDHELHESLPLHKTSITVLGWSSAGTRLSSGDKAGVLMVWKADAKGRLQQNPLHQHHIQEPLKIMLYRPVPPP-DPNNDIAQLARAAVSGDESALDMFNWKKGKNNARGGAPFGAQEALTFFVGGATGGVYYVNDAGQCAQIFNVDGPVLTLLHYDEKNILITVTESMLLTQHFITPEGEAREVLKVKMSGRGDSKTIVWAGLGILATSLGEGVVRMWDLEHEDNYILSLEGHNSYDHNESITCISYCPEKGTLAGGTNMGNVALWK-------YSPPLTGKVVDGEMKWKLQAPATVEGPIKQIRWGSNKHLLA--VNTIAN------VFMLNEQVMSAGFKEQTAVVQYGPSSLSVEVFSN--------MAHHDLKTD---------------IQVKGIFT----TKDALAVWNGRRVITYEYSADKSSIKA-AGTFTTETMNVCLHEQNVYCIEAMKVQVRTHQGTVKQTINFSEPEGQPVSIDVCGNYLVIGTNIGLVRVYDLSRREAKPHSQPRNLGEIIPGFGSIISCKCNCSGTRVSVLVKSTNDAIDPKLYFWDTEIDQVSYFNFETGRGEQD------------------------------------DFPPEQVEGVEGDTNDAERGKTQA-----------------------AKDIAGRSPMTHYWDAHDPKLIVCEAKILMDIFHKKEKEEKKIVSLSKTMDDGPVEVMIVSLFSTPENGILIQDSFPLPEQYQTLLGIEVPYHYFVNKSENTSDDDGQGDGPRPEAVSPRMVARRTMRDFVGLEDSDKNTKDAMLNFSYYLTIGNMDEAFKAIKLIKSESVWENMAKMCVKSRRLDVASVCLGNMGHARGARALREAMKE-PELDAKVAVLAMQLGLKEDAERLLKNCKRYDLLNEFYQSIGDWKKALETAEMYDRIHLRTTYFNFAKHLEMKGEYSEAIPNYEKSDTHRFEVPRMLFDEPEALEHYISMHKDKALHKWWAQYMESTGDMENALQYYENAQDYLSLVRVYCYCGQMDKAAEICNNTGDRAACYHLGRQYENQDQIKEAIHFFTRAQAYFNAIRLCKEHGMEDQLMNLALMGRPEDMIEAARYYEQKPGAQDKAVMLYHKARNFSKALDLSFRARQFGALQLISGELDERADPELLKRCGDFFMENGQYDKAVDLLAIGKKYWEALKICMDQTVEINEDLAEKLTPSKDDAGID-----------------TMERVKILEAIAEVCMHQGEYHLATKKFTQAGNKIKAMKALLKSGDTEKICFFANVSRQKEIYIMAANYLQSLDWRKDPEIMKNIIGFYTKGRALDSLAGFYDACAQVEIDEYQDYEKALRALGEAYKCLTKAKMNDEMLLEERLAQLKNKMALIKKFVTARRAFEENPEEGIKQCQILLEEPDLESGVRVGDVYGVMIEYYARRDRWKAAHAAIEEMKSRIPNMSI-GYYVNMRTVEAVYRALDIPM 1449          
BLAST of Intraflagellar transport protein 140 vs. TrEMBL
Match: A0A210PX04 (Intraflagellar transport protein 140 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT02234 PE=4 SV=1)

HSP 1 Score: 1205.28 bits (3117), Expect = 0.000e+0
Identity = 646/1576 (40.99%), Postives = 954/1576 (60.53%), Query Frame = 1
Query:   76 MAIYLTKQLNLDDVQI-LDIKFHQKLELLAISVIRESSHGHVIIANNKGEIFNSCKISKPQPISAILWHPSKAQLAVGWSDGQISLFDETQNVSNESLHLHCLPIASFAWSSHGSKLMSADIEGHLYAWKIDARGSFSQNPIFNFSANCPINCILLRMPKLKGSDVYDIRELAKAAVSGDERALDLMSW-TKSSSGIKLTG-YSYMEVSNFFAGLGDGRVILINEDGKTTNITSLSGSVVRLLYHEERDVLIATTDIGMLTQHQLLSDGSSKEVMKVKLASRTPNPSLIWAGPSTLAISLGESMIRMWDIDREENYMLQPSEDMGYTKMGLLSVVDYCASQRTIVAGSNKGQIVMWKMMGNEESYSKENPENRWCLQ-PATELHVNGQVSAGSIEKLV-ASSTNVIAAGTSSNIMYILEEKPMISAFYNGIVITQKGASELFIQLYSSCKESNDNKMFTNEPVLDEQYQETTEKKMECFTIAVEHLITLMDCTRENLIISDGKTVFVYELKLRSSDLASLCGQFESPTFILKIHQQNIYVSEKSQLQIRNFQGIIKQVVDLGNMDGKLSHIDINNNFMVCTTDKCCLRIYDLSRRDPKPIGIIKDFGECIPAVTMIASVSINCNGTVVSLIVEKQK-ETDPKLYFWNIETDSIQYFNFSTGLGEQDDFTIKNSIXXXXXXXXXXXXXXXXXXXXXXNFIEQSDTPFSVTQSILYNDEDDENNETASDSDNENISLSPTVTNEHEDSLLLAKDVSSSLPVSHFWDKIDHRLIVVEIRSFDDKELNFNFTNIS--SIGEKVKKN--NRVLVSLFATQDDGILMFDNIICDEEYERLIGFDAPYYFFAIRND-IAYKKQAKDG-------------LTCSFITPRVMRDFVGLEDSDGINKQALLNFSYYLTIGNMDEAFKSMKLIKSELVWRNMARMCVKTRRLDVATVCLGKMNYACAAMQLREARQNLPELDAKVAMLALHLDMKEEAIKLLEKSQRYDILNELYQAMEEWNKALDVAEKHDRIHLKTTYYNYAKYLEEEKRYSEALENFVKSGTHAFEVPRMLFNQPDELEKFIRERPEKALRKWWAQYMECCGEMKAALEFYAAAQDNFSLVRAYWLLGMEKKATEVCNDTGDRAACYHLARQFEATNNVDQAIHYYSRAKAYNSAIRLCKENKKDDHLVNLALLCKPEEQVEAASYLQTRNGYQDKAVILFHKAGQVSRAIDLACKTKQFGALQHISNDLSDKVHPDLLQKCASFFMENNQFDRAVDMLASSKQLWEALKLCVDYNVPMTEELAEKLSPPRLNENIEHTQTSISRINSSPHEYTEAERLRLLEGIAEIALSQRQYHLACKKFTQAGNQMMAMKSLLKSGDTEKIIRFANISKTKEVYVLAANYLQNLDWRRDPDIMKNIITFYTKGKALERLATFYEACSQSEIEEYQNYSKAIGALGEAYKYWSKMKFESENQKNVKLDSIRNKCTLMKKFLATIEMFETSPDEAIHQCQLLLDEPNIDVAIRYGDIYSHMIQYFIHQSKFKAAYACLDEMKRRIRNPSIVTA-YIDVATLEFLHKSLGIPF 4728
            MA+Y   +L  D   I  D  +     ++A++   + + G V +   +GE   +  + +    +++ WHP+K  +AVGW +G++ +++E  +   E L LH   I    WSS GS+L S D  G L  WK D +G   QNP+       P++ IL R P       +DI  LA+AAVSGDE+ALDL +W +K     K++  +   E   FF G   G V  +NE+G+ T I S+  +++R LY+EE++VLI  T+  MLTQH ++ +G +KE+M+VK++ R  NP + WAG S +A + GE ++RMWD+D EENY+L       Y K   +  + YC  +  +  G+N G I +W+      S   +  E +W LQ PAT          GSI +L   S  N++A  T +N+ ++L E+ M S+F     + Q G S L ++++++    +                           +  E  +  +  T++ L + +G+ V  YE       +    G F + T  +++++QN+Y  E  ++Q+R  QG +KQV++  + +G+   +D+    +V  TD   +R+YDLSRR+ KP    K+ G+ IP    I S   N NG+ VS++V+      DPKLYFW++E+D + YFNF +G GE                                    Q D P    + +  +  D E  +  +                       AKD++   P++H WD  D +LIV E +                 S+ + V++     ++VSLF T ++GIL+ D+    E+++ L+G + PYY+   +++ +  ++Q KD              +    +  + MRDFVGLE+SD   ++A++NFSYYLTIGNMDEAFKS+KLIKSE VW NMA+MCVK+RRLDVA+VCLG M +A  A  LREA +  PELDAKVA+LA+ L +KE+A +LL+  +RYD+LNE YQ+  +W KAL+ AE +DRIHL+ TYYN+AK+LE +  YS+A+ N+ KS TH FEVPRMLF++P+ LE++I    +KAL KWWAQYME  GEM AAL++Y  AQD  SLVR Y   G   KA+E+CN+TGDRAACYHL RQ+E  + + +AIH++ RA+AY +AIRLCKE+  +D L+NLALL +PE+ +EAA Y + + G +DKAV+L+HKAG  S+A+DL+ ++KQFGALQ IS DL ++  P+LLQ+C  FFM+N Q+D+AVD+LA  K+ WEALK+C+D +V +TE+LAEKL+P + +  I+                   ER+++LE IAE+ + Q QYHLA KKFTQAGN++ AMK+LLKSGDTEKI  FA +S+ KE+YV+AANYLQ+LDWR+DP+IMKNII FYTKG+AL+ LA FY+AC+Q EI+EYQNY KA+GALGEAYK  SK K   E  +  KL  ++NK TL+KKF+     ++ +P++AI QCQ+LL+EP++D ++R GD+Y  +I+++  + ++KAAYA ++EMK RI  P++  A Y+++ T+E +H++L IP 
Sbjct:    1 MAVYFDHRLETDRSGINTDASWFSGAPMIAVTSYSDENGGTVNLFLEEGEKLLNIPLHRAGQATSVAWHPTKKIVAVGWENGELLVWNEVDHELFEGLPLHKTAITVLHWSSSGSRLSSGDKAGVLMVWKSDGKGRLQQNPLHQHHVQEPLSKILYR-PIPPPDPEHDIAALARAAVSGDEKALDLFTWKSKGKGNSKMSSMFGPTEALTFFVGGESGGVYYVNENGQCTQIFSVDTAILRFLYYEEKNVLITVTENMMLTQHAIMPEGDAKELMRVKMSGRGENPVICWAGKSIVATATGEGVVRMWDLDHEENYILSLDGHGSYDKSENIMCISYCEEKGVLAGGTNLGNIALWRYAPPLGSRLVDG-EKKWKLQAPAT--------VEGSIRQLSWGSKKNLLAVNTIANV-FMLNEQTMSSSFSGQTAVVQFGPSSLALEMFATGTHHD---------------------------LKTEVQVKGVCTTKDTLAVWNGRKVITYEYS-EDRTIIKGAGTFATETMEVRLYEQNVYCVEIGKVQVRTHQGTVKQVINFSDAEGQPVSLDVCGTSLVIATDNGVVRVYDLSRREAKPTSQPKNLGDVIPGFNGILSARCNSNGSKVSVLVKNNSSHADPKLYFWDVESDVVSYFNFESGRGE------------------------------------QDDFPPEQIEGVEGDTNDAERGKNQA-----------------------AKDIAGRYPMTHHWDPHDTKLIVCEAKVMASAVEKKEKEEKKRHSLTKAVEEGPVEVMVVSLFCTPENGILIQDSFQMPEQFQALLGIEVPYYYNIKKSENLKEEEQEKDDTPQPENLIKSDTVIQPKLVARKTMRDFVGLENSDKNTREAMMNFSYYLTIGNMDEAFKSIKLIKSESVWENMAKMCVKSRRLDVASVCLGNMGHARGAKALREAMKE-PELDAKVAVLAMQLGLKEDAERLLKNCKRYDLLNEFYQSSGQWIKALETAEMYDRIHLRATYYNHAKHLEVKGDYSDAIPNYEKSDTHRFEVPRMLFDEPEALEQYISRHKDKALHKWWAQYMESTGEMDAALQYYETAQDFLSLVRVYCYCGKMDKASEICNETGDRAACYHLGRQYENQDLIKEAIHFFQRAQAYGNAIRLCKEHGYEDQLLNLALLGRPEDMMEAARYYEQKQGSEDKAVMLYHKAGNFSKALDLSFRSKQFGALQMISGDLDERADPELLQRCGDFFMDNGQYDKAVDLLAIGKKYWEALKICMDQHVEITEDLAEKLTPNKDDMGID-----------------TMERVKILEAIAEVCMHQGQYHLATKKFTQAGNKIKAMKALLKSGDTEKITFFAGVSRQKEIYVMAANYLQSLDWRKDPEIMKNIIGFYTKGRALDSLAAFYDACAQVEIDEYQNYDKALGALGEAYKCLSKTKMSDEMLQEEKLSRLKNKITLIKKFVTARRAYDENPEDAIKQCQVLLEEPHLDDSVRMGDVYGLIIEHYARRERWKAAYAAMEEMKSRI--PALNMAYYVNMRTIESVHRALDIPL 1458          
BLAST of Intraflagellar transport protein 140 vs. TrEMBL
Match: V3ZMC6 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_223604 PE=4 SV=1)

HSP 1 Score: 1176 bits (3041), Expect = 0.000e+0
Identity = 641/1576 (40.67%), Postives = 944/1576 (59.90%), Query Frame = 1
Query:   76 MAIYLTKQLNLDDVQI-LDIKFHQKLELLAISVIRESSHGHVIIANNKGEIFNSCKISKPQPISAILWHPSKAQLAVGWSDGQISLFDETQNVSNESLHLHCLPIASFAWSSHGSKLMSADIEGHLYAWKIDARGSFSQNPIFNFSANCPINCILLRMPKLKGSDVYDIRELAKAAVSGDERALDLMSWTKSSSGIKLTGYSYMEVSNFFAG--LGDGRVILINEDGKTTNITSLSGSVVRLLYHEERDVLIATTDIGMLTQHQLLSDGSSKEVMKVKLASRTPNPSLIWAGPSTLAISLGESMIRMWDIDREENYMLQPSEDMGYTKMGLLSVVDYCASQRTIVAGSNKGQIVMWKMMGNEESYSKENPENRWCLQPATELHVNGQVSAGSIEKL-VASSTNVIAAGTSSNIMYILEEKPMISAFYNGIVITQKGASELFIQLYSSCKESNDNKMFTNEPVLDEQYQETTEKKMECFTIAVEHLITLMDCTRENLIISDGKTVFVYELKLRSSDLASLCGQFESPTFILKIHQQNIYVSEKSQLQIRNFQGIIKQVVDLGNMDGKLSHIDINNNFMVCTTDKCCLRIYDLSRRDPKPIGIIKDFGECIPAVTMIASVSINCNGTVVSLIVEK-QKETDPKLYFWNIETDSIQYFNFSTGLGEQDDFTIKNSIXXXXXXXXXXXXXXXXXXXXXXNFIEQSDTPFSVTQSILYNDEDDENNETASDSDNENISLSPTVTNEHEDSLLLAKDVSSSLPVSHFWDKIDHRLIVVE---IRSFDDKELNFNFTNIS-SIGEKVKKNNRVLVSLFATQDDGILMFDNIICDEEYERLIGFDAPYYFFAIRNDIAYKKQAKD----GLTCSFITPRVMRDFVGLEDSDGINKQALLNFSYYLTIGNMDEAFKSMKLIKSELVWRNMARMCVKTRRLDVATVCLGKMNYACAAMQLREARQNLPELDAKVAMLALHLDMKEEAIKLLEKSQRYDILNELYQAMEEWNKALDVAEKHDRIHLKTTYYNYAKYLEEEKRYSEALENFVKSGTHAFEVPRMLFNQPDELEKFIRERPEKALRKWWAQYMECCGEMKAALEFYAAAQDNFSLVRAYWLLGMEKKATEVCNDTGDRAACYHLARQFEATNNVDQAIHYYSRAKAYNSAIRLCKENKKDDHLVNLALLCKPEEQVEAASYLQTRNGYQDKAVILFHKAGQVSRAIDLACKTKQFGALQHISNDLSDKVHPDLLQKCASFFMENNQFDRAVDMLASSKQLWEALKLCVDYNVPMTEELAEKLSPPRLNENIEHTQTSISRINSSPHEYTEAERLRLLEGIAEIALSQRQYHLACKKFTQAGNQMMAMKSLLKSGDTEKIIRFANISKTKEVYVLAANYLQNLDWRRDPDIMKNIITFYTKGKALERLATFYEACSQSEIEEYQNYSKAIGALGEAYKYWSKMKFESENQKNVKLDSIRNKCTLMKKFLATIEMFETSPDEAIHQCQLLLDEPNIDVAIRYGDIYSHMIQYFIHQSKFKAAYACLDEMKRR--IRNPSIVTAYIDVATLEFLHKSLGIPFRQPSQIETEK 4758
            MA+Y   +L  D   I  +IK+      LA+    E + G V I   +GE      + K   +S I WHP++  LAVGW  G+I++++E  N   E+L +H   ++   WSS GS+L + D  G L  WK D++G   Q+P        P+  IL R P   G  + DI  LA+AAVSGDE ALD+ +W +  S   +  +   E   FF G  +  G V  +N+ G+ T   S   SV +LLY++ER++L+  T+   +TQH +L DG ++EV+KVKL+ ++ N S++WAG   LA + GE ++RMWD+  E+N++L       Y     +  + YCA   T+  G+N G I +WK   N      E  E+ W LQ          V  G + ++  A     +A  T SN+ ++L E+ M ++F +   + Q G S + I+++S+    +                           I V+  I     T++ + I +GK V +YE     S + S  G F++   ++ +++QN+Y  E++++Q+R FQG +KQ++   +M+G   ++DI  N++   TD   +R+YDLSRR+ K     K   + IP    I S   NC G  VS++++   K TDPKLYFW++E D++QYFNF TG GEQDD+T  +  +                        E SDT          ND +   N+ A                         KD++  +P+SH+WD ++ +L+V E   +     K+ N N    S SI + V+K   ++VSLF T ++G+L+ D+     ++ +L+G + P  +FA            D     +    +  RVMRDFVGLE SD   + A++NFSYYLTIGNMDEAFK++KLIKSE VW NMA+MCVK+RRLDVATVCLG M  A  A  LRE+ +  PELDA+VA+LA  L + E+A +LL+  +RYD+LNE YQ   +W KA++ AE +DR+HL+TT ++YA++LE+    + A++ F KS TH FEVPRML ++P+ LE++I    +K LRKWWAQY+E  G+MK AL+FY +AQD FS+VR +       +A EVCN+TG+ AACY++A Q+E    + +AIH++ RAKAY SAIRLCKE+  +D ++NLAL+ +PEE +EAA Y + +   QDKAV+L+HKAG  SRA DLA + K+FGALQHIS DL ++  P+LLQ+C  FF+EN Q+D+AVD+LA  K+ W+ALK+C++ +V MTEEL EKLSP + +EN                E    ER ++LE +AE+ + Q  YHLA KKFTQAGN++ AMK+LLKSGDT+KI+ FA +S+ KE+Y++AANYLQ+LDWR+DP+IMKNII FY+KG+AL+ LA FY+AC+Q EI+EYQNY KAIGALGEAYK  SK K + E+ +  +L  I++K  ++KKF+    +++  P+EA+  CQ+++ E + + +IR GD+YS MI+++  + ++KAAYA L+E+K +  + NP+    Y+D+  +E +HK+L IP  +   I TEK
Sbjct:    1 MAVYFDHRLGGDSSYIKTEIKWCPSSLHLAVICYSEENGGTVEIYTEEGERIQHNAVHKQCHVSTIAWHPNRRILAVGWETGEITIWNEQDNEVTEALQIHKHEVSVLHWSSTGSRLSTGDKNGVLVVWKSDSKGRLQQHPFCQHHIQEPLTSILYR-PSKTGEALPDIASLARAAVSGDEAALDMFNWKRGKSSTPM--FFPSESLAFFVGDLVFIGGVYYVNDTGQCTQSFSADNSVKQLLYYDERNILVTVTEQLQMTQHTVLPDGGTQEVLKVKLSGKSGNVSILWAGKGLLATASGEMVVRMWDLASEDNFVLNLDSHNAYDDNETIICISYCAENGTLAGGTNNGNIALWKYSPNLGKVGDE--ESMWRLQSPP-------VVDGPVRQVEWAPKKGFMAVNTVSNV-FMLSEQVMSASFRDETAVVQYGPSSIAIEIFSTGNNHD---------------------------IKVDMQIKGAYTTKDAMAIWNGKRVILYEYAADRSVIRS-TGTFQTEAMMICLYEQNVYTIEQNKVQVRTFQGTVKQILSFIDMEGVPIYLDICGNYLTVATDTGLVRVYDLSRREAKAHTNPKILSDIIPGFGTILSAKCNCTGNRVSVLIQNTDKYTDPKLYFWDVENDTVQYFNFETGRGEQDDYTATSDGEP-----------------------EDSDT----------NDAEKGKNQAA-------------------------KDIAGRIPISHYWDMMESKLLVCEAQYVPPATPKDKNDNLLKRSHSINKHVEK---MIVSLFCTPENGVLIQDSFPMSVQHNKLLGIEVPNLYFAKNVTQQQSDHVVDEDAMAIYPKLVARRVMRDFVGLESSDKSTRDAMMNFSYYLTIGNMDEAFKAIKLIKSESVWENMAKMCVKSRRLDVATVCLGNMGNARGAKALRESAKE-PELDARVAVLATQLGLYEDAERLLKNCKRYDLLNEFYQNSGQWEKAVETAEMYDRVHLRTTNFSYARHLEDLGETALAIQRFEKSETHRFEVPRMLGDEPEVLEQYIINSKDKKLRKWWAQYLESTGDMKNALQFYESAQDFFSVVRVFCYCEEMDRAAEVCNETGNEAACYYIAGQYENQGQIKEAIHFFQRAKAYGSAIRLCKEHDIEDQMMNLALMARPEEMMEAARYFEQKPNSQDKAVMLYHKAGNFSRATDLAFRNKEFGALQHISGDLDERADPELLQRCGDFFLENGQYDKAVDLLALGKKYWDALKICMEKHVEMTEELCEKLSPEK-DEN----------------ENNPDERNKILEAVAEVCMHQGAYHLATKKFTQAGNRIKAMKALLKSGDTQKIVFFAGVSRQKEIYIMAANYLQSLDWRKDPEIMKNIIGFYSKGRALDSLAGFYDACAQVEIDEYQNYDKAIGALGEAYKCMSKAKLQDESLQEERLGQIKHKMNIIKKFVQARRLYDEDPEEAVKMCQVIIGESDREGSIRLGDVYSFMIEHYARKERWKAAYAALEELKTKLPVVNPAY---YVDIKLIEAIHKALDIPLSRT--INTEK 1451          
BLAST of Intraflagellar transport protein 140 vs. TrEMBL
Match: A0A433TMG6 (WD_REPEATS_REGION domain-containing protein OS=Elysia chlorotica OX=188477 GN=EGW08_009501 PE=4 SV=1)

HSP 1 Score: 1171.76 bits (3030), Expect = 0.000e+0
Identity = 622/1582 (39.32%), Postives = 950/1582 (60.05%), Query Frame = 1
Query:   76 MAIYLTKQLNLDDVQI-LDIKFHQKLELLAISVIRESSHGHVIIANNKGEIFNSCKISKPQPISAILWHPSKAQLAVGWSDGQISLFDETQNVSNESLHLHCLPIASFAWSSHGSKLMSADIEGHLYAWKIDARGSFSQNPIFNFSANCPINCILLRMPKLKGSDVYDIRELAKAAVSGDERALDLMSWTKSS-SGIKLTGYSYMEVSNFFAGLGDGRVILINEDGKTTNITSLSGSVVRLLYHEERDVLIATTDIGMLTQHQLLSDGSSKEVMKVKLASRTPNPSLIWAGPSTLAISLGESMIRMWDIDREENYMLQPSEDMGYTKMG-LLSVVDYCASQRTIVAGSNKGQIVMWKMMGNEESYSKENPENRWCLQ-PATELHVNGQVSAGSIEKLVASSTNVIAAGTSSNIMYILEEKPMISAFYNGIVITQKGASELFIQLYSSCKESNDNKMFTNEPVLDEQYQETTEKKMECFTIAVEHLITLMDCTRENLIISDGKTVFVYELKLRSSDLASLCGQFESPTFILKIHQQNIYVSEKSQLQIRNFQGIIKQVVDLGNMDGKLSHIDINNNFMVCTTDKCCLRIYDLSRRDPKPIGIIKDFGECIPAVTMIASVSINCNGTVVSL-IVEKQKETDPKLYFWNIETDSIQYFNFSTGLGEQDDFTIKNSIXXXXXXXXXXXXXXXXXXXXXXNFIEQSDTPFSVTQSILYNDEDDENNETASDSDNENISLSPTVTNEHEDSLLLAKDVSSSLPVSHFWDKIDHRLIVVEIRSFDDKELNFNFTNISSIGEKVKKN--NRVLVSLFATQDDGILMFDNIICDEEYERLIGFDAPYYFFAIRNDIAYKKQAKDG---------LTCSFITPRVMRDFVGLEDSDGINKQALLNFSYYLTIGNMDEAFKSMKLIKSELVWRNMARMCVKTRRLDVATVCLGKMNYACAAMQLREARQNLPELDAKVAMLALHLDMKEEAIKLLEKSQRYDILNELYQAMEEWNKALDVAEKHDRIHLKTTYYNYAKYLEEEKRYSEALENFVKSGTHAFEVPRMLFNQPDELEKFIRERPEKALRKWWAQYMECCGEMKAALEFYAAAQDNFSLVRAYWLLGMEKKATEVCNDTGDRAACYHLARQFEATNNVDQAIHYYSRAKAYNSAIRLCKENKKDDHLVNLALLCKPEEQVEAASYLQTRNGYQDKAVILFHKAGQVSRAIDLACKTKQFGALQHISNDLSDKVHPDLLQKCASFFMENNQFDRAVDMLASSKQLWEALKLCVDYNVPMTEELAEKLSPPRLNENIEHTQTSISRINSSPHEYTEAERLRLLEGIAEIALSQRQYHLACKKFTQAGNQMMAMKSLLKSGDTEKIIRFANISKTKEVYVLAANYLQNLDWRRDPDIMKNIITFYTKGKALERLATFYEACSQSEIEEYQNYSKAIGALGEAYKYWSKMKFESENQKNVKLDSIRNKCTLMKKFLATIEMFETSPDEAIHQCQLLLDEPNIDVAIRYGDIYSHMIQYFIHQSKFKAAYACLDEMKRRIRNPSI-VTAYIDVATLEFLHKSLGIPFRQPSQIETEKKQFS 4770
            MA++   +LN DD  I +DI + Q   +LA+    E   G V + N +GE      I+     S+  WHP++  +AVGW  G+I+L++E      E+ HLH   I    WSS+GS+L+SAD  G +  WK D++G   Q+P +      P+  I+ + P        DI  LA+AAVSGDE ALD+ +W +   S I  + +   E  +FF G   G V  ++E G+     S+   V  LL+++E++VL+  T+  MLTQH +  +G +KE++KVK++ R+  P  IWAG   LA + GESMIRMWD+D+++NY+L      GY      +  + + +    +  G+N G + +WK      +  K + + +W LQ PAT   V G V     +   + S   +A  T +N+ Y+L E+ M  ++ +   + Q G   L ++++S+          T+  V  E              I V+ + T    T++ L + +GK V VY+     S +    G F +   ++ +++QN+Y  E++++Q+R FQG +KQ++     +G    +D+  +++V  TD   +R+YDLSRR+ KP    K+  E IP    + S  +NC G  VS+  V  + + D ++YFW++E D++QYFNF TG GEQDD+                                    P    +++   DE+D N+     +                     AKD++   PVS  WD  + +L V E  + +    + N  N  S+ + V +     +++SLF T ++GIL+ DN      +  L+G + PYY F  +++ + ++    G              +  ++MRDFVGLE SD   + A++NFS++L +GNMDEAFK++KLIKSE VW NMA+MCVK+RRLDVA+VCLG M +A  A  LREA +  PELDA+VA+LA+ L + E+A +LL   +RYD+LNE YQ   +W KAL+ AE +DRIHL+TT+Y+YA++LEE+   + A+ N+ KS TH FEVPRML + P++LE+++    +K L +WWAQYME  G+M+ A++FY  AQD FSLVR Y      +KA+ +CN+TGD+AACY+LARQ+E  + + +AIH++ RA+AY SAIRLCKE+  +D L+N AL+ +PE+ +EAA + +T+ G+QDKAV+L+HKAG  S+A+DLA  TKQFGALQ IS+DL ++  P+LLQ+CA FF+EN Q+D+AVD+LA  K+ WEA+K+C+D  V +TE+L+EKL+P +               +  P       RL++LE IAE+ + Q  YHLA KKFTQAGN++ AMK+LLKSGDTEKI+ FA +S+ +E+YV+AANYLQ+LDWR+DP++MKNII FYTKG+AL+ LA+FY+AC+Q EI+EYQNY KA+GALGEAYK  SK K +    +  +L +I++K  L+K+F+     ++ + +E+I QCQ+LL+E ++D A+R GDIY  MI+++  + ++KAA+A L+E++ R+  P I +  YI+  T+E + ++L +P  +    + + + F+
Sbjct:    1 MAVHFDHRLNTDDAGINIDIGWLQTSPILAVLSYSEDRGGTVSLFNEEGEKLQHKPIAHQSHPSSYAWHPTRKIIAVGWETGEITLWNEQDKELIEAAHLHRSEITVMQWSSNGSRLLSADNSGVIIGWKSDSKGRLGQDP-YQHHIQEPVTKIISK-PAPPPDPGMDIGSLARAAVSGDESALDMFNWKRGGKSKIASSPFGAQESLSFFVGGASGGVYFMSESGRCIQCFSVDAPVKELLFYDEKNVLVTITENLMLTQHAVFGEGDTKEILKVKMSGRSEKPMFIWAGKGILATATGESMIRMWDLDQDDNYILTLEGHSGYDSSNEAIMCLAFNSGTGVLAGGTNMGNVALWKYT-PPIAGRKVDGDEKWRLQAPAT---VEGPVR----QIKWSHSKGFMAVNTIANV-YVLCEQVMSYSYKDQTAVVQYGPGALSLEIFSAG---------THHDVKTE--------------IQVKGICT----TKDALAVWNGKRVIVYDFAPDKS-MVKAAGTFATEAMVIALYEQNVYTIEQNKVQVRTFQGTVKQLMTFAEPEGHPVSLDVCGSYLVVATDVGIIRVYDLSRREAKPHSNPKNLAEVIPGFGAVVSAKVNCAGNRVSIQAVTAEGKPDHRMYFWDVELDTVQYFNFETGRGEQDDYP----------------------------------APGGTQEAV---DEEDTNDAERGKTQ-------------------AAKDIAGRYPVSQHWDPAESKLFVCEAWNLNRSTADQNQRNKPSLTKIVDEGPVEVMVISLFCTPENGILIQDNFPLPSSFSSLMGVEVPYYIFTKKSESSVEEMENQGGPRVLSDPSTQPKLVARKIMRDFVGLESSDKGTRDAMMNFSFFLAVGNMDEAFKAIKLIKSESVWENMAKMCVKSRRLDVASVCLGNMGHARGAKALREAAKE-PELDARVAVLAMQLGLYEDAERLLRNCKRYDLLNEFYQNQGQWQKALETAEMYDRIHLRTTFYSYARHLEEQGDTTAAIPNYEKSETHKFEVPRMLADDPEQLEEYVSRTTDKTLHRWWAQYMESTGDMETAIQFYETAQDFFSLVRVYCYCSNMEKASSICNETGDKAACYYLARQYENQDEIKEAIHFFQRAQAYGSAIRLCKEHGFEDQLLNSALMGRPEDMMEAARHYETKQGFQDKAVMLYHKAGNYSKALDLAFTTKQFGALQLISSDLDERADPELLQRCADFFLENGQYDKAVDLLAIGKKFWEAVKICMDQTVEITEDLSEKLTPDK-------------DFDPDP-----MARLKILEAIAEVCMHQGAYHLATKKFTQAGNKIKAMKALLKSGDTEKIMFFAGVSRQREIYVMAANYLQSLDWRKDPEVMKNIIAFYTKGRALDALASFYDACAQVEIDEYQNYDKALGALGEAYKCMSKAKMDDSMLQEERLGAIKHKMALIKRFVMARRSYQENSEESIKQCQVLLEEQDLDAAVRIGDIYGFMIEHYASKERWKAAHAHLEELQSRM--PGIHLGYYINSKTVEAIFQALALPMDRSYASKAQDRAFN 1466          
BLAST of Intraflagellar transport protein 140 vs. TrEMBL
Match: A0A2C9JGU0 (WD_REPEATS_REGION domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106056245 PE=4 SV=1)

HSP 1 Score: 1169.84 bits (3025), Expect = 0.000e+0
Identity = 634/1543 (41.09%), Postives = 936/1543 (60.66%), Query Frame = 1
Query:  154 LLAISVIRESSHGHVIIANNKGEIFNSCKISKPQPISAILWHPSKAQLAVGWSDGQISLFDETQNVSNESLHLHCLPIASFAWSSHGSKLMSADIEGHLYAWKIDARGSFSQNPIFNFSANCPINCILLRMPKLKGSDVYDIRELAKAAVSGDERALDLMSWTKSSSGIKLTGYSYMEVSNFFAGLGDGRVILINEDGKTTNITSLSGSVVRLLYHEERDVLIATTDIGMLTQHQLLSDGSSKEVMKVKLASRTPNPSLIWAGPSTLAISLGESMIRMWDIDREENYMLQPSEDMGYTKMGLLSVVDYCASQRTIVAGSNKGQIVMWKMMGNEESYSKENPENRWCLQ-PATELHVNGQVSAGSIEKLVASST-NVIAAGTSSNIMYILEEKPMISAFYNGIVITQKGASELFIQLYSSCKESNDNKMFTNEPVLDEQYQETTEKKMECFTIAVEHLITLMDCTRENLIISDGKTVFVYELKLRSSDLASL--CGQFESPTFILKIHQQNIYVSEKSQLQIRNFQGIIKQVVDLGNMDGKLSHIDINNNFMVCTTDKCCLRIYDLSRRDPKPIGIIKDFGECIPAVTMIASVSINCNGTVVSL-IVEKQKETDPKLYFWNIETDSIQYFNFSTGLGEQDDFTIKNSIXXXXXXXXXXXXXXXXXXXXXXNFIEQSDTPFSVTQSILYNDEDDENNETASDSDNENISLSPTVTNEHEDSLLLAKDVSSSLPVSHFWDKIDHRLIVVE--IRSFDDKELNFNFTNISSIGEKVKKNNRVLVSLFATQDDGILMFDNIICDEEYERLIGFDAPYYFFAIR-----NDIAYKKQAKDGLTCSFITPR-----VMRDFVGLEDSDGINKQALLNFSYYLTIGNMDEAFKSMKLIKSELVWRNMARMCVKTRRLDVATVCLGKMNYACAAMQLREARQNLPELDAKVAMLALHLDMKEEAIKLLEKSQRYDILNELYQAMEEWNKALDVAEKHDRIHLKTTYYNYAKYLEEEKRYSEALENFVKSGTHAFEVPRMLFNQPDELEKFIRERPEKALRKWWAQYMECCGEMKAALEFYAAAQDNFSLVRAYWLLGMEKKATEVCNDTGDRAACYHLARQFEATNNVDQAIHYYSRAKAYNSAIRLCKENKKDDHLVNLALLCKPEEQVEAASYLQTRNGYQDKAVILFHKAGQVSRAIDLACKTKQFGALQHISNDLSDKVHPDLLQKCASFFMENNQFDRAVDMLASSKQLWEALKLCVDYNVPMTEELAEKLSPPRLNENIEHTQTSISRINSSPHEYTEAERLRLLEGIAEIALSQRQYHLACKKFTQAGNQMMAMKSLLKSGDTEKIIRFANISKTKEVYVLAANYLQNLDWRRDPDIMKNIITFYTKGKALERLATFYEACSQSEIEEYQNYSKAIGALGEAYKYWSKMKFESENQKNVKLDSIRNKCTLMKKFLATIEMFETSPDEAIHQCQLLLDEPNIDVAIRYGDIYSHMIQYFIHQSKFKAAYACLDEMKRRIRNPSI-VTAYIDVATLEFLHKSLGIPF 4728
            LLA+    E S G V++ N +GE      I+         WHPS+  LAVGW  G+IS++++      E+ HLH   +A  AWSS+G++L+SAD  G L  WK D++G   Q+P F      PI  I+L+ P   G    DI  LA+AAVSGDE ALD+ +W +       T +   E  +FF G   G +  +N+ GK     S+   V +LLY+EE+++L+  T+  +LTQH + ++G +KE+MKVKL+ RT NP  IWAG   LA   GE++IRMWD+++++NY+L    +  +    ++  + Y      +  G+N G I  WK   + ++ SK +   +W LQ PAT          G+I K+  SST  ++A  T +N+ YI+ EK M  ++ +   + Q G                 N +          ++  TE       I V+ + T    T+++L + +GK V +YE    +SD +SL   G F + + I+ +++QN+Y  E++++Q+R FQG +KQ++     +G    +D+  +F++  TD   LR+YDLSRR+ K     K+  + IP    I +  INC G  VS+ +++     D KLYFW++E D++QYFNF TG GEQDD+                                    P SVT     ND +D     A    N+                  AKD++   P S +WD  + +L V E  I S      +    +++ I E+      +++SLF T ++GIL+ DN      ++R++G + PYY+F ++     ND++      +  T +   PR     +M DFVGLE+SD   + A++NFS+YL IGNMDEAFK++KLIKSE VW NMA+MCVK+RRLDVA+VCLG M +A  A  LREA    PELDAKVA+LA+ L + E+A +LL+  +RYD+LNE YQ   EW KAL+ AE +DRIHL+TT+YNYA+YLEE+  +  A+ N+ KS T+ FE+PRML +  D+LE +I +  +K L +WWAQYME  G+M+ A+++Y  A+DNFSLVR Y       KA E+C+ T D AACY+LARQ+E    + +AI ++ +AKAY SAIRLCKE+  +D L+N AL+ +PE+ +EAA Y +T+ G + KAV+L+HKAG  S+A++LA  T+QF +LQ +S++L D+  P++LQKCA FF+EN+QFD+AVDMLA  K+ WEA+K+C+D  V +TE+LAEKL+P +                    ++  A RL+LLE IAE+ + Q  YHLA KKFTQAGN++ AMK+LLKSGDTEKI+ FA +S+ KE+YV+AANYLQ+LDWR++P+IMKNII FY KG+AL+ LA+FY+AC+Q EI+EYQNY KA+GALGEAYK  +K K +   Q+  KL+++++K TL+K+F      ++ +P+EAI QCQ+LL+E ++D A+R GDIY  +I++F  + ++KAA+  L+E++RR+  P I +  Y+ + T+E +H +L +P 
Sbjct:   29 LLAVLSYGEDSGGSVLLFNEEGERVPHKSINSQGHAKCHAWHPSRKILAVGWETGEISVWNDQDKELIEAPHLHHAEVACIAWSSNGTRLISADSSGALIGWKCDSKGHLGQDP-FQHHLQEPITEIILKPPP-PGDPSMDINSLARAAVSGDESALDMFNWKRGGKNKAPTPFGPQESLSFFIGGASGGLYFLNDQGKCIQCFSVDTPVRKLLYYEEKNMLLTITNNLILTQHIVFAEGETKEIMKVKLSGRTENPLFIWAGKGVLATVTGETVIRMWDMEQDDNYILSLEGNSSFDVNEIIVCLAYNKETGILAGGTNLGSIAFWKFSQHLQN-SKVDGSEKWTLQSPAT--------VEGAIRKIEWSSTKGLLAVNTIANV-YIMSEKVMSFSYRDQNAVVQFGP----------------NSISIEIFSSSLHHEIKTE-------IQVKGIYT----TKDSLAVWNGKKVIIYEF---TSDKSSLKTAGSFATESMIIVLYEQNVYSIEQNKVQVRTFQGTVKQLLTFAEPEGHPVSLDVCGSFLLVATDVGVLRVYDLSRREAKSHSNPKNLQDIIPGFGSIINAKINCAGNRVSIQVMQSNGSLDHKLYFWDVELDTVQYFNFETGRGEQDDY------------------------------------PSSVTTQENENDSND-----AERGKNQ-----------------AAKDIAGRYPNSMYWDITEPKLFVCEALILSNTVDSSDMKKPSLTKIVEQ-GPAEVMVISLFCTSENGILIQDNFPMPSYFQRMMGVEVPYYYFTLKGEAKHNDLSSYGGQVNPETGAVTYPRRVARKIMHDFVGLENSDKATRDAMMNFSFYLCIGNMDEAFKAIKLIKSESVWENMAKMCVKSRRLDVASVCLGNMGHARGAKALREAIAREPELDAKVAVLAIQLGLYEDAERLLKNCKRYDLLNEFYQNRGEWQKALETAEMYDRIHLRTTFYNYARYLEEQGDFQAAIPNYEKSETYKFEIPRMLLDDADQLELYISKSQDKTLNRWWAQYMESVGDMETAIQYYEKAEDNFSLVRVYSFCDKIDKAAEICDTTKDLAACYYLARQYENQGQIKEAIAFFQKAKAYGSAIRLCKEHGYEDQLLNSALVGRPEDIMEAARYYETKPGQESKAVMLYHKAGNYSKALELAFTTRQFDSLQQMSSELDDRADPEILQKCAEFFLENSQFDKAVDMLAIGKKYWEAIKICMDQTVEITEDLAEKLTPDK--------------------DFDNAARLKLLEAIAEVCMHQGAYHLATKKFTQAGNKIKAMKALLKSGDTEKIVFFAGVSRQKEIYVMAANYLQSLDWRKEPEIMKNIIAFYNKGRALDALASFYDACAQVEIDEYQNYDKALGALGEAYKCLTKAKMDDSMQQEEKLEALKHKMTLIKRFSTARRSYQENPEEAIKQCQVLLEEKDLDSAVRIGDIYGFIIEHFASKERWKAAHTYLEELQRRL--PGIHLGFYVSMKTIEAIHSALALPM 1448          
BLAST of Intraflagellar transport protein 140 vs. Ensembl Cavefish
Match: ift140 (intraflagellar transport 140 [Source:NCBI gene;Acc:103040823])

HSP 1 Score: 514.998 bits (1325), Expect = 9.288e-158
Identity = 268/600 (44.67%), Postives = 395/600 (65.83%), Query Frame = 1
Query: 2311 DVSSSLPVSHFWDKIDHRLIVVEIRSFDDKELNFNFTNISSIGEKVKKNNRVLVSLFATQDDGILMFDNIICDEEYERLIGFDAPYYFFAIR-------NDIAYKKQAKDGLTCSFITPRVMRDFVGLEDSDGINKQALLNFSYYLTIGNMDEAFKSMKLIKSELVWRNMARMCVKTRRLDVATVCLGKMNYACAAMQLREARQNLPELDAKVAMLALHLDMKEEAIKLLEKSQRYDILNELYQAMEEWNKALDVAEKHDRIHLKTTYYNYAKYLEEEKRYSEALENFVKSGTHAFEVPRMLFNQPDELEKFIRERPEKALRKWWAQYMECCGEMKAALEFYAAAQDNFSLVRAYWLLGMEKKATEVCNDTGDRAACYHLARQFEATNNVDQAIHYYSRAKAYNSAIRLCKENKKDDHLVNLALLCKPEEQVEAASYLQTRNGYQDKAVILFHKAGQVSRAIDLACKTKQFGALQHISNDLSDKVHPDLLQKCASFFMENNQFDRAVDMLASSKQLWEALKLCVDYNVPMTEELAEKLSPPRLNENIEHTQTSISRINSSPHEYTEAERLRLLEGIAEIALSQRQYHLACKKFTQAGNQM 4089
            +++   PVS FWD+ + RL V E    + +   F+  + S   EKV+    ++V+ F TQ+ G+L+ D        + L+G D PYY++  +       ND++    A    +   +  R +RDF+GLE  +   + A+LNFS+YLTIG+MDEAF+++KLIKSE VW NMARMCVK+RRLDVA VCLG M  A AA  LREA +  PEL+A++A+LA  L M E+A +L     R+D+LN+ YQA   W +A+++AE HDRIHL+TTYY+YA++LE     S AL  + +S TH FEVPRML      LE +I +  +K+L KWW  Y+E   +M++AL FY  AQD  S VR +  LG  +KA+E+ N+TG+RAA YH+ARQ+E    + Q++H+Y+RA+AYN+AIRLCKEN  D+ L+NLALL  PE+ ++ A Y + +  + D+AV+L+HKAG VS+A++LA  T+QF ALQ I+ DL++   P LL +C+ FF++++Q+ +AV++L ++K+  +AL+LC+D N+ +TE+LAE+++  R + ++                 TEAER  LLE IA+  + Q  YHLA KK+TQAG ++
Sbjct:  638 ELAGRYPVSQFWDQSEPRLFVCESLLVNSE---FHHVDQSHATEKVEV---LVVTFFVTQEHGLLLQDTHPKPPALQGLLGLDTPYYYYTCKPGEQDMDNDVSPSTPAAVRPSPHMVVRRALRDFIGLESCEKPTRDAMLNFSFYLTIGDMDEAFRAIKLIKSEAVWENMARMCVKSRRLDVARVCLGNMGNARAARALREAEKE-PELEARIAVLATQLGMLEDAERLYRSCGRFDLLNKFYQAAGRWQQAVEMAETHDRIHLRTTYYSYAQHLEAMGDKSLALTYYERSDTHRFEVPRMLMEDTLSLEIYINKMKDKSLYKWWGHYLESQSDMESALRFYDYAQDYLSQVRVHCYLGNIQKASEIANETGNRAASYHVARQYEGQEKISQSVHFYTRAQAYNNAIRLCKENNMDEQLMNLALLSNPEDMMDTACYYEEKGAHMDRAVMLYHKAGHVSKALELAFATEQFAALQLIAEDLNENSDPALLSRCSDFFIKHSQYQKAVELLVAAKKYHDALQLCLDQNLTITEDLAERMTVSRGSAHL-----------------TEAERKELLERIADSCMRQGNYHLATKKYTQAGKKI 1213          

HSP 2 Score: 327.405 bits (838), Expect = 7.885e-92
Identity = 218/768 (28.39%), Postives = 377/768 (49.09%), Query Frame = 1
Query:   76 MAIYLTKQLNLDDVQ--ILDIKFHQKLELLAISVIRESSHGHVIIANNKGEIFNSCKISKPQPISAILWHPSKAQLAVGWSDGQISLFDET---QNVSNESLHLHCLPIASFAWSSHGSKLMSADIEGHLYAWKIDARGSFSQNPIFNFSANCPIN-CILLRMPKLKGSDVYDIRELAKAAVSGDERALDLMSWTKSSSGIKLTGYSYMEVSNFFAGLGDGRVILINEDGKTTNITSLSGSVVRLLYHEERDVLIATTDIGMLTQHQLLSDGSSKEVMKVKLASRTPNPS-LIWAGPSTLAISLGESMIRMWDIDREENYMLQPSEDMGYTKMGLLSVVDYCASQRTIVAGSNKGQIVMWKMMGNEESYSKENPENRWCLQPATELHVNGQVSAGSIEKLVASSTNVIAAGTSSNIMYILEEKPMISAFYNGIVITQKGASELFIQLYSSCKESNDNKMFTNEPVLDEQYQETTEKKMECFTIAVEHLITLMDCTRENLIISDGKTVFVYEL---KLRSSDLASLCGQFESPTFILKIHQQNIYVSEKSQLQIRNFQGIIKQVVDLGNMDGKLSHIDINNNFMVCTTDKCCLRIYDLSRRDPKPIGIIKDFGECIPAVTMIASVSINCNGTVVS-LIVEKQKETDPKLYFWNIETDSIQYFNFST-----GLGEQDDFTIKNSIXXXXXXXXXXXXXXXXXXXXXXNFIEQSDTPFSVTQSILYNDEDDENNETASDSDNENISLSPTVTNEHEDSLLLAKDVSSSLP 2331
            MA+Y   ++   D       + +H    LLA++ I  +S G V +   +GE    C + +    + + WHP+K  LAVGW  G+  L       Q +  ++ H  C+ +    WS  G++L++ D  G L  WK+DARG    N +     N P+  CI    P  +     D+  LAKAAVSGDE ALD  +W KSS G  +      E    +A   DG V  +++ G++ ++ ++ G V ++ Y E R +L   TD  +L+Q  L  +G ++E+ KVKL+ R  + + ++W     L  + GE  IR+WD++R++NY+L   E++G+ K  LL+ V YCA++  + AG+N+G++ +W+M+    +  K + + +W LQ  TEL        G+I +L   S+  + A  SS+ + IL E  M S +   +   Q   ++L +  +S+     D  +                      T+  +  I  +   +E + + DG+ V VYE+    LRS+      G F+  +  L +H++NIY  E +++Q+R  QG +KQ++     +G    +D+  +++   TD   +R++DL+RR+ KP+   K+  E IP +  + SV  N +G  +S LI +     D ++YF+++E D++ +F+F T     GL + DD           ++     +           F +QS+    V +S+L N E    +++ +    E + ++  VT EH    LL +D     P
Sbjct:    1 MAVYFDHRVQAPDSSGSAALLAWHSSQPLLAVASINPASGGSVDVYLQQGEHVELCHVERGFSPALLRWHPTKPLLAVGWETGETLLLTHPHGEQTLLPQNTHTACITL--LEWSFSGARLVTGDEAGVLALWKVDARGRLHGNHVTKQQYNKPLTTCIFRPTPPTE-----DVAMLAKAAVSGDEDALDKFNWRKSSKGGGVWSPWSQEGLTIYASTADGCVYSVDDRGRSVSLLTVEGRVQKMFYSERRAMLAVVTDSLLLSQFSLGPEGGAQELSKVKLSGRGGHTADIVWMESGLLITASGEQHIRLWDLERDDNYILSLDENLGFEKGELLNCVSYCAAKDVLAAGTNRGRVALWQMV--TVTNQKADTKTQWKLQTPTELE-------GNITQLQWGSSLQLLAVCSSSSVLILSEHVMCSHYSQQVAAVQLTPAQLSLTYFST-----DTHL----------------------TLRTDTHIRAVQLAKETVTVWDGRCVTVYEVSGQSLRST------GSFQCDSVALAVHEENIYTVEPNRVQVRTPQGTVKQLLTFSEAEGNPIMLDVCGSYLAVGTDAAHVRVFDLTRREAKPLCNAKNMAELIPDLGALRSVKCNASGNQISILITQINGRPDHRVYFYDVEMDTLSHFDFFTGRPLSGLSQSDD-----------NQRSRDNELELAGRYPVSQFWDQSEPRLFVCESLLVNSEFHHVDQSHATEKVEVLVVTFFVTQEHG---LLLQDTHPKPP 705          
BLAST of Intraflagellar transport protein 140 vs. Ensembl Cavefish
Match: ift140 (intraflagellar transport 140 [Source:NCBI gene;Acc:103040823])

HSP 1 Score: 509.605 bits (1311), Expect = 1.277e-155
Identity = 268/612 (43.79%), Postives = 395/612 (64.54%), Query Frame = 1
Query: 2311 DVSSSLPVSHFWDKIDHRLIVVEIRSFDDKELNFNFTNISSIGEKVKKNNRVLVSLFATQDDGILMFDNIICDEEYERLIGFDAPYYFFAIR-------------------NDIAYKKQAKDGLTCSFITPRVMRDFVGLEDSDGINKQALLNFSYYLTIGNMDEAFKSMKLIKSELVWRNMARMCVKTRRLDVATVCLGKMNYACAAMQLREARQNLPELDAKVAMLALHLDMKEEAIKLLEKSQRYDILNELYQAMEEWNKALDVAEKHDRIHLKTTYYNYAKYLEEEKRYSEALENFVKSGTHAFEVPRMLFNQPDELEKFIRERPEKALRKWWAQYMECCGEMKAALEFYAAAQDNFSLVRAYWLLGMEKKATEVCNDTGDRAACYHLARQFEATNNVDQAIHYYSRAKAYNSAIRLCKENKKDDHLVNLALLCKPEEQVEAASYLQTRNGYQDKAVILFHKAGQVSRAIDLACKTKQFGALQHISNDLSDKVHPDLLQKCASFFMENNQFDRAVDMLASSKQLWEALKLCVDYNVPMTEELAEKLSPPRLNENIEHTQTSISRINSSPHEYTEAERLRLLEGIAEIALSQRQYHLACKKFTQAGNQM 4089
            +++   PVS FWD+ + RL V E    + +   F+  + S   EKV+    ++V+ F TQ+ G+L+ D        + L+G D PYY++  +                   ND++    A    +   +  R +RDF+GLE  +   + A+LNFS+YLTIG+MDEAF+++KLIKSE VW NMARMCVK+RRLDVA VCLG M  A AA  LREA +  PEL+A++A+LA  L M E+A +L     R+D+LN+ YQA   W +A+++AE HDRIHL+TTYY+YA++LE     S AL  + +S TH FEVPRML      LE +I +  +K+L KWW  Y+E   +M++AL FY  AQD  S VR +  LG  +KA+E+ N+TG+RAA YH+ARQ+E    + Q++H+Y+RA+AYN+AIRLCKEN  D+ L+NLALL  PE+ ++ A Y + +  + D+AV+L+HKAG VS+A++LA  T+QF ALQ I+ DL++   P LL +C+ FF++++Q+ +AV++L ++K+  +AL+LC+D N+ +TE+LAE+++  R + ++                 TEAER  LLE IA+  + Q  YHLA KK+TQAG ++
Sbjct:  638 ELAGRYPVSQFWDQSEPRLFVCESLLVNSE---FHHVDQSHATEKVEV---LVVTFFVTQEHGLLLQDTHPKPPALQGLLGLDTPYYYYTCKLLFRRGGVFLPDPGEQDMDNDVSPSTPAAVRPSPHMVVRRALRDFIGLESCEKPTRDAMLNFSFYLTIGDMDEAFRAIKLIKSEAVWENMARMCVKSRRLDVARVCLGNMGNARAARALREAEKE-PELEARIAVLATQLGMLEDAERLYRSCGRFDLLNKFYQAAGRWQQAVEMAETHDRIHLRTTYYSYAQHLEAMGDKSLALTYYERSDTHRFEVPRMLMEDTLSLEIYINKMKDKSLYKWWGHYLESQSDMESALRFYDYAQDYLSQVRVHCYLGNIQKASEIANETGNRAASYHVARQYEGQEKISQSVHFYTRAQAYNNAIRLCKENNMDEQLMNLALLSNPEDMMDTACYYEEKGAHMDRAVMLYHKAGHVSKALELAFATEQFAALQLIAEDLNENSDPALLSRCSDFFIKHSQYQKAVELLVAAKKYHDALQLCLDQNLTITEDLAERMTVSRGSAHL-----------------TEAERKELLERIADSCMRQGNYHLATKKYTQAGKKI 1225          

HSP 2 Score: 326.635 bits (836), Expect = 1.630e-91
Identity = 218/768 (28.39%), Postives = 377/768 (49.09%), Query Frame = 1
Query:   76 MAIYLTKQLNLDDVQ--ILDIKFHQKLELLAISVIRESSHGHVIIANNKGEIFNSCKISKPQPISAILWHPSKAQLAVGWSDGQISLFDET---QNVSNESLHLHCLPIASFAWSSHGSKLMSADIEGHLYAWKIDARGSFSQNPIFNFSANCPIN-CILLRMPKLKGSDVYDIRELAKAAVSGDERALDLMSWTKSSSGIKLTGYSYMEVSNFFAGLGDGRVILINEDGKTTNITSLSGSVVRLLYHEERDVLIATTDIGMLTQHQLLSDGSSKEVMKVKLASRTPNPS-LIWAGPSTLAISLGESMIRMWDIDREENYMLQPSEDMGYTKMGLLSVVDYCASQRTIVAGSNKGQIVMWKMMGNEESYSKENPENRWCLQPATELHVNGQVSAGSIEKLVASSTNVIAAGTSSNIMYILEEKPMISAFYNGIVITQKGASELFIQLYSSCKESNDNKMFTNEPVLDEQYQETTEKKMECFTIAVEHLITLMDCTRENLIISDGKTVFVYEL---KLRSSDLASLCGQFESPTFILKIHQQNIYVSEKSQLQIRNFQGIIKQVVDLGNMDGKLSHIDINNNFMVCTTDKCCLRIYDLSRRDPKPIGIIKDFGECIPAVTMIASVSINCNGTVVS-LIVEKQKETDPKLYFWNIETDSIQYFNFST-----GLGEQDDFTIKNSIXXXXXXXXXXXXXXXXXXXXXXNFIEQSDTPFSVTQSILYNDEDDENNETASDSDNENISLSPTVTNEHEDSLLLAKDVSSSLP 2331
            MA+Y   ++   D       + +H    LLA++ I  +S G V +   +GE    C + +    + + WHP+K  LAVGW  G+  L       Q +  ++ H  C+ +    WS  G++L++ D  G L  WK+DARG    N +     N P+  CI    P  +     D+  LAKAAVSGDE ALD  +W KSS G  +      E    +A   DG V  +++ G++ ++ ++ G V ++ Y E R +L   TD  +L+Q  L  +G ++E+ KVKL+ R  + + ++W     L  + GE  IR+WD++R++NY+L   E++G+ K  LL+ V YCA++  + AG+N+G++ +W+M+    +  K + + +W LQ  TEL        G+I +L   S+  + A  SS+ + IL E  M S +   +   Q   ++L +  +S+     D  +                      T+  +  I  +   +E + + DG+ V VYE+    LRS+      G F+  +  L +H++NIY  E +++Q+R  QG +KQ++     +G    +D+  +++   TD   +R++DL+RR+ KP+   K+  E IP +  + SV  N +G  +S LI +     D ++YF+++E D++ +F+F T     GL + DD           ++     +           F +QS+    V +S+L N E    +++ +    E + ++  VT EH    LL +D     P
Sbjct:    1 MAVYFDHRVQAPDSSGSAALLAWHSSQPLLAVASINPASGGSVDVYLQQGEHVELCHVERGFSPALLRWHPTKPLLAVGWETGETLLLTHPHGEQTLLPQNTHTACITL--LEWSFSGARLVTGDEAGVLALWKVDARGRLHGNHVTKQQYNKPLTTCIFRPTPPTE-----DVAMLAKAAVSGDEDALDKFNWRKSSKGGGVWSPWSQEGLTIYASTADGCVYSVDDRGRSVSLLTVEGRVQKMFYSERRAMLAVVTDSLLLSQFSLGPEGGAQELSKVKLSGRGGHTADIVWMESGLLITASGEQHIRLWDLERDDNYILSLDENLGFEKGELLNCVSYCAAKDVLAAGTNRGRVALWQMV--TVTNQKADTKTQWKLQTPTELE-------GNITQLQWGSSLQLLAVCSSSSVLILSEHVMCSHYSQQVAAVQLTPAQLSLTYFST-----DTHL----------------------TLRTDTHIRAVQLAKETVTVWDGRCVTVYEVSGQSLRST------GSFQCDSVALAVHEENIYTVEPNRVQVRTPQGTVKQLLTFSEAEGNPIMLDVCGSYLAVGTDAAHVRVFDLTRREAKPLCNAKNMAELIPDLGALRSVKCNASGNQISILITQINGRPDHRVYFYDVEMDTLSHFDFFTGRPLSGLSQSDD-----------NQRSRDNELELAGRYPVSQFWDQSEPRLFVCESLLVNSEFHHVDQSHATEKVEVLVVTFFVTQEHG---LLLQDTHPKPP 705          
BLAST of Intraflagellar transport protein 140 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010689.1 (pep scaffold:Pmarinus_7.0:GL477043:7942:58124:-1 gene:ENSPMAG00000009672.1 transcript:ENSPMAT00000010689.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1070.46 bits (2767), Expect = 0.000e+0
Identity = 600/1567 (38.29%), Postives = 922/1567 (58.84%), Query Frame = 1
Query:   76 MAIYLTKQLNL-DDVQILD-IKFHQKLELLAISVIRESSHGHVIIANNKGEIFNSCKISKPQPISAILWHPSKAQLAVGWSDGQISLFDETQNVSNESLHLHCLPIASFAWSSHGSKLMSADIEGHLYAWKIDARGSFSQNPIFNFSANCPINCILLRMPKLKGSDVYDIRELAKAAVSGDERALDLMSWTKSSSGIKLTGYSYMEVSNFFAGLGDGRVILINEDGKTTNITSLSGSVVRLLYHEERDVLIATTDIGMLTQHQLLSDGSSKEVMKVKLASRTPNPS-LIWAGPSTLAISLGESMIRMWDIDREENYMLQPSEDMGYTKMGLLSVVDYCASQRTIVAGSNKGQIVMWKMMGNEESYSKENPE--NRWCLQPATELHVNG-QVSAGSIEKLVASSTNVIAAGTSSNIMYILEEKPMISAFYNGIVITQKGASELFIQLYSSCKESNDNKMFTNEPVLDEQYQETTEKKMECFTIAVEHLITLMDCTRENLIISDGKTVFVYELKLRSSDLASLCGQFESPTFILKIHQQNIYVSEKSQLQIRNFQGIIKQVVDLGNMDGKLSHIDINNNFMVCTTDKCCLRIYDLSRRDPKPIGIIKDFGECIPAVTMIASVSINCNGTVVSLIVEKQKET-DPKLYFWNIETDSIQYFNFSTGLGEQDDFTIKNSIXXXXXXXXXXXXXXXXXXXXXXNFIEQSDTPFSVTQSILYNDEDDENNETASDSDNENISLSPTVTNEHEDSLLLAKDVSSSLPVSHFWDKIDHRLIVVE------IRSFDDKELNFNFTNISSIGEKVKKNNRVLVSLFATQDDGILMFDNIICDEEYERLIGFDAPYYFFAIR----NDIAYKKQAKDGLT--CSFITPRVMRDFVGLEDSDGINKQALLNFSYYLTIGNMDEAFKSMKLIKSELVWRNMARMCVKTRRLDVATVCLGKMNYACAAMQLREARQNLPELDAKVAMLALHLDMKEEAIKLLEKSQRYDILNELYQAMEEWNKALDVAEKHDRIHLKTTYYNYAKYLEEEKRYSEALENFVKSGTHAFEVPRMLFNQPDELEKFIRERPEKALRKWWAQYMECCGEMKAALEFYAAAQDNFSLVRAYWLLGMEKKATEVCNDTGDRAACYHLARQFEATNNVDQAIHYYSRAKAYNSAIRLCKENKKDDHLVNLALLCKPEEQVEAASYLQTRNGYQDKAVILFHKAGQVSRAIDLACKTKQFGALQHISNDLSDKVHPDLLQKCASFFMENNQFDRAVDMLASSKQLWEALKLCVDYNVPMTEELAEKLSPPRLNENIEHTQTSISRINSSPHEYTEAERLRLLEGIAEIALSQRQYHLACKKFTQAGNQMMAMKSLLKSGDTEKIIRFANISKTKEVYVLAANYLQNLDWRRDPDIMKNIITFYTKGKALERLATFYEACSQSEIEEYQNYSKAIGALGEAYKYWSKMKFESENQKNVKLDSIRNKCTLMKKFLATIEMFETSPDEAIHQCQLLLDEPNIDVAIRYGDIYSHMIQYFIHQSKFKAAYACLDEMKRRIRNPSIVTAYIDVATLEFLHKSLG 4719
            MA+Y  +++ L D+ Q    I +H    LLA++ +   + G V I   +GE      IS+    +A+ WHPS+  LAVGW  G++ ++ E    ++++  LH   IA   WSS+G++L+SAD +G +  W++D RG F  N  F       ++  + R     G    D+   A+AAV+GDE ALD+ +W KS+        +  E   FF    DG V  I++ G  + + S  G + ++++ E +DVL+  T+  +L+Q+ + SDGS +E+MKVKL+ +  + + ++WA    L  + GE +IR+WD++R+ENY+L   E +G+     ++ V YC S+  +  G+NKG+I MWK +     +S EN E  ++W LQ  TEL  N  Q+  GS + L+A   N +        + IL E+ M S F   +   Q   + L I  Y            ++ P                 ++  +  I  +  T++ + + +G  + +Y+L   S  +    G F S + ++ + +QN+Y  E +++Q+R  QG +KQ++    ++G    +DI  +F+   TD   +++YDLSRR+ K     K+  + IP +T + SV +N  G+ VS++V K   + DP++YF+++E D++ Y++ S G                                       +SDT               EN+E   D   E  SL+       ED  +L +      PVS +WD+++ RL V E      +   ++K+ N      S   E+ ++   V+V+LF +Q+ GIL+ D+    E +E L+G   PYY+F  +     D   + +   G +     +  R MRDFVGLE+ D   ++A+LNFSYYLT GNMDEAFKS+KLIKSE+VW NMARMCVKT+RLDVA VCLG M +A  A  LREA Q  PEL+A+VAMLAL L +K+EA +L +  +RYD+LN+ YQA  +W KA++ AE +DR+HL+TTYYN AKYLEE   +  A+  + KS TH FEVPRMLF     LE +I +  + +L KWWAQY+E  G M AAL+ Y +A D  SLVR Y  LG  +KA+E+ ++TG++AA YHLARQ+EA ++  QAI++Y+RA+A+N+AIRLCKE+K DD L+NLALL  PE+ ++ A Y +      D+AV+L+HKAG  S+A++LA  T+QFGALQ ++ +L +K  P LL +C+ FF+++  + +AV++L ++K+  EALKLC+ +++ +TEELAEK++ P+                    +Y +  R  +LE IA+  + Q  YHLA KK+TQAGN++ AM++LLKSGDTEKII FA +SK KE+Y++AANYLQ+LDW++DP+IMKNII+FYTKG+AL+ LA FY+AC+Q EI+EYQNY KA+GAL E YK  SK K  S  ++  KL  I++K  L+KKF+    +++    EAI  C++L++EP++D A+R GD+Y  MI+++  Q  ++AAY  ++ + ++    S+   +++  T+E +H +LG
Sbjct:    1 MAVYFDQKIKLHDETQTPSQISWHNINPLLAVTSV--GNGGSVAIFTQEGECSGDV-ISRAFLPTALAWHPSRPLLAVGWETGEVFVYHELDKETHKAQALHSADIALLQWSSNGTRLISADRDGLVICWRVDQRGKFHGNIFFKLELEKALSHCVFR----PGKSEDDLARFARAAVNGDESALDMFNWNKSNKPGSAASINSQEGIAFFLSSSDGLVYHIDDSGNHSQVLSCDGPIRKMMFAEGKDVLVIITESLVLSQYCVNSDGSVQEIMKVKLSGKAGHSADIVWADHGLLVTATGEIVIRLWDLERDENYVLALDEAVGFEPGETINCVSYCPSKGMLAGGTNKGRISMWKKIQPGSRFS-ENVESSDKWKLQTPTELTGNLIQIKWGSRKNLLA--VNAV------QYVAILSEQVMSSHFNQQVAAVQVAPTHLSIYFY-----------LSSTP----------------HSLKTDFHIRGIFVTQDLITVWNGSQITIYQL---SGAILQNTGSFFSESSVVAVVEQNVYTVEPNKVQVRTLQGTVKQLLQFSEVEGNPVFLDICGSFLAVGTDTAHIKVYDLSRREAKQQCGAKNLADVIPGLTTVTSVKVNYTGSHVSIMVNKADGSLDPRIYFYDVEMDTLHYYDLSNG---------------------------------------RSDT---------------ENDEIIQD---EEGSLN---RKRCEDKYMLGR-----YPVSQYWDQMEPRLFVCEAALPAAVSGPNNKDANLEPLLKSGACER-EQPEVVVVTLFCSQEHGILLQDSFARAEAHEALLGMQVPYYYFTRKAGKSEDDVEEAEGSQGPSNVPRMVARRPMRDFVGLEECDKQTREAMLNFSYYLTTGNMDEAFKSIKLIKSEVVWENMARMCVKTQRLDVARVCLGNMGHARGAKALREA-QKEPELEAQVAMLALQLGLKDEAEQLYKSCKRYDLLNQFYQATGQWQKAVETAETNDRVHLRTTYYNKAKYLEETGDFDAAITYYEKSETHKFEVPRMLFEDQHALENYINKNKDVSLLKWWAQYLESTGAMDAALKAYESAHDYLSLVRVYCFLGNTQKASEIASETGNKAASYHLARQYEAQDDFKQAINFYTRAQAFNNAIRLCKEHKLDDQLMNLALLSTPEDMMDTAQYYEENGNQMDRAVMLYHKAGHFSKALELAFATQQFGALQLVAEELDEKSDPALLARCSDFFIQHQHYSKAVELLVAAKKFHEALKLCLQHDLMITEELAEKMTLPK-----------------DSKQYQDDFRREILESIADCCMRQGNYHLATKKYTQAGNKIKAMRALLKSGDTEKIIFFAGVSKQKEIYIMAANYLQSLDWQKDPEIMKNIISFYTKGRALDLLAGFYDACAQVEIDEYQNYEKALGALTEGYKCMSKAKVRSSEEQQEKLSLIQSKINLVKKFVHARRVYQEDAPEAIKLCEVLVEEPDLDRAVRLGDVYGMMIEHYARQENYQAAYRLMEALSKKCTGVSL-QYFVNAQTIERVHHALG 1436          
BLAST of Intraflagellar transport protein 140 vs. Ensembl Nematostella
Match: EDO35505 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLF0])

HSP 1 Score: 769.615 bits (1986), Expect = 0.000e+0
Identity = 378/770 (49.09%), Postives = 528/770 (68.57%), Query Frame = 1
Query: 2311 DVSSSLPVSHFWDKIDHRLIVVE-IRSFDDKELNFNFTNISSIGEKVKKNNRVLVSLFATQDDGILMFDNIICDEEYERLIGFDAPYYFFAIRNDIAYKKQAKDGLTCS---FITPRVMRDFVGLEDSDGINKQALLNFSYYLTIGNMDEAFKSMKLIKSELVWRNMARMCVKTRRLDVATVCLGKMNYACAAMQLREARQNLPELDAKVAMLALHLDMKEEAIKLLEKSQRYDILNELYQAMEEWNKALDVAEKHDRIHLKTTYYNYAKYLEEEKRYSEALENFVKSGTHAFEVPRMLFNQPDELEKFIRERPEKALRKWWAQYMECCGEMKAALEFYAAAQDNFSLVRAYWLLGMEKKATEVCNDTGDRAACYHLARQFEATNNVDQAIHYYSRAKAYNSAIRLCKENKKDDHLVNLALLCKPEEQVEAASYLQTRNGYQDKAVILFHKAGQVSRAIDLACKTKQFGALQHISNDLSDKVHPDLLQKCASFFMENNQFDRAVDMLASSKQLWEALKLCVDYNVPMTEELAEKLSPPRLNENIEHTQTSISRINSSPHEYTEAERLRLLEGIAEIALSQRQYHLACKKFTQAGNQMMAMKSLLKSGDTEKIIRFANISKTKEVYVLAANYLQNLDWRRDPDIMKNIITFYTKGKALERLATFYEACSQSEIEEYQNYSKAIGALGEAYKYWSKMKFESENQKNVKLDSIRNKCTLMKKFLATIEMFETSPDEAIHQCQLLLDEPNIDVAIRYGDIYSHMIQYFIHQSKF 4608
            +++   PV+ +WD  + +L+V E +R  D  +      ++ S  +   +   ++VSLFAT + GIL+ DN   D  +  L+G + P+++   +  +     A           +T   MRDF GLE+++   K+A+++FSY   IGNMDEAFK++KLIKSE VW NMARMCVKT+RLDVATVCLG M  A AA  LRE+    PELDA+VA+LAL L MK+EA KL + SQR+D+LN+LYQA  +W KA++VAE HDRIHL+TTYYNYAK+LE     S A+ N+ KS TH FEVPRML + P +LE +I +  +K LRKWWAQYME   EM+ AL+FY AA+DN SLVR Y   G  +KA E+CN+TGDRAACYHLARQFE  +NV  AIH+Y+RA  Y++AIRL KE+  D+ L+NLALL   ++ ++ A Y +++   QDKAV+L+HK G +S+A++L   T+QF ALQ ++ DL +   P ++ KC++FFM++ Q+DRAVD+L   K+  +AL LC+ +NV +TEEL EK++ P+  EN                      R+ +LE IAE A+ Q  YHLA KK+TQAGN+M AMK+LLKSGDTEKI+ FA +S+ +E+YV+AANYLQ+LDWR+DP++MKNII FYTKG+AL+ LA FY+AC+Q EI+EYQNY KA+GAL EAYK  +K K ++   +  K+  ++ +   +KKF+     +E  P+E++  C +LL+EP+++ A+R GDIY  +I+++  Q  F
Sbjct:  428 EIAGRRPVAQYWDPTEPKLLVCETLRGGDSSKTPKRSMSLLSDDKDSAQGEVMIVSLFATPEHGILLQDNFPIDASHTSLMGVEVPFFYLMNKAPLPVMHGAVSPPPLPHHRMVTKHTMRDFTGLENANDEAKRAMMDFSYLSAIGNMDEAFKAIKLIKSESVWENMARMCVKTKRLDVATVCLGNMRNARAAKALRESADE-PELDARVAVLALQLGMKDEAEKLYKNSQRFDLLNQLYQASNQWTKAIEVAELHDRIHLRTTYYNYAKHLESMGNMSAAIVNYEKSDTHRFEVPRMLLDDPHQLEAYILKTKDKELRKWWAQYMESTSEMETALQFYEAARDNLSLVRVYCYCGNLEKAAEICNETGDRAACYHLARQFENQDNVKDAIHFYTRAHCYSNAIRLAKEHGLDNELMNLALLSTQQDMIDVARYYESQPNMQDKAVMLYHKGGNISKALELCFATQQFAALQVVAEDLDEHTDPVMIDKCSAFFMDHGQYDRAVDLLVVGKKFSDALDLCMRHNVVITEELGEKMTLPKGAEN----------------------RVTMLERIAECAMHQGSYHLATKKYTQAGNKMKAMKALLKSGDTEKIVFFAGVSRQREIYVMAANYLQSLDWRKDPEVMKNIIGFYTKGRALDSLAGFYDACAQVEIDEYQNYDKALGALTEAYKCMAKAKMKNATDQEEKVAFLKQRIGFVKKFVQARRSYEEDPEESVKLCHILLEEPDLETAVRVGDIYGLIIEHYARQQNF 1174          

HSP 2 Score: 208.764 bits (530), Expect = 1.931e-54
Identity = 131/442 (29.64%), Postives = 230/442 (52.04%), Query Frame = 1
Query:  724 VILINEDGKTTNITSLSGSVVRLLYHEERDVLIATTDIGMLTQHQLLSDGSSKEVMKVKLASRTPNPSLIWAGPSTLAISLGESMIRMWDIDREENYMLQPSEDMGYTKMGLLSVVDYCASQRTIVAGSNKGQIVMWKMMGNEESYSKENPENRWCLQPATELHVNGQVSAGSIEKLVASSTNVIAAGTSSNIMYILEEKPMISAFYNGIVITQKGASELFIQLYSSCKESNDNKMFTNEPVLDEQYQETTEKKMECFTIAVEHLITLMDCTRENLIISDGKTVFVYELKLRSSDLASLC--GQFESPTFILKIHQQNIYVSEKSQLQIRNFQGIIKQVVDLGNMDGKLSHIDINNNFMVCTTDKCCLRIYDLSRRDPKPIGIIKDFGECIPAVTMIASVSINCNGTVVSLIVEKQKET-DPKLYFWNIETDSIQYFNFSTG 2040
            V  I++ GK     ++ G V  LLY E RD+L+A TD  ML+QH +  DGS+ E +KVKL+ +     LIWAG   LA + GE+++RMW++++++NY L   +  G+     ++ + Y  S+  +   ++KG++ MWK    +    KE  E  W LQP + L   G+     IE   ASS N++A    + ++ IL E+ M + F   +   Q   S+L I+ +S+                   Y +  +  +    + V         T+ +  I +GK V  YE+   S D A +   G F S + ++ +++Q+++ +E  ++Q R FQG +KQ++     +G    +D+  NF+V  T +  ++ +D+SRR+ K     K+  E I  +  +  V  N +G+ +S+I +++  T D +LY W+ E+D++  F+F+TG
Sbjct:    3 VYHIDDRGKCFQRFTVEGPVKTLLYAEGRDMLVAVTDGLMLSQHTIAKDGSTTETIKVKLSGQASKSHLIWAGRQLLATATGENIVRMWNLEQDDNYFLS-LKGQGFEPGECINCISYNKSKDLLAGCTSKGKVAMWKHASPKVKGRKEEGEEMWELQPPSIL--EGEADLTQIE--WASSKNILAVNCIATVI-ILNEQVMKAHFNQQVAAVQVSPSQLTIENFSTA------------------YHQDLKTDIHIKGVFV---------TKSHTTIWNGKRVVTYEV---SPDKAMVRAEGSFSSDSPVVVVYEQSVFTAEPGKVQARTFQGTVKQILPFSEAEGDPVLLDLCGNFLVAGTSQGYVKCWDVSRREAKQHCTPKNLTEVIANLGRLKCVKCNSSGSKISIICDQENNTPDSRLYVWDCESDALHTFDFATG 408          
BLAST of Intraflagellar transport protein 140 vs. Ensembl Nematostella
Match: EDO35506 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLF1])

HSP 1 Score: 48.1358 bits (113), Expect = 8.414e-7
Identity = 30/91 (32.97%), Postives = 50/91 (54.95%), Query Frame = 1
Query:   76 MAIYLTKQLN--LDDVQILDIKFHQKLELLAISVIRESS-HGHVIIANNKGEIFNSCKISKPQPISAILWHPSKAQLAVGWSDGQISLFDE 339
            MA+Y   ++   L  VQ L + +H    LLA++   E   +G V +  ++GE+     I +   ++AI WHPS+  LAVGW  G + L+++
Sbjct:    1 MAVYFDHKIQAPLVGVQTL-LTWHSSYPLLAVASKTEPGVNGAVNLYLDEGELVEDSSIQRSCEVTAIKWHPSRKILAVGWQSGDLLLWND 90          
BLAST of Intraflagellar transport protein 140 vs. Ensembl Medaka
Match: ift140 (intraflagellar transport 140 [Source:NCBI gene;Acc:101163773])

HSP 1 Score: 699.893 bits (1805), Expect = 0.000e+0
Identity = 355/818 (43.40%), Postives = 531/818 (64.91%), Query Frame = 1
Query: 2311 DVSSSLPVSHFWDKIDHRLIVVEIRSFDDKELNFNFTNISSIGEKVKKNNRVLVSLFATQDDGILMFDNIICDEEYERLIGFDAPYYFFAIR-----------NDIAYKKQAKDGLTCSF---ITPRVMRDFVGLEDSDGINKQALLNFSYYLTIGNMDEAFKSMKLIKSELVWRNMARMCVKTRRLDVATVCLGKMNYACAAMQLREARQNLPELDAKVAMLALHLDMKEEAIKLLEKSQRYDILNELYQAMEEWNKALDVAEKHDRIHLKTTYYNYAKYLEEEKRYSEALENFVKSGTHAFEVPRMLFNQPDELEKFIRERPEKALRKWWAQYMECCGEMKAALEFYAAAQDNFSLVRAYWLLGMEKKATEVCNDTGDRAACYHLARQFEATNNVDQAIHYYSRAKAYNSAIRLCKENKKDDHLVNLALLCKPEEQVEAASYLQTRNGYQDKAVILFHKAGQVSRAIDLACKTKQFGALQHISNDLSDKVHPDLLQKCASFFMENNQFDRAVDMLASSKQLWEALKLCVDYNVPMTEELAEKLSPPRLNENIEHTQTSISRINSSPHEYTEAERLRLLEGIAEIALSQRQYHLACKKFTQAGNQMMAMKSLLKSGDTEKIIRFANISKTKEVYVLAANYLQNLDWRRDPDIMKNIITFYTKGKALERLATFYEACSQSEIEEYQNYSKAIGALGEAYKYWSKMKFESENQKNVKLDSIRNKCTLMKKFLATIEMFETSPDEAIHQCQLLLDEPNIDVAIRYGDIYSHMIQYFIHQSKFKAAYACLDEMKRRIRNPSIVTAYIDVATLEFLHKSLGI 4722
            +VS   PVSHFWD+ + RL   E      +  + +F +++ +          +V+LF TQ+DG+L+ D  +     + L+  D PYY+++ +           + ++++  +       F   ++ R ++DFVGLE  +   + A+LNFS+YLT G+MD+AF+S+KLIKS+ VW NMARMCVKTRRLDVA VCLG M  A AA  LREA+   PE +A+VAMLA+ L M E+A KL +  QR+D+LN  YQA  +W +AL+ AE HDRIHL+TTYYNYAK LE      +A+  + KS TH  EVPRML +    LE ++ ++ +K++ KWWAQY+E   +M AAL FY  AQD  SLVR +  +G  ++A+++ N TG+RAA YHLAR +E+ +++ QA+H+Y+RA+AYN+AIRLCKEN  DD L+NLALL  PE+ +EAA Y + +  + D+AV+L+HKAG VS+A++LA  T+QF ALQ I+ DL++   P LL +C+ FF+ ++Q+++A+++L ++K+  +AL+LC+ +N+ +T +LAE+++                   +   + ++  R  LLE IA+  + Q  YH+A KK++QA N++ AMK+LLKSGDTEK+I FAN+ + KE++++AANYLQ+L W  DP I+K II FY KGKAL  LA FYEAC+Q EI++YQNY KA+ AL EA+K  SK +  S  Q+  +L  +++K TL+KKF+    ++     EA   C+ LL EP +D  IR GD +  +I +   +   +AAY  L E+++ + +  I   YI   +L+ L   + +
Sbjct:  631 EVSGRYPVSHFWDESEPRLFACETVPVSSETSSESFLDMADVS---------VVTLFCTQEDGLLLHDYYLKPLGLQALLALDVPYYYYSCKPGEMDQGSTEASSLSHQTHSSKSKPSQFPHMVSRRPLKDFVGLESCEKATRDAMLNFSFYLTTGDMDKAFRSIKLIKSKAVWENMARMCVKTRRLDVAQVCLGNMGNARAAKALREAKAE-PEPEAQVAMLAIQLGMLEDAEKLYKSCQRFDLLNTFYQASGQWQQALETAEIHDRIHLRTTYYNYAKCLESMGDKMQAITFYEKSDTHRVEVPRMLQDDTSSLEVYVNKKKDKSIYKWWAQYLESQSKMDAALHFYELAQDYLSLVRVHCFMGSIQEASQIANATGNRAASYHLARYYESHDDLKQAVHFYTRAQAYNNAIRLCKENGLDDQLMNLALLSNPEDMMEAARYYEEKGSHMDRAVVLYHKAGHVSKALELAFSTEQFSALQQIAEDLNENSDPALLARCSDFFVSHSQYEKALELLVAAKKYHQALELCLSHNLTITNDLAERMTV------------------TDSKDLSKEARNELLERIADCCMRQGSYHMAAKKYSQAENRVKAMKALLKSGDTEKVIFFANLCRQKELFIMAANYLQSLAWHEDPKILKTIIQFYIKGKALALLAGFYEACAQVEIDDYQNYEKALDALTEAFKCLSKAEDTSGGQQATRLAELQHKITLIKKFIHMQRLYSEDAQEAALLCEALLQEPQLDPPIRIGDAFGFLIDHHCQKGNLEAAYHKLAELQKLLPSQKIA-CYISQTSLQALQSKMEV 1419          

HSP 2 Score: 323.553 bits (828), Expect = 7.338e-90
Identity = 204/661 (30.86%), Postives = 347/661 (52.50%), Query Frame = 1
Query:   76 MAIYLTKQLNL---DDVQILDIKFHQKLELLAISVIRESSHGHVIIANNKGEIFNSCKISKPQPISAILWHPSKAQLAVGWSDGQISLFDETQNVSNESLHLHCLPIASFAWSSHGSKLMSADIEGHLYAWKIDARGSFSQNPIFNFSANCPINCILLRMPKLKGSDVYDIRELAKAAVSGDERALDLMSWTKSSSGIKLTGYSYMEVSNFFAGLGDGRVILINEDGKTTNITSLSGSVVRLLYHEERDVLIATTDIGMLTQHQLLSDGSSKEVMKVKLASRT-PNPSLIWAGPSTLAISLGESMIRMWDIDREENYMLQPSEDMGYTKMGLLSVVDYCASQRTIVAGSNKGQIVMWKMMGNEESYSKENPENRWCLQPATELHVNGQVSAGSIEKLV-ASSTNVIAAGTSSNIMYILEEKPMISAFYNGIVITQKGASELFIQLYSSCKESNDNKMFTNEPVLDEQYQETTEKKMECFTIAVEHLITLMDCTRENLIISDGKTVFVYELKLRSSDLASLCGQFESPTFILKIHQQNIYVSEKSQLQIRNFQGIIKQVVDLGNMDGKLSHIDINNNFMVCTTDKCCLRIYDLSRRDPKPIGIIKDFGECIPAVTMIASVSINCNGTVVSLIVEK-QKETDPKLYFWNIETDSIQYFNFSTG 2040
            MA+Y   +++     DV    + +H  L +LA++    S+ G+V +   +GE   SC + +P   + + WHP K  LA+GW +G++ L             LH   I    WSS GS+L++ D  G L  WK+DARG    N +     N P+   L R P L G    D+ +LA+A+VSGDE ALD+ SW    + +K+      E   F+    DG+V  ++E GKT+ +  + GS+ +L++ ++R+VL   TD  ML+Q+ L  +G +++ MKVKL+S++  N  ++W   + L  + GE MIR+WD+DR++NY+L   E +G+ +  L++ V YC+++  + AG++ G+I MWK        S+ + + +W LQ  TE+        G++ +L    S N++AA  S  ++ IL E  M + F   +   Q   ++L I        SN    FT    L        +  M    + V         T++++I+ +GK + VYEL   S       G F   + ++ +H +N+Y  E ++LQIR  QG +KQ +     +G    +++  +++V  TD   ++++DLSRRD K     K+  + I  +  + SV  N +G+ +S+++ +     D K+YF++IE D++ +F+F TG
Sbjct:    1 MAVYFDHRIDAPENGDVPS-QLTWHSTLPVLAVASHSPSAGGNVDLYLQQGEHVESCHVERPHQPTVLHWHPLKPVLALGWENGEVVLLMHPSGDQTVLPSLHTASITLLEWSSSGSRLVTGDQTGVLAVWKVDARGRLQGNHLVKHEYNKPLTYCLFR-PALPG---IDVAKLARASVSGDENALDMFSW--KGAPLKM---GPQEGLVFYVSSADGKVHSVDEHGKTSPLLRVEGSIRKLVFVKKREVLAVITDSLMLSQYTLGPEGEAQDFMKVKLSSKSGQNVDIVWTENNLLITATGEHMIRLWDLDRDDNYILSLDETLGFDRGELINCVSYCSAKEILAAGTSNGRIAMWKKFS-----SRSDTKTQWKLQTPTEIE-------GNVTQLQWGCSLNLLAANNSKTVL-ILCEHLMSAHFSQQVAAVQLSPTQLSI--------SN----FTTGVHL------ALQSDMHIKGVCV---------TKDSVIVWNGKLINVYEL---SGTALHNTGSFLCDSHVVAVHDENLYTVEPNKLQIRTLQGTVKQHLYFSKAEGNPMLLNVCQSYLVVGTDTAHIQVFDLSRRDAKANCKTKNLADHIANLGALRSVKCNSSGSYISILISQVNGRLDHKVYFYDIEMDTLTHFDFFTG 608          
BLAST of Intraflagellar transport protein 140 vs. Ensembl Medaka
Match: ift140 (intraflagellar transport 140 [Source:NCBI gene;Acc:101163773])

HSP 1 Score: 699.123 bits (1803), Expect = 0.000e+0
Identity = 355/818 (43.40%), Postives = 531/818 (64.91%), Query Frame = 1
Query: 2311 DVSSSLPVSHFWDKIDHRLIVVEIRSFDDKELNFNFTNISSIGEKVKKNNRVLVSLFATQDDGILMFDNIICDEEYERLIGFDAPYYFFAIR-----------NDIAYKKQAKDGLTCSF---ITPRVMRDFVGLEDSDGINKQALLNFSYYLTIGNMDEAFKSMKLIKSELVWRNMARMCVKTRRLDVATVCLGKMNYACAAMQLREARQNLPELDAKVAMLALHLDMKEEAIKLLEKSQRYDILNELYQAMEEWNKALDVAEKHDRIHLKTTYYNYAKYLEEEKRYSEALENFVKSGTHAFEVPRMLFNQPDELEKFIRERPEKALRKWWAQYMECCGEMKAALEFYAAAQDNFSLVRAYWLLGMEKKATEVCNDTGDRAACYHLARQFEATNNVDQAIHYYSRAKAYNSAIRLCKENKKDDHLVNLALLCKPEEQVEAASYLQTRNGYQDKAVILFHKAGQVSRAIDLACKTKQFGALQHISNDLSDKVHPDLLQKCASFFMENNQFDRAVDMLASSKQLWEALKLCVDYNVPMTEELAEKLSPPRLNENIEHTQTSISRINSSPHEYTEAERLRLLEGIAEIALSQRQYHLACKKFTQAGNQMMAMKSLLKSGDTEKIIRFANISKTKEVYVLAANYLQNLDWRRDPDIMKNIITFYTKGKALERLATFYEACSQSEIEEYQNYSKAIGALGEAYKYWSKMKFESENQKNVKLDSIRNKCTLMKKFLATIEMFETSPDEAIHQCQLLLDEPNIDVAIRYGDIYSHMIQYFIHQSKFKAAYACLDEMKRRIRNPSIVTAYIDVATLEFLHKSLGI 4722
            +VS   PVSHFWD+ + RL   E      +  + +F +++ +          +V+LF TQ+DG+L+ D  +     + L+  D PYY+++ +           + ++++  +       F   ++ R ++DFVGLE  +   + A+LNFS+YLT G+MD+AF+S+KLIKS+ VW NMARMCVKTRRLDVA VCLG M  A AA  LREA+   PE +A+VAMLA+ L M E+A KL +  QR+D+LN  YQA  +W +AL+ AE HDRIHL+TTYYNYAK LE      +A+  + KS TH  EVPRML +    LE ++ ++ +K++ KWWAQY+E   +M AAL FY  AQD  SLVR +  +G  ++A+++ N TG+RAA YHLAR +E+ +++ QA+H+Y+RA+AYN+AIRLCKEN  DD L+NLALL  PE+ +EAA Y + +  + D+AV+L+HKAG VS+A++LA  T+QF ALQ I+ DL++   P LL +C+ FF+ ++Q+++A+++L ++K+  +AL+LC+ +N+ +T +LAE+++                   +   + ++  R  LLE IA+  + Q  YH+A KK++QA N++ AMK+LLKSGDTEK+I FAN+ + KE++++AANYLQ+L W  DP I+K II FY KGKAL  LA FYEAC+Q EI++YQNY KA+ AL EA+K  SK +  S  Q+  +L  +++K TL+KKF+    ++     EA   C+ LL EP +D  IR GD +  +I +   +   +AAY  L E+++ + +  I   YI   +L+ L   + +
Sbjct:  634 EVSGRYPVSHFWDESEPRLFACETVPVSSETSSESFLDMADVS---------VVTLFCTQEDGLLLHDYYLKPLGLQALLALDVPYYYYSCKPGEMDQGSTEASSLSHQTHSSKSKPSQFPHMVSRRPLKDFVGLESCEKATRDAMLNFSFYLTTGDMDKAFRSIKLIKSKAVWENMARMCVKTRRLDVAQVCLGNMGNARAAKALREAKAE-PEPEAQVAMLAIQLGMLEDAEKLYKSCQRFDLLNTFYQASGQWQQALETAEIHDRIHLRTTYYNYAKCLESMGDKMQAITFYEKSDTHRVEVPRMLQDDTSSLEVYVNKKKDKSIYKWWAQYLESQSKMDAALHFYELAQDYLSLVRVHCFMGSIQEASQIANATGNRAASYHLARYYESHDDLKQAVHFYTRAQAYNNAIRLCKENGLDDQLMNLALLSNPEDMMEAARYYEEKGSHMDRAVVLYHKAGHVSKALELAFSTEQFSALQQIAEDLNENSDPALLARCSDFFVSHSQYEKALELLVAAKKYHQALELCLSHNLTITNDLAERMTV------------------TDSKDLSKEARNELLERIADCCMRQGSYHMAAKKYSQAENRVKAMKALLKSGDTEKVIFFANLCRQKELFIMAANYLQSLAWHEDPKILKTIIQFYIKGKALALLAGFYEACAQVEIDDYQNYEKALDALTEAFKCLSKAEDTSGGQQATRLAELQHKITLIKKFIHMQRLYSEDAQEAALLCEALLQEPQLDPPIRIGDAFGFLIDHHCQKGNLEAAYHKLAELQKLLPSQKIA-CYISQTSLQALQSKMEV 1422          

HSP 2 Score: 316.235 bits (809), Expect = 1.812e-87
Identity = 193/618 (31.23%), Postives = 327/618 (52.91%), Query Frame = 1
Query:  196 VIIANNKGEIFNSCKISKPQPISAILWHPSKAQLAVGWSDGQISLFDETQNVSNESLHLHCLPIASFAWSSHGSKLMSADIEGHLYAWKIDARGSFSQNPIFNFSANCPINCILLRMPKLKGSDVYDIRELAKAAVSGDERALDLMSWTKSSSGIKLTGYSYMEVSNFFAGLGDGRVILINEDGKTTNITSLSGSVVRLLYHEERDVLIATTDIGMLTQHQLLSDGSSKEVMKVKLASRT-PNPSLIWAGPSTLAISLGESMIRMWDIDREENYMLQPSEDMGYTKMGLLSVVDYCASQRTIVAGSNKGQIVMWKMMGNEESYSKENPENRWCLQPATELHVNGQVSAGSIEKLV-ASSTNVIAAGTSSNIMYILEEKPMISAFYNGIVITQKGASELFIQLYSSCKESNDNKMFTNEPVLDEQYQETTEKKMECFTIAVEHLITLMDCTRENLIISDGKTVFVYELKLRSSDLASLCGQFESPTFILKIHQQNIYVSEKSQLQIRNFQGIIKQVVDLGNMDGKLSHIDINNNFMVCTTDKCCLRIYDLSRRDPKPIGIIKDFGECIPAVTMIASVSINCNGTVVSLIVEK-QKETDPKLYFWNIETDSIQYFNFSTG 2040
            V++ + +GE   SC + +P   + + WHP K  LA+GW +G++ L             LH   I    WSS GS+L++ D  G L  WK+DARG    N +     N P+   L R P L G    D+ +LA+A+VSGDE ALD+ SW    + +K+      E   F+    DG+V  ++E GKT+ +  + GS+ +L++ ++R+VL   TD  ML+Q+ L  +G +++ MKVKL+S++  N  ++W   + L  + GE MIR+WD+DR++NY+L   E +G+ +  L++ V YC+++  + AG++ G+I MWK        S+ + + +W LQ  TE+        G++ +L    S N++AA  S  ++ IL E  M + F   +   Q   ++L I        SN    FT    L        +  M    + V         T++++I+ +GK + VYEL   S       G F   + ++ +H +N+Y  E ++LQIR  QG +KQ +     +G    +++  +++V  TD   ++++DLSRRD K     K+  + I  +  + SV  N +G+ +S+++ +     D K+YF++IE D++ +F+F TG
Sbjct:   46 VVLVHVQGEHVESCHVERPHQPTVLHWHPLKPVLALGWENGEVVLLMHPSGDQTVLPSLHTASITLLEWSSSGSRLVTGDQTGVLAVWKVDARGRLQGNHLVKHEYNKPLTYCLFR-PALPG---IDVAKLARASVSGDENALDMFSW--KGAPLKM---GPQEGLVFYVSSADGKVHSVDEHGKTSPLLRVEGSIRKLVFVKKREVLAVITDSLMLSQYTLGPEGEAQDFMKVKLSSKSGQNVDIVWTENNLLITATGEHMIRLWDLDRDDNYILSLDETLGFDRGELINCVSYCSAKEILAAGTSNGRIAMWKKFS-----SRSDTKTQWKLQTPTEIE-------GNVTQLQWGCSLNLLAANNSKTVL-ILCEHLMSAHFSQQVAAVQLSPTQLSI--------SN----FTTGVHL------ALQSDMHIKGVCV---------TKDSVIVWNGKLINVYEL---SGTALHNTGSFLCDSHVVAVHDENLYTVEPNKLQIRTLQGTVKQHLYFSKAEGNPMLLNVCQSYLVVGTDTAHIQVFDLSRRDAKANCKTKNLADHIANLGALRSVKCNSSGSYISILISQVNGRLDHKVYFYDIEMDTLTHFDFFTG 611          
BLAST of Intraflagellar transport protein 140 vs. Ensembl Medaka
Match: ift140 (intraflagellar transport 140 [Source:NCBI gene;Acc:101163773])

HSP 1 Score: 659.062 bits (1699), Expect = 0.000e+0
Identity = 343/818 (41.93%), Postives = 512/818 (62.59%), Query Frame = 1
Query: 2311 DVSSSLPVSHFWDKIDHRLIVVEIRSFDDKELNFNFTNISSIGEKVKKNNRVLVSLFATQDDGILMFDNIICDEEYERLIGFDAPYYFFAIR-----------NDIAYKKQAKDGLTCSF---ITPRVMRDFVGLEDSDGINKQALLNFSYYLTIGNMDEAFKSMKLIKSELVWRNMARMCVKTRRLDVATVCLGKMNYACAAMQLREARQNLPELDAKVAMLALHLDMKEEAIKLLEKSQRYDILNELYQAMEEWNKALDVAEKHDRIHLKTTYYNYAKYLEEEKRYSEALENFVKSGTHAFEVPRMLFNQPDELEKFIRERPEKALRKWWAQYMECCGEMKAALEFYAAAQDNFSLVRAYWLLGMEKKATEVCNDTGDRAACYHLARQFEATNNVDQAIHYYSRAKAYNSAIRLCKENKKDDHLVNLALLCKPEEQVEAASYLQTRNGYQDKAVILFHKAGQVSRAIDLACKTKQFGALQHISNDLSDKVHPDLLQKCASFFMENNQFDRAVDMLASSKQLWEALKLCVDYNVPMTEELAEKLSPPRLNENIEHTQTSISRINSSPHEYTEAERLRLLEGIAEIALSQRQYHLACKKFTQAGNQMMAMKSLLKSGDTEKIIRFANISKTKEVYVLAANYLQNLDWRRDPDIMKNIITFYTKGKALERLATFYEACSQSEIEEYQNYSKAIGALGEAYKYWSKMKFESENQKNVKLDSIRNKCTLMKKFLATIEMFETSPDEAIHQCQLLLDEPNIDVAIRYGDIYSHMIQYFIHQSKFKAAYACLDEMKRRIRNPSIVTAYIDVATLEFLHKSLGI 4722
            +VS   PVSHFWD+ + RL   E      +  + +F +++ +          +V+LF TQ+DG+L+ D  +     + L+  D PYY+++ +           + ++++  +       F   ++ R ++DFVGLE  +   + A+LNFS+YLT G+MD+AF+S+KLIKS+ VW NMARMCVKTRRLDVA VCLG M  A AA  LREA+   PE +A+VAMLA+ L M E+A KL +  QR+D+LN  YQA  +W +AL+ AE HDRIHL+TTYYNYAK LE      +A+  + KS TH  EVPRML +    LE ++ ++ +K++ KWWAQY+E   +M AAL FY  AQD  SLVR +  +G  ++A+++ N TG+RAA YHLAR +E+ +++ QA+H+Y+RA+AYN+AIRLCKEN  DD L+NLALL  PE+ +EAA Y + +  + D+AV+L+HKAG VS+A++LA  T+QF ALQ I+ DL++   P LL +C+ FF+ ++Q+++A+++L ++K+  +AL+LC+ +N+ +T +LAE+++                   +   + ++  R  LLE IA+  + Q  YH+A KK++QA N++ AMK+LLKSGDTEK                      +L W  DP I+K II FY KGKAL  LA FYEAC+Q EI++YQNY KA+ AL EA+K  SK +  S  Q+  +L  +++K TL+KKF+    ++     EA   C+ LL EP +D  IR GD +  +I +   +   +AAY  L E+++ + +  I   YI   +L+ L   + +
Sbjct:  631 EVSGRYPVSHFWDESEPRLFACETVPVSSETSSESFLDMADVS---------VVTLFCTQEDGLLLHDYYLKPLGLQALLALDVPYYYYSCKPGEMDQGSTEASSLSHQTHSSKSKPSQFPHMVSRRPLKDFVGLESCEKATRDAMLNFSFYLTTGDMDKAFRSIKLIKSKAVWENMARMCVKTRRLDVAQVCLGNMGNARAAKALREAKAE-PEPEAQVAMLAIQLGMLEDAEKLYKSCQRFDLLNTFYQASGQWQQALETAEIHDRIHLRTTYYNYAKCLESMGDKMQAITFYEKSDTHRVEVPRMLQDDTSSLEVYVNKKKDKSIYKWWAQYLESQSKMDAALHFYELAQDYLSLVRVHCFMGSIQEASQIANATGNRAASYHLARYYESHDDLKQAVHFYTRAQAYNNAIRLCKENGLDDQLMNLALLSNPEDMMEAARYYEEKGSHMDRAVVLYHKAGHVSKALELAFSTEQFSALQQIAEDLNENSDPALLARCSDFFVSHSQYEKALELLVAAKKYHQALELCLSHNLTITNDLAERMTV------------------TDSKDLSKEARNELLERIADCCMRQGSYHMAAKKYSQAENRVKAMKALLKSGDTEK----------------------SLAWHEDPKILKTIIQFYIKGKALALLAGFYEACAQVEIDDYQNYEKALDALTEAFKCLSKAEDTSGGQQATRLAELQHKITLIKKFIHMQRLYSEDAQEAALLCEALLQEPQLDPPIRIGDAFGFLIDHHCQKGNLEAAYHKLAELQKLLPSQKIA-CYISQTSLQALQSKMEV 1397          

HSP 2 Score: 323.939 bits (829), Expect = 5.229e-90
Identity = 204/661 (30.86%), Postives = 347/661 (52.50%), Query Frame = 1
Query:   76 MAIYLTKQLNL---DDVQILDIKFHQKLELLAISVIRESSHGHVIIANNKGEIFNSCKISKPQPISAILWHPSKAQLAVGWSDGQISLFDETQNVSNESLHLHCLPIASFAWSSHGSKLMSADIEGHLYAWKIDARGSFSQNPIFNFSANCPINCILLRMPKLKGSDVYDIRELAKAAVSGDERALDLMSWTKSSSGIKLTGYSYMEVSNFFAGLGDGRVILINEDGKTTNITSLSGSVVRLLYHEERDVLIATTDIGMLTQHQLLSDGSSKEVMKVKLASRT-PNPSLIWAGPSTLAISLGESMIRMWDIDREENYMLQPSEDMGYTKMGLLSVVDYCASQRTIVAGSNKGQIVMWKMMGNEESYSKENPENRWCLQPATELHVNGQVSAGSIEKLV-ASSTNVIAAGTSSNIMYILEEKPMISAFYNGIVITQKGASELFIQLYSSCKESNDNKMFTNEPVLDEQYQETTEKKMECFTIAVEHLITLMDCTRENLIISDGKTVFVYELKLRSSDLASLCGQFESPTFILKIHQQNIYVSEKSQLQIRNFQGIIKQVVDLGNMDGKLSHIDINNNFMVCTTDKCCLRIYDLSRRDPKPIGIIKDFGECIPAVTMIASVSINCNGTVVSLIVEK-QKETDPKLYFWNIETDSIQYFNFSTG 2040
            MA+Y   +++     DV    + +H  L +LA++    S+ G+V +   +GE   SC + +P   + + WHP K  LA+GW +G++ L             LH   I    WSS GS+L++ D  G L  WK+DARG    N +     N P+   L R P L G    D+ +LA+A+VSGDE ALD+ SW    + +K+      E   F+    DG+V  ++E GKT+ +  + GS+ +L++ ++R+VL   TD  ML+Q+ L  +G +++ MKVKL+S++  N  ++W   + L  + GE MIR+WD+DR++NY+L   E +G+ +  L++ V YC+++  + AG++ G+I MWK        S+ + + +W LQ  TE+        G++ +L    S N++AA  S  ++ IL E  M + F   +   Q   ++L I        SN    FT    L        +  M    + V         T++++I+ +GK + VYEL   S       G F   + ++ +H +N+Y  E ++LQIR  QG +KQ +     +G    +++  +++V  TD   ++++DLSRRD K     K+  + I  +  + SV  N +G+ +S+++ +     D K+YF++IE D++ +F+F TG
Sbjct:    1 MAVYFDHRIDAPENGDVPS-QLTWHSTLPVLAVASHSPSAGGNVDLYLQQGEHVESCHVERPHQPTVLHWHPLKPVLALGWENGEVVLLMHPSGDQTVLPSLHTASITLLEWSSSGSRLVTGDQTGVLAVWKVDARGRLQGNHLVKHEYNKPLTYCLFR-PALPG---IDVAKLARASVSGDENALDMFSW--KGAPLKM---GPQEGLVFYVSSADGKVHSVDEHGKTSPLLRVEGSIRKLVFVKKREVLAVITDSLMLSQYTLGPEGEAQDFMKVKLSSKSGQNVDIVWTENNLLITATGEHMIRLWDLDRDDNYILSLDETLGFDRGELINCVSYCSAKEILAAGTSNGRIAMWKKFS-----SRSDTKTQWKLQTPTEIE-------GNVTQLQWGCSLNLLAANNSKTVL-ILCEHLMSAHFSQQVAAVQLSPTQLSI--------SN----FTTGVHL------ALQSDMHIKGVCV---------TKDSVIVWNGKLINVYEL---SGTALHNTGSFLCDSHVVAVHDENLYTVEPNKLQIRTLQGTVKQHLYFSKAEGNPMLLNVCQSYLVVGTDTAHIQVFDLSRRDAKANCKTKNLADHIANLGALRSVKCNSSGSYISILISQVNGRLDHKVYFYDIEMDTLTHFDFFTG 608          
BLAST of Intraflagellar transport protein 140 vs. Planmine SMEST
Match: SMESG000001316.1 (SMESG000001316.1)

HSP 1 Score: 3209.47 bits (8320), Expect = 0.000e+0
Identity = 1558/1567 (99.43%), Postives = 1563/1567 (99.74%), Query Frame = 1
Query:   76 MAIYLTKQLNLDDVQILDIKFHQKLELLAISVIRESSHGHVIIANNKGEIFNSCKISKPQPISAILWHPSKAQLAVGWSDGQISLFDETQNVSNESLHLHCLPIASFAWSSHGSKLMSADIEGHLYAWKIDARGSFSQNPIFNFSANCPINCILLRMPKLKGSDVYDIRELAKAAVSGDERALDLMSWTKSSSGIKLTGYSYMEVSNFFAGLGDGRVILINEDGKTTNITSLSGSVVRLLYHEERDVLIATTDIGMLTQHQLLSDGSSKEVMKVKLASRTPNPSLIWAGPSTLAISLGESMIRMWDIDREENYMLQPSEDMGYTKMGLLSVVDYCASQRTIVAGSNKGQIVMWKMMGNEESYSKENPENRWCLQPATELHVNGQVSAGSIEKLVASSTNVIAAGTSSNIMYILEEKPMISAFYNGIVITQKGASELFIQLYSSCKESNDNKMFTNEPVLDEQYQETTEKKMECFTIAVEHLITLMDCTRENLIISDGKTVFVYELKLRSSDLASLCGQFESPTFILKIHQQNIYVSEKSQLQIRNFQGIIKQVVDLGNMDGKLSHIDINNNFMVCTTDKCCLRIYDLSRRDPKPIGIIKDFGECIPAVTMIASVSINCNGTVVSLIVEKQKETDPKLYFWNIETDSIQYFNFSTGLGEQDDFTIKNSIXXXXXXXXXXXXXXXXXXXXXXNFIEQSDTPFSVTQSILYNDEDDENNETASDSDNENISLSPTVTNEHEDSLLLAKDVSSSLPVSHFWDKIDHRLIVVEIRSFDDKELNFNFTNISSIGEKVKKNNRVLVSLFATQDDGILMFDNIICDEEYERLIGFDAPYYFFAIRNDIAYKKQAKDGLTCSFITPRVMRDFVGLEDSDGINKQALLNFSYYLTIGNMDEAFKSMKLIKSELVWRNMARMCVKTRRLDVATVCLGKMNYACAAMQLREARQNLPELDAKVAMLALHLDMKEEAIKLLEKSQRYDILNELYQAMEEWNKALDVAEKHDRIHLKTTYYNYAKYLEEEKRYSEALENFVKSGTHAFEVPRMLFNQPDELEKFIRERPEKALRKWWAQYMECCGEMKAALEFYAAAQDNFSLVRAYWLLGMEKKATEVCNDTGDRAACYHLARQFEATNNVDQAIHYYSRAKAYNSAIRLCKENKKDDHLVNLALLCKPEEQVEAASYLQTRNGYQDKAVILFHKAGQVSRAIDLACKTKQFGALQHISNDLSDKVHPDLLQKCASFFMENNQFDRAVDMLASSKQLWEALKLCVDYNVPMTEELAEKLSPPRLNENIEHTQTSISRINSSPHEYTEAERLRLLEGIAEIALSQRQYHLACKKFTQAGNQMMAMKSLLKSGDTEKIIRFANISKTKEVYVLAANYLQNLDWRRDPDIMKNIITFYTKGKALERLATFYEACSQSEIEEYQNYSKAIGALGEAYKYWSKMKFESENQKNVKLDSIRNKCTLMKKFLATIEMFETSPDEAIHQCQLLLDEPNIDVAIRYGDIYSHMIQYFIHQSKFKAAYACLDEMKRRIRNPSIVTAYIDVATLEFLHKSLGIPFRQPSQIETEKKQFSDN 4776
            MAIYLTKQLNLDDVQILDIKFHQKLELLAISVIRESSHG+VIIANNKGEIFNSCKISKPQPISAILWHPSKAQLAVGWSDGQISLFDETQNVSNESLHLHCLPIASFAWSSHGSKLMSADIEGHLYAWKIDARGSFSQNPIFNFSANCPINCILLRMPKLKGSDVYDIRELAKAAVSGDERALDLMSWTKSSSGIKLTGYSYMEVSNFFAGLGDGRVILINEDGKTTNITSLSGSVVRLLYHEERDVLIATTDIGMLTQHQLLSDGSSKEVMKVKLASRTPNPSLIWAGPSTLAISLGESMIRMWDIDREENYMLQPSEDMGYTKMGLLSVVDYCASQRTIVAGSNKGQIVMWKMMGNEESYSKENPENRWCLQPATELHV+ QVSAGSIEKLVASSTNVIAAGTSSNIMYILEEKPMISAFYNGIVITQKGASELFIQLYSSCKESNDNKMFTNEPV DEQYQETTEKKMECFTIAVEHLITLMDCTRENLIISDGKTVFVYELKL+SSDLASLCGQF+SPTFILKIHQQNIYVSEKSQLQIRNFQGIIKQVVDLGNMDGKLSHIDINNNFMVCTTDKCCLRIYDLSRRDPKPIGIIKDFGECIPAVTMIASVSINCNGT+VSLIVEKQKETDPKLYFWNIETDSIQYFNFSTGLGEQDDFTIKNSIKTRDSRVKSSRKSVRQKNRRR NFIEQSDTPFSVTQSILYNDEDDENNETASDSDNENISLSPTVTNEHEDSLLLAKDVSSSLPVSHFWDKIDHRLIVVEIRSFDDKELNFNFTNISSIGEKVKKNNRVLVSLFATQDDGILMFDNIICDEEYERLIGFDAPYYFFAIRNDIAYKKQAKDGLTCSFITPRVMRDFVGLEDSDGINKQALLNFSYYLTIGNMDEAFKSMKLIKSELVWRNMARMCVKTRRLDVATVCLGKMNYACAAMQLREARQNLPELDAKVAMLALHLDMKEEAIKLLEKSQRYDILNELYQAMEEWNKALDVAEKHDRIHLKTTYYNYAKYLEEEKRYSEALENFVKSGTHAFEVPRMLFNQPDELEKFIRERPEKALRKWWAQYMECCGEMKAALEFYAAAQDNFSLVRAYWLLGMEKKATEVCNDTGDRAACYHLARQFEATNNVDQAIHYYSRAKAYNSAIRLCKENKKDDHLVNLALLCKPEEQVEAASYLQTRNGYQDKAVILFHKAGQVSRAIDLACKTKQFGALQHISNDLSDKVHPDLLQKCASFFMENNQFDRAVDMLASSKQLWEALKLCVDYNVPMTEELAEKLSPPRLNENIEHTQTSISRINSSPHEYTEAERLRLLEGIAEIALSQRQYHLACKKFTQAGNQMMAMKSLLKSGDTEKIIRFANISKTKEVYVLAANYLQNLDWRRDPDIMKNIITFYTKGKALERLATFYEACSQSEIEEYQNYSKAIGALGEAYKYWSKMKFESENQKNVKLDSIRNKCTLMKKFLATIEMFETSPDEAIHQCQLLLDEPNIDVAIRYGDIYSHMIQYFIHQSKFKAAYACLDEMKRRIRNPSIVTAYIDVAT EFLHKSLGIPFRQPSQIETEKKQFSDN
Sbjct:    1 MAIYLTKQLNLDDVQILDIKFHQKLELLAISVIRESSHGYVIIANNKGEIFNSCKISKPQPISAILWHPSKAQLAVGWSDGQISLFDETQNVSNESLHLHCLPIASFAWSSHGSKLMSADIEGHLYAWKIDARGSFSQNPIFNFSANCPINCILLRMPKLKGSDVYDIRELAKAAVSGDERALDLMSWTKSSSGIKLTGYSYMEVSNFFAGLGDGRVILINEDGKTTNITSLSGSVVRLLYHEERDVLIATTDIGMLTQHQLLSDGSSKEVMKVKLASRTPNPSLIWAGPSTLAISLGESMIRMWDIDREENYMLQPSEDMGYTKMGLLSVVDYCASQRTIVAGSNKGQIVMWKMMGNEESYSKENPENRWCLQPATELHVSEQVSAGSIEKLVASSTNVIAAGTSSNIMYILEEKPMISAFYNGIVITQKGASELFIQLYSSCKESNDNKMFTNEPVFDEQYQETTEKKMECFTIAVEHLITLMDCTRENLIISDGKTVFVYELKLKSSDLASLCGQFDSPTFILKIHQQNIYVSEKSQLQIRNFQGIIKQVVDLGNMDGKLSHIDINNNFMVCTTDKCCLRIYDLSRRDPKPIGIIKDFGECIPAVTMIASVSINCNGTIVSLIVEKQKETDPKLYFWNIETDSIQYFNFSTGLGEQDDFTIKNSIKTRDSRVKSSRKSVRQKNRRRHNFIEQSDTPFSVTQSILYNDEDDENNETASDSDNENISLSPTVTNEHEDSLLLAKDVSSSLPVSHFWDKIDHRLIVVEIRSFDDKELNFNFTNISSIGEKVKKNNRVLVSLFATQDDGILMFDNIICDEEYERLIGFDAPYYFFAIRNDIAYKKQAKDGLTCSFITPRVMRDFVGLEDSDGINKQALLNFSYYLTIGNMDEAFKSMKLIKSELVWRNMARMCVKTRRLDVATVCLGKMNYACAAMQLREARQNLPELDAKVAMLALHLDMKEEAIKLLEKSQRYDILNELYQAMEEWNKALDVAEKHDRIHLKTTYYNYAKYLEEEKRYSEALENFVKSGTHAFEVPRMLFNQPDELEKFIRERPEKALRKWWAQYMECCGEMKAALEFYAAAQDNFSLVRAYWLLGMEKKATEVCNDTGDRAACYHLARQFEATNNVDQAIHYYSRAKAYNSAIRLCKENKKDDHLVNLALLCKPEEQVEAASYLQTRNGYQDKAVILFHKAGQVSRAIDLACKTKQFGALQHISNDLSDKVHPDLLQKCASFFMENNQFDRAVDMLASSKQLWEALKLCVDYNVPMTEELAEKLSPPRLNENIEHTQTSISRINSSPHEYTEAERLRLLEGIAEIALSQRQYHLACKKFTQAGNQMMAMKSLLKSGDTEKIIRFANISKTKEVYVLAANYLQNLDWRRDPDIMKNIITFYTKGKALERLATFYEACSQSEIEEYQNYSKAIGALGEAYKYWSKMKFESENQKNVKLDSIRNKCTLMKKFLATIEMFETSPDEAIHQCQLLLDEPNIDVAIRYGDIYSHMIQYFIHQSKFKAAYACLDEMKRRIRNPSIVTAYIDVATFEFLHKSLGIPFRQPSQIETEKKQFSDN 1567          
The following BLAST results are available for this feature:
BLAST of Intraflagellar transport protein 140 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
IFT1402.571e-8944.46intraflagellar transport 140 [Source:HGNC Symbol;A... [more]
IFT1400.000e+047.85intraflagellar transport 140 [Source:HGNC Symbol;A... [more]
IFT1401.100e-1937.37intraflagellar transport 140 [Source:HGNC Symbol;A... [more]
IFT1402.233e-1028.33intraflagellar transport 140 [Source:HGNC Symbol;A... [more]
IFT1407.250e-927.68intraflagellar transport 140 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Intraflagellar transport protein 140 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
che-112.152e-15434.83pep chromosome:WBcel235:V:12144295:12150689:-1 gen... [more]
dyf-28.568e-924.45WD repeat-containing protein dyf-2 [Source:UniPro... [more]
dyf-21.676e-824.45WD repeat-containing protein dyf-2 [Source:UniPro... [more]
dyf-21.676e-824.45WD repeat-containing protein dyf-2 [Source:UniPro... [more]
back to top
BLAST of Intraflagellar transport protein 140 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rempA2.758e-14536.07gene:FBgn0260933 transcript:FBtr0303763[more]
rempA4.310e-14536.07gene:FBgn0260933 transcript:FBtr0078078[more]
back to top
BLAST of Intraflagellar transport protein 140 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ift1401.900e-8645.32intraflagellar transport 140 homolog (Chlamydomona... [more]
ift1401.900e-8645.32intraflagellar transport 140 homolog (Chlamydomona... [more]
BX294098.22.459e-8648.92intraflagellar transport 140 homolog (Chlamydomona... [more]
BX322565.10.000e+048.48intraflagellar transport 140 homolog (Chlamydomona... [more]
ift1408.939e-2147.47intraflagellar transport 140 homolog (Chlamydomona... [more]
back to top
BLAST of Intraflagellar transport protein 140 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ift1407.227e-8147.71intraflagellar transport 140 [Source:NCBI gene;Acc... [more]
ift1402.483e-8847.13intraflagellar transport 140 [Source:NCBI gene;Acc... [more]
ift1402.483e-7047.45intraflagellar transport 140 [Source:NCBI gene;Acc... [more]
ift1404.790e-8847.14intraflagellar transport 140 [Source:NCBI gene;Acc... [more]
ift1400.000e+049.07intraflagellar transport 140 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Intraflagellar transport protein 140 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Ift1409.910e-8746.97intraflagellar transport 140 [Source:MGI Symbol;Ac... [more]
Ift1401.169e-8647.87intraflagellar transport 140 [Source:MGI Symbol;Ac... [more]
Ift1402.525e-17647.47intraflagellar transport 140 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Intraflagellar transport protein 140 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|E9PY46|IF140_MOUSE6.932e-8646.97Intraflagellar transport protein 140 homolog OS=Mu... [more]
sp|Q96RY7|IF140_HUMAN1.235e-8844.46Intraflagellar transport protein 140 homolog OS=Ho... [more]
sp|G5ECZ4|DYF2_CAEEL1.090e-724.45WD repeat-containing protein dyf-2 OS=Caenorhabdit... [more]
back to top
BLAST of Intraflagellar transport protein 140 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1QP230.000e+041.06Uncharacterized protein OS=Crassostrea gigas OX=29... [more]
A0A210PX040.000e+040.99Intraflagellar transport protein 140 OS=Mizuhopect... [more]
V3ZMC60.000e+040.67Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A433TMG60.000e+039.32WD_REPEATS_REGION domain-containing protein OS=Ely... [more]
A0A2C9JGU00.000e+041.09WD_REPEATS_REGION domain-containing protein OS=Bio... [more]
back to top
BLAST of Intraflagellar transport protein 140 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ift1409.288e-15844.67intraflagellar transport 140 [Source:NCBI gene;Acc... [more]
ift1401.277e-15543.79intraflagellar transport 140 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Intraflagellar transport protein 140 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000010689.10.000e+038.29pep scaffold:Pmarinus_7.0:GL477043:7942:58124:-1 g... [more]
back to top
BLAST of Intraflagellar transport protein 140 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Intraflagellar transport protein 140 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO355051.931e-5449.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355068.414e-732.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Intraflagellar transport protein 140 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ift1407.338e-9043.40intraflagellar transport 140 [Source:NCBI gene;Acc... [more]
ift1401.812e-8743.40intraflagellar transport 140 [Source:NCBI gene;Acc... [more]
ift1405.229e-9041.93intraflagellar transport 140 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Intraflagellar transport protein 140 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000001316.10.000e+099.43SMESG000001316.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016654 ID=SMED30016654|Name=Intraflagellar transport protein 140|organism=Schmidtea mediterranea sexual|type=transcript|length=4921bp
ATTTGTTTTGTTGTTTTATTTAATTTTTAAACTTAGGTCAATAGTAAATT
TACATTAGTTACTATTATTTGAAAAATGGCAATATATTTAACGAAGCAAC
TTAATCTTGATGATGTTCAAATTCTTGACATTAAATTCCATCAGAAATTG
GAATTATTAGCTATTTCTGTTATCAGGGAGTCCTCACATGGCCATGTTAT
AATTGCAAACAATAAAGGTGAAATTTTTAATTCGTGTAAAATCAGCAAAC
CTCAGCCTATCTCTGCTATTCTGTGGCATCCATCTAAAGCTCAATTAGCC
GTTGGTTGGTCAGACGGTCAGATTTCGTTATTCGATGAAACTCAAAATGT
GTCAAATGAATCACTTCATCTGCATTGTTTACCGATAGCTTCATTTGCAT
GGTCAAGCCATGGATCTAAATTAATGTCAGCTGATATCGAAGGTCATCTT
TATGCTTGGAAAATAGATGCCAGGGGTAGTTTTTCTCAAAATCCTATTTT
CAATTTCAGTGCAAACTGCCCTATTAATTGTATCCTTTTGAGGATGCCTA
AATTAAAAGGCAGTGATGTCTATGACATCAGAGAATTGGCAAAAGCAGCA
GTTAGTGGAGACGAAAGAGCTTTGGATTTGATGAGTTGGACGAAAAGCTC
TAGTGGAATAAAATTGACGGGTTACAGCTACATGGAGGTTTCCAATTTCT
TTGCTGGTTTGGGCGATGGACGTGTAATTCTAATAAATGAGGATGGAAAA
ACTACCAATATTACATCATTGAGCGGATCTGTCGTTAGGCTTCTCTATCA
CGAAGAGAGGGATGTTCTCATAGCCACAACTGACATTGGTATGTTAACAC
AACATCAGCTATTATCAGATGGTAGCAGCAAAGAAGTTATGAAGGTAAAA
CTCGCAAGTAGAACTCCTAATCCATCTCTTATTTGGGCTGGACCGTCAAC
ACTAGCAATAAGTTTGGGAGAATCAATGATTCGAATGTGGGATATAGACA
GAGAGGAGAACTATATGTTACAACCCAGTGAAGATATGGGATACACAAAA
ATGGGTTTGCTATCCGTCGTAGATTACTGCGCATCACAAAGAACAATCGT
AGCTGGATCCAATAAAGGTCAAATTGTTATGTGGAAGATGATGGGTAACG
AGGAAAGTTATTCAAAAGAAAACCCAGAAAATCGGTGGTGTTTGCAGCCC
GCAACTGAACTTCATGTCAATGGGCAAGTATCGGCAGGTTCTATAGAAAA
GTTAGTGGCCAGCTCTACCAATGTAATTGCAGCAGGGACAAGTTCAAACA
TTATGTACATTTTAGAAGAGAAACCAATGATTTCAGCTTTTTACAATGGA
ATTGTAATAACTCAAAAAGGCGCAAGCGAATTATTTATTCAATTGTACAG
TAGTTGTAAGGAGTCAAATGACAATAAGATGTTCACAAATGAGCCTGTTC
TTGATGAGCAGTATCAAGAAACAACAGAAAAGAAAATGGAATGCTTTACG
ATTGCCGTGGAACATTTAATTACATTGATGGATTGTACAAGAGAAAATCT
TATAATATCCGATGGGAAAACAGTATTTGTTTACGAGCTGAAATTAAGAT
CTTCAGATTTAGCTTCTCTTTGTGGTCAATTTGAAAGCCCGACCTTTATC
CTGAAAATTCACCAGCAGAACATTTATGTGTCTGAAAAATCTCAATTGCA
AATAAGAAACTTTCAAGGAATCATTAAGCAAGTGGTAGACTTAGGTAATA
TGGATGGGAAATTGTCACATATAGATATCAATAATAATTTCATGGTTTGT
ACCACTGATAAATGCTGCTTGAGGATATATGATTTGTCCAGGCGAGATCC
AAAACCAATAGGAATTATTAAAGACTTCGGTGAATGCATTCCAGCTGTAA
CGATGATAGCGTCAGTTTCCATTAACTGCAATGGCACGGTTGTGAGTTTA
ATAGTTGAAAAACAAAAAGAAACAGATCCAAAACTATATTTCTGGAATAT
CGAAACTGATTCCATTCAGTATTTTAATTTTTCAACCGGACTTGGCGAAC
AGGATGATTTTACCATAAAAAACTCGATAAAAACAAGAGATTCTAGAGTT
AAAAGTAGTCGAAAGTCAGTTAGACAAAAGAATCGACGTCGACGCAATTT
CATCGAGCAAAGTGACACTCCGTTCTCTGTAACACAATCAATTCTATACA
ACGATGAAGACGATGAGAATAATGAAACAGCTAGTGATTCAGATAATGAA
AATATCAGTCTATCTCCAACAGTAACAAATGAACATGAAGATTCGCTATT
ATTAGCTAAAGATGTATCTAGCTCATTACCCGTTTCTCATTTTTGGGATA
AAATAGATCATCGGTTGATCGTTGTTGAGATTAGAAGTTTTGATGATAAA
GAGCTAAATTTTAATTTCACAAACATTTCCAGCATTGGTGAGAAAGTAAA
AAAAAACAACCGAGTGCTGGTTTCTCTATTTGCCACTCAAGATGACGGCA
TTTTAATGTTTGATAACATTATATGCGACGAAGAATATGAAAGATTAATT
GGTTTTGATGCACCCTATTATTTTTTTGCGATAAGGAATGACATAGCTTA
TAAAAAACAAGCCAAAGATGGATTGACTTGTAGCTTTATAACTCCTCGAG
TTATGCGGGATTTTGTTGGATTAGAGGATTCCGATGGAATAAACAAACAA
GCTCTGTTGAATTTCAGTTATTATTTAACTATTGGAAACATGGATGAGGC
TTTCAAGTCAATGAAACTCATTAAAAGCGAATTAGTTTGGAGGAATATGG
CGCGAATGTGCGTTAAAACTAGGAGACTTGATGTTGCTACTGTTTGTTTG
GGTAAAATGAATTATGCTTGTGCTGCCATGCAGTTGCGCGAAGCTCGACA
AAATTTACCCGAATTAGATGCCAAAGTAGCAATGTTAGCTTTACATCTGG
ATATGAAAGAAGAAGCTATTAAATTGTTGGAAAAATCTCAAAGATATGAC
ATCCTAAATGAACTTTATCAAGCAATGGAAGAATGGAACAAAGCTTTGGA
TGTTGCTGAAAAACATGACAGAATTCACTTAAAAACCACTTATTATAATT
ATGCAAAATATCTTGAGGAAGAAAAACGCTACTCAGAAGCTTTAGAAAAT
TTCGTTAAATCTGGAACTCATGCTTTTGAAGTTCCAAGAATGCTATTTAA
TCAGCCTGATGAGTTGGAAAAATTTATTCGAGAAAGACCAGAAAAAGCTT
TAAGGAAATGGTGGGCTCAATATATGGAGTGTTGCGGAGAAATGAAAGCA
GCATTGGAATTTTACGCTGCTGCCCAGGATAATTTTTCTTTAGTACGTGC
TTATTGGCTTTTGGGAATGGAAAAGAAAGCAACTGAAGTTTGCAATGATA
CTGGAGATAGAGCAGCTTGTTATCATTTAGCGAGGCAGTTCGAAGCTACT
AATAATGTTGATCAAGCCATCCATTATTACAGCAGAGCAAAGGCATATAA
TAGCGCCATTCGTTTGTGTAAAGAAAATAAAAAAGATGATCATCTCGTTA
ATTTGGCGTTGCTTTGTAAACCAGAAGAGCAAGTAGAAGCTGCTTCTTAT
CTTCAAACTCGCAATGGTTATCAGGACAAAGCTGTAATTTTATTTCACAA
AGCTGGACAGGTCAGTCGTGCAATAGACCTTGCATGCAAAACCAAACAAT
TTGGTGCTTTACAACACATTTCAAATGACTTATCAGACAAAGTTCATCCG
GATCTTTTGCAAAAATGTGCATCATTTTTCATGGAAAACAATCAGTTTGA
CAGGGCGGTTGACATGCTGGCGTCAAGCAAACAATTATGGGAAGCATTGA
AATTATGCGTGGATTATAATGTTCCAATGACTGAAGAATTGGCTGAAAAG
CTGTCACCTCCGAGATTAAATGAAAATATTGAACATACACAAACATCAAT
ATCAAGAATTAATTCTAGTCCTCATGAATACACAGAAGCAGAAAGATTGC
GTCTTCTAGAAGGAATTGCTGAAATAGCTCTCAGTCAACGGCAATATCAT
CTGGCTTGTAAGAAATTCACTCAAGCAGGAAATCAAATGATGGCCATGAA
ATCATTGCTTAAATCTGGAGACACAGAGAAAATCATACGATTTGCCAATA
TTTCCAAGACAAAAGAAGTGTACGTATTAGCGGCAAACTACCTTCAAAAT
CTAGACTGGCGAAGGGATCCTGATATTATGAAAAATATTATCACTTTTTA
TACCAAAGGCAAAGCTTTAGAGCGCCTGGCTACATTTTACGAGGCTTGTT
CTCAGAGTGAAATTGAAGAATATCAAAACTATTCCAAAGCCATCGGAGCT
TTGGGAGAAGCATATAAATACTGGAGTAAGATGAAATTTGAATCAGAAAA
CCAGAAAAATGTGAAATTAGATTCCATCAGAAATAAGTGTACATTAATGA
AAAAGTTTCTGGCAACAATTGAAATGTTTGAAACTTCTCCAGATGAAGCT
ATTCACCAGTGCCAGCTGCTCTTGGATGAGCCCAACATTGACGTGGCTAT
TAGATATGGAGATATCTATTCTCACATGATTCAATACTTTATTCACCAAA
GCAAATTTAAAGCAGCATATGCTTGTTTGGATGAGATGAAGAGACGGATC
AGAAATCCCAGTATCGTGACAGCATACATTGACGTAGCCACATTGGAATT
CCTTCACAAATCCCTCGGAATTCCATTCCGTCAGCCTTCTCAAATCGAAA
CTGAAAAAAAACAATTTTCTGACAATGAAGATGATATAATAGACGATGGA
ATAACCGCAGCAATAGACGAAGACTGACATGTCTTATGCATCCAATGCTC
TGTATTAAAATAAAGATAACTTTTATATCCAAATAAAGAGAAAAATCTTG
TTAAATTTGTATTGATTAGTG
back to top

protein sequence of SMED30016654-orf-1

>SMED30016654-orf-1 ID=SMED30016654-orf-1|Name=SMED30016654-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1584bp
MAIYLTKQLNLDDVQILDIKFHQKLELLAISVIRESSHGHVIIANNKGEI
FNSCKISKPQPISAILWHPSKAQLAVGWSDGQISLFDETQNVSNESLHLH
CLPIASFAWSSHGSKLMSADIEGHLYAWKIDARGSFSQNPIFNFSANCPI
NCILLRMPKLKGSDVYDIRELAKAAVSGDERALDLMSWTKSSSGIKLTGY
SYMEVSNFFAGLGDGRVILINEDGKTTNITSLSGSVVRLLYHEERDVLIA
TTDIGMLTQHQLLSDGSSKEVMKVKLASRTPNPSLIWAGPSTLAISLGES
MIRMWDIDREENYMLQPSEDMGYTKMGLLSVVDYCASQRTIVAGSNKGQI
VMWKMMGNEESYSKENPENRWCLQPATELHVNGQVSAGSIEKLVASSTNV
IAAGTSSNIMYILEEKPMISAFYNGIVITQKGASELFIQLYSSCKESNDN
KMFTNEPVLDEQYQETTEKKMECFTIAVEHLITLMDCTRENLIISDGKTV
FVYELKLRSSDLASLCGQFESPTFILKIHQQNIYVSEKSQLQIRNFQGII
KQVVDLGNMDGKLSHIDINNNFMVCTTDKCCLRIYDLSRRDPKPIGIIKD
FGECIPAVTMIASVSINCNGTVVSLIVEKQKETDPKLYFWNIETDSIQYF
NFSTGLGEQDDFTIKNSIKTRDSRVKSSRKSVRQKNRRRRNFIEQSDTPF
SVTQSILYNDEDDENNETASDSDNENISLSPTVTNEHEDSLLLAKDVSSS
LPVSHFWDKIDHRLIVVEIRSFDDKELNFNFTNISSIGEKVKKNNRVLVS
LFATQDDGILMFDNIICDEEYERLIGFDAPYYFFAIRNDIAYKKQAKDGL
TCSFITPRVMRDFVGLEDSDGINKQALLNFSYYLTIGNMDEAFKSMKLIK
SELVWRNMARMCVKTRRLDVATVCLGKMNYACAAMQLREARQNLPELDAK
VAMLALHLDMKEEAIKLLEKSQRYDILNELYQAMEEWNKALDVAEKHDRI
HLKTTYYNYAKYLEEEKRYSEALENFVKSGTHAFEVPRMLFNQPDELEKF
IRERPEKALRKWWAQYMECCGEMKAALEFYAAAQDNFSLVRAYWLLGMEK
KATEVCNDTGDRAACYHLARQFEATNNVDQAIHYYSRAKAYNSAIRLCKE
NKKDDHLVNLALLCKPEEQVEAASYLQTRNGYQDKAVILFHKAGQVSRAI
DLACKTKQFGALQHISNDLSDKVHPDLLQKCASFFMENNQFDRAVDMLAS
SKQLWEALKLCVDYNVPMTEELAEKLSPPRLNENIEHTQTSISRINSSPH
EYTEAERLRLLEGIAEIALSQRQYHLACKKFTQAGNQMMAMKSLLKSGDT
EKIIRFANISKTKEVYVLAANYLQNLDWRRDPDIMKNIITFYTKGKALER
LATFYEACSQSEIEEYQNYSKAIGALGEAYKYWSKMKFESENQKNVKLDS
IRNKCTLMKKFLATIEMFETSPDEAIHQCQLLLDEPNIDVAIRYGDIYSH
MIQYFIHQSKFKAAYACLDEMKRRIRNPSIVTAYIDVATLEFLHKSLGIP
FRQPSQIETEKKQFSDNEDDIIDDGITAAIDED*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR001148CA_dom
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0031514motile cilium
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 977..997
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 675..694
NoneNo IPR availablePANTHERPTHR15722IFT140/172-RELATEDcoord: 1..1569
NoneNo IPR availablePANTHERPTHR15722:SF7INTRAFLAGELLAR TRANSPORT PROTEIN 140 HOMOLOGcoord: 1..1569
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 90..129
e-value: 1.2
score: 16.5
coord: 308..354
e-value: 220.0
score: 2.2
coord: 47..87
e-value: 2.2
score: 14.9
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 55..138
score: 10.997
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 54..647
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 207..419