55 kDa erythrocyte membrane protein

Overview
Name55 kDa erythrocyte membrane protein
Smed IDSMED30016632
Length (bp)1800
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 55 kDa erythrocyte membrane protein (SMED30016632) t-SNE clustered cells

Violin plots show distribution of expression levels for 55 kDa erythrocyte membrane protein (SMED30016632) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 55 kDa erythrocyte membrane protein (SMED30016632) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 55 kDa erythrocyte membrane protein (SMED30016632) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016632

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30016632SMESG000017603.1 dd_Smed_v4_7653_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30016632SMESG000017603.1 dd_Smed_v6_7653_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30016632SMESG000017603.1 OX_Smed_1.0.02355ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30016632SMESG000017603.1 dd_Smed_v4_7653_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Human
Match: DLG2 (discs large MAGUK scaffold protein 2 [Source:HGNC Symbol;Acc:HGNC:2901])

HSP 1 Score: 145.206 bits (365), Expect = 6.359e-38
Identity = 117/368 (31.79%), Postives = 198/368 (53.80%), Query Frame = 1
Query:  355 MNHTQQNSYITV-DNKVQTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRKPMEKSICGTDLENNFTNPYEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSP-TWVAAEDQ 1452
            MNH+  +   ++  N+ ++ Y+R +  Y+ S D GLP +GL FK GD+L VINA+D +WWQA  +                    G+IPS  RV+ K R + + V+F+++  VI   G      I   G   +  K ++  +++    E S  G   + +    YE + +Q I  TRP++++GP KD++ + L+ E+ D + + +PHTTRP R  E DG DYHF+ +++++E +    K+I+ G++  N Y  S++SV+    + K+ +LD+S N I++L+ A +YPI I I   SL     ++ + R      + T D  IKLE+EF   F  I+   T  ++  Q  +LV   Q  P  W+ ++++
Sbjct:    2 MNHSMSSGSGSLRTNQKRSLYVRAMFDYDKSKDSGLPSQGLSFKYGDILHVINASDDEWWQARRVMLEGDSEEM-----------GVIPSKRRVERKERARLKTVKFNAKPGVIDSKGD-----IPGLGDDGYGTKTLKHVSSNASDSESSYRG---QEDLILSYEPVTRQEINYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVISREQMEKDIQEHKFIEAGQYNDNLYGTSVQSVRFVAERGKHCILDVSGNAIKRLQVAQLYPIAIFIKPRSLE--PLMEMNKRLTEEQAKKTYDRAIKLEQEFGEYFTAIVQGDTLEDIYNQ-CKLVIEEQSGPFIWIPSKEK 347          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Human
Match: DLG2 (discs large MAGUK scaffold protein 2 [Source:HGNC Symbol;Acc:HGNC:2901])

HSP 1 Score: 144.05 bits (362), Expect = 1.024e-37
Identity = 115/368 (31.25%), Postives = 192/368 (52.17%), Query Frame = 1
Query:  355 MNHTQQNSYITV-DNKVQTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRKPMEKSICGTDLENNFTNPYEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSP-TWVAAEDQ 1452
            MNH+  +   ++  N+ ++ Y+R +  Y+ S D GLP +GL FK GD+L VINA+D +WWQA  +                    G+IPS  RV+ K R + + V+F+++  VI   G      I   G   +  K +R                  + +    YE + +Q I  TRP++++GP KD++ + L+ E+ D + + +PHTTRP R  E DG DYHF+ +++++E +    K+I+ G++  N Y  S++SV+    + K+ +LD+S N I++L+ A +YPI I I   SL     ++ + R      + T D  IKLE+EF   F  I+   T  ++  Q  +LV   Q  P  W+ ++++
Sbjct:    2 MNHSMSSGSGSLRTNQKRSLYVRAMFDYDKSKDSGLPSQGLSFKYGDILHVINASDDEWWQARRVMLEGDSEEM-----------GVIPSKRRVERKERARLKTVKFNAKPGVIDSKGD-----IPGLGDDGYGTKTLRG-----------------QEDLILSYEPVTRQEINYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVISREQMEKDIQEHKFIEAGQYNDNLYGTSVQSVRFVAERGKHCILDVSGNAIKRLQVAQLYPIAIFIKPRSLE--PLMEMNKRLTEEQAKKTYDRAIKLEQEFGEYFTAIVQGDTLEDIYNQ-CKLVIEEQSGPFIWIPSKEK 333          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Human
Match: DLG2 (discs large MAGUK scaffold protein 2 [Source:HGNC Symbol;Acc:HGNC:2901])

HSP 1 Score: 148.673 bits (374), Expect = 8.782e-37
Identity = 122/377 (32.36%), Postives = 201/377 (53.32%), Query Frame = 1
Query:  355 MNHTQQNSYITV-DNKVQTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRK-PMEKSICGTDLEN--------NFTNPYEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSP-TWVAAEDQ 1452
            MNH+  +   ++  N+ ++ Y+R +  Y+ S D GLP +GL FK GD+L VINA+D +WWQA  +                    G+IPS  RV+ K R + + V+F+++  VI   G             SF+ KR + F  SRK P  K+   ++ E         +    YE + +Q I  TRP++++GP KD++ + L+ E+ D + + +PHTTRP R  E DG DYHF+ +++++E +    K+I+ G++  N Y  S++SV+    + K+ +LD+S N I++L+ A +YPI I I   SL     ++ + R      + T D  IKLE+EF   F  I+   T  ++  Q  +LV   Q  P  W+ ++++
Sbjct:  625 MNHSMSSGSGSLRTNQKRSLYVRAMFDYDKSKDSGLPSQGLSFKYGDILHVINASDDEWWQARRVMLEGDSEEM-----------GVIPSKRRVERKERARLKTVKFNAKPGVIDSKG-------------SFNDKRKKSFIFSRKFPFYKNKEQSEQETSDPERGQEDLILSYEPVTRQEINYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVISREQMEKDIQEHKFIEAGQYNDNLYGTSVQSVRFVAERGKHCILDVSGNAIKRLQVAQLYPIAIFIKPRSLE--PLMEMNKRLTEEQAKKTYDRAIKLEQEFGEYFTAIVQGDTLEDIYNQ-CKLVIEEQSGPFIWIPSKEK 974          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Human
Match: DLG2 (discs large MAGUK scaffold protein 2 [Source:HGNC Symbol;Acc:HGNC:2901])

HSP 1 Score: 148.288 bits (373), Expect = 9.610e-37
Identity = 122/377 (32.36%), Postives = 201/377 (53.32%), Query Frame = 1
Query:  355 MNHTQQNSYITV-DNKVQTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRK-PMEKSICGTDLEN--------NFTNPYEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSP-TWVAAEDQ 1452
            MNH+  +   ++  N+ ++ Y+R +  Y+ S D GLP +GL FK GD+L VINA+D +WWQA  +                    G+IPS  RV+ K R + + V+F+++  VI   G             SF+ KR + F  SRK P  K+   ++ E         +    YE + +Q I  TRP++++GP KD++ + L+ E+ D + + +PHTTRP R  E DG DYHF+ +++++E +    K+I+ G++  N Y  S++SV+    + K+ +LD+S N I++L+ A +YPI I I   SL     ++ + R      + T D  IKLE+EF   F  I+   T  ++  Q  +LV   Q  P  W+ ++++
Sbjct:  662 MNHSMSSGSGSLRTNQKRSLYVRAMFDYDKSKDSGLPSQGLSFKYGDILHVINASDDEWWQARRVMLEGDSEEM-----------GVIPSKRRVERKERARLKTVKFNAKPGVIDSKG-------------SFNDKRKKSFIFSRKFPFYKNKEQSEQETSDPERGQEDLILSYEPVTRQEINYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVISREQMEKDIQEHKFIEAGQYNDNLYGTSVQSVRFVAERGKHCILDVSGNAIKRLQVAQLYPIAIFIKPRSLE--PLMEMNKRLTEEQAKKTYDRAIKLEQEFGEYFTAIVQGDTLEDIYNQ-CKLVIEEQSGPFIWIPSKEK 1011          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Human
Match: DLG1 (discs large MAGUK scaffold protein 1 [Source:HGNC Symbol;Acc:HGNC:2900])

HSP 1 Score: 148.288 bits (373), Expect = 9.698e-37
Identity = 110/351 (31.34%), Postives = 192/351 (54.70%), Query Frame = 1
Query:  403 QTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRI-RKFNNSRKPMEKSICGTDLENNFTNPYEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPTWVAAEDQ 1452
            ++ Y+R L  Y+ + D GLP +GL FK GD+L VINA+D +WWQA  +  +                 G+IPS  RV+ K R + + V+F+S+       G++  +M       S  LK +    ++S     +  C    +  +   YE + QQ +  TRP++++GP KD++ + L+ E+ D + + +PHTTRP R  E DG DYHF+++++++E +    K+I+ G++  + Y  S++SV++   K K+ +LD+S N I++L+ A +YPI I I   S+     ++ + R      + T +  +KLE+EF+  F  I+   T  ++  QV Q++     S  WV A+++
Sbjct:  549 RSLYVRALFDYDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEV-----------GVIPSKRRVEKKERARLKTVKFNSKTR---DKGEIPDDM------GSKGLKHVTSNASDSESSYHEYGCSKGGQEEYVLSYEPVNQQEVNYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMEN--IMEMNKRLTEEQARKTFERAMKLEQEFTEHFTAIVQGDTLEDIYNQVKQIIEEQSGSYIWVPAKEK 877          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Celegans
Match: dlg-1 (Disks large homolog 1 [Source:UniProtKB/Swiss-Prot;Acc:G5ECY0])

HSP 1 Score: 115.546 bits (288), Expect = 1.463e-26
Identity = 107/361 (29.64%), Postives = 179/361 (49.58%), Query Frame = 1
Query:  412 YIRTLCSYEPSXXXXXXXXXXXX-XXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRKPMEKSICG-TDLENNFTN-------PYEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRS-AAIYPICILISTSSLSQ--------AKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPT-TAAELKEQVVQLVHAYQRSPTWV 1437
            Y+R L  Y+PS +  +          GD+L +IN++D +WW A  +  N   ++            G+IPS +RV+ + R +++ V F+S +  +G        + N  G  S  L   RKF     P  KS     DL    +N        Y+ +EQQ I   RP++++G  KD++ + L+      +++ +PHT+RPPR GE +G DY+F+ NK  +E +  ++ +I+ G+F+ N Y  SI+SV+    + ++ +LD+S N I +L+S A I PI I I  SS  Q        A   Q D      + Q+      ++E+ F  LF   IS   +A ++  +V  ++    ++P WV
Sbjct:  623 YVRALFDYDPSRENSVAPHRSMGFNYGDILHIINSSDDEWWTARKVHENGEETAE-----------GVIPSKKRVEKRERLRRKQVNFNSGSQSLGRNSSTTG-LENRRGSRS-QLSFSRKF-----PFVKSTDRLNDLNEESSNVAEEPVWSYQAVEQQAINYVRPVIILGALKDRINDELVNRDPSKFSSCVPHTSRPPREGEVNGRDYYFV-NKHNMEEDVKNNLFIEAGQFQNNLYGTSIQSVRDVANQGRHCILDVSGNAIRRLQSNANIQPISIFIKPSSAQQILELDSQLATNRQDDRAMSGEEAQAQYSRCHRIEQTFGDLFTQEISNVHSANDVLSKVYSIISRESQTPIWV 964          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Celegans
Match: magu-2 (MAGUK family [Source:UniProtKB/TrEMBL;Acc:A0A3B1DQX2])

HSP 1 Score: 55.4546 bits (132), Expect = 9.602e-8
Identity = 53/208 (25.48%), Postives = 103/208 (49.52%), Query Frame = 1
Query:  844 YEIIEQQIIKTT--RPIVVIGP---GKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSS---LSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPTWVAA 1443
            YE +  ++ K T  RPIV+ G    G  +L + LL         P+P+T+R P+ GE +GV YHF+S K +   +  S K+++ G+++  +Y  + + V   + + K  ++ +    +  +RS  I P  I I+  S   L + + ++G     + ++++    +  +E+++  LFD II      +   ++ Q++      P WV A
Sbjct:  457 YEEVVLELPKATHRRPIVLCGAEGVGCLKLRDRLLESDRITLACPVPYTSRTPKEGEFNGVHYHFVS-KQKFHEDAKSGKFVEFGEYQKFWYGTAKKDVVNVIERGKTCVMTLKAESLGAIRSPDIQPYIIFIAAPSLYILRRQREVEGTFGVKDDELKAILTQSKSIEQKYGHLFDGIIVNIDFEKSFRELKQILMKVNTEPMWVPA 663          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Celegans
Match: magu-2 (MAGUK family [Source:UniProtKB/TrEMBL;Acc:A0A3B1DQX2])

HSP 1 Score: 55.4546 bits (132), Expect = 9.602e-8
Identity = 53/208 (25.48%), Postives = 103/208 (49.52%), Query Frame = 1
Query:  844 YEIIEQQIIKTT--RPIVVIGP---GKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSS---LSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPTWVAA 1443
            YE +  ++ K T  RPIV+ G    G  +L + LL         P+P+T+R P+ GE +GV YHF+S K +   +  S K+++ G+++  +Y  + + V   + + K  ++ +    +  +RS  I P  I I+  S   L + + ++G     + ++++    +  +E+++  LFD II      +   ++ Q++      P WV A
Sbjct:  457 YEEVVLELPKATHRRPIVLCGAEGVGCLKLRDRLLESDRITLACPVPYTSRTPKEGEFNGVHYHFVS-KQKFHEDAKSGKFVEFGEYQKFWYGTAKKDVVNVIERGKTCVMTLKAESLGAIRSPDIQPYIIFIAAPSLYILRRQREVEGTFGVKDDELKAILTQSKSIEQKYGHLFDGIIVNIDFEKSFRELKQILMKVNTEPMWVPA 663          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Celegans
Match: magu-2 (MAGUK family [Source:UniProtKB/TrEMBL;Acc:A0A3B1DQX2])

HSP 1 Score: 55.0694 bits (131), Expect = 1.451e-7
Identity = 53/208 (25.48%), Postives = 103/208 (49.52%), Query Frame = 1
Query:  844 YEIIEQQIIKTT--RPIVVIGP---GKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSS---LSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPTWVAA 1443
            YE +  ++ K T  RPIV+ G    G  +L + LL         P+P+T+R P+ GE +GV YHF+S K +   +  S K+++ G+++  +Y  + + V   + + K  ++ +    +  +RS  I P  I I+  S   L + + ++G     + ++++    +  +E+++  LFD II      +   ++ Q++      P WV A
Sbjct:  619 YEEVVLELPKATHRRPIVLCGAEGVGCLKLRDRLLESDRITLACPVPYTSRTPKEGEFNGVHYHFVS-KQKFHEDAKSGKFVEFGEYQKFWYGTAKKDVVNVIERGKTCVMTLKAESLGAIRSPDIQPYIIFIAAPSLYILRRQREVEGTFGVKDDELKAILTQSKSIEQKYGHLFDGIIVNIDFEKSFRELKQILMKVNTEPMWVPA 825          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Celegans
Match: magu-2 (MAGUK family [Source:UniProtKB/TrEMBL;Acc:A0A3B1DQX2])

HSP 1 Score: 55.0694 bits (131), Expect = 1.451e-7
Identity = 53/208 (25.48%), Postives = 103/208 (49.52%), Query Frame = 1
Query:  844 YEIIEQQIIKTT--RPIVVIGP---GKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSS---LSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPTWVAA 1443
            YE +  ++ K T  RPIV+ G    G  +L + LL         P+P+T+R P+ GE +GV YHF+S K +   +  S K+++ G+++  +Y  + + V   + + K  ++ +    +  +RS  I P  I I+  S   L + + ++G     + ++++    +  +E+++  LFD II      +   ++ Q++      P WV A
Sbjct:  619 YEEVVLELPKATHRRPIVLCGAEGVGCLKLRDRLLESDRITLACPVPYTSRTPKEGEFNGVHYHFVS-KQKFHEDAKSGKFVEFGEYQKFWYGTAKKDVVNVIERGKTCVMTLKAESLGAIRSPDIQPYIIFIAAPSLYILRRQREVEGTFGVKDDELKAILTQSKSIEQKYGHLFDGIIVNIDFEKSFRELKQILMKVNTEPMWVPA 825          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Fly
Match: dlg1 (gene:FBgn0001624 transcript:FBtr0333262)

HSP 1 Score: 140.198 bits (352), Expect = 1.916e-34
Identity = 112/352 (31.82%), Postives = 189/352 (53.69%), Query Frame = 1
Query:  403 QTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRKPMEKSICGTDLENNFTN--PYEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPT-WVAAED 1449
            ++ Y+R L  Y+P+ D GLP +GL FK GD+L V NA+D +WWQA  +  +                 G++PS  R + K R + R V+F   A        L  +        +F   R   F  SR   EK+  G+D E +  N   YE +++  I  TRP++++GP KD++ + L+ EY D + + +PHTTRP R  E DG DYHF+S+++++E +  +  +I+ G++  N Y  S+ SV++   K K+ +LD+S N I++L+ A +YP+ + I   S+     ++ + R      + T +  IK+E+EF   F  ++   T  E+  +V  ++ + Q  PT WV +++
Sbjct:  609 RSLYVRALFDYDPNRDDGLPSRGLPFKHGDILHVTNASDDEWWQARRVLGDNEDEQI-----------GIVPSKRRWERKMRARDRSVKFQGHAAA---NNNLDKQSTLDRKKKNFTFSRKFPFMKSRD--EKNEDGSDQEPSEENVLSYEAVQRLSINYTRPVIILGPLKDRINDDLISEYPDKFGSCVPHTTRPKREYEVDGRDYHFVSSREQMERDIQNHLFIEAGQYNDNLYGTSVASVREVAEKGKHCILDVSGNAIKRLQVAQLYPVAVFIKPKSVDS--VMEMNRRMTEEQAKKTYERAIKMEQEFGEYFTGVVQGDTIEEIYSKVKSMIWS-QSGPTIWVPSKE 941          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Fly
Match: dlg1 (gene:FBgn0001624 transcript:FBtr0073490)

HSP 1 Score: 134.035 bits (336), Expect = 1.824e-32
Identity = 114/373 (30.56%), Postives = 191/373 (51.21%), Query Frame = 1
Query:  403 QTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRK-PMEKS---------------ICGTDLENNFTNP-------YEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPT-WVAAED 1449
            ++ Y+R L  Y+P+ D GLP +GL FK GD+L V NA+D +WWQA  +  +                 G++PS  R + K R + R V+F   A              N    S+ D K+ + F  SRK P  KS               +C T  + N           YE +++  I  TRP++++GP KD++ + L+ EY D + + +PHTTRP R  E DG DYHF+S+++++E +  +  +I+ G++  N Y  S+ SV++   K K+ +LD+S N I++L+ A +YP+ + I   S+     ++ + R      + T +  IK+E+EF   F  ++   T  E+  +V  ++ + Q  PT WV +++
Sbjct:  562 RSLYVRALFDYDPNRDDGLPSRGLPFKHGDILHVTNASDDEWWQARRVLGDNEDEQI-----------GIVPSKRRWERKMRARDRSVKFQGHAAANN----------NLDKQSTLDRKK-KNFTFSRKFPFMKSRDEKNEDGSDQEPFMLCYTQDDANAEGASEENVLSYEAVQRLSINYTRPVIILGPLKDRINDDLISEYPDKFGSCVPHTTRPKREYEVDGRDYHFVSSREQMERDIQNHLFIEAGQYNDNLYGTSVASVREVAEKGKHCILDVSGNAIKRLQVAQLYPVAVFIKPKSVDS--VMEMNRRMTEEQAKKTYERAIKMEQEFGEYFTGVVQGDTIEEIYSKVKSMIWS-QSGPTIWVPSKE 909          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Fly
Match: dlg1 (gene:FBgn0001624 transcript:FBtr0073488)

HSP 1 Score: 133.65 bits (335), Expect = 2.606e-32
Identity = 114/373 (30.56%), Postives = 191/373 (51.21%), Query Frame = 1
Query:  403 QTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRK-PMEKS---------------ICGTDLENNFTNP-------YEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPT-WVAAED 1449
            ++ Y+R L  Y+P+ D GLP +GL FK GD+L V NA+D +WWQA  +  +                 G++PS  R + K R + R V+F   A       K           S+ D K+ + F  SRK P  KS               +C T  + N           YE +++  I  TRP++++GP KD++ + L+ EY D + + +PHTTRP R  E DG DYHF+S+++++E +  +  +I+ G++  N Y  S+ SV++   K K+ +LD+S N I++L+ A +YP+ + I   S+     ++ + R      + T +  IK+E+EF   F  ++   T  E+  +V  ++ + Q  PT WV +++
Sbjct:  621 RSLYVRALFDYDPNRDDGLPSRGLPFKHGDILHVTNASDDEWWQARRVLGDNEDEQI-----------GIVPSKRRWERKMRARDRSVKFQGHAAANNNLDK----------QSTLDRKK-KNFTFSRKFPFMKSRDEKNEDGSDQEPFMLCYTQDDANAEGASEENVLSYEAVQRLSINYTRPVIILGPLKDRINDDLISEYPDKFGSCVPHTTRPKREYEVDGRDYHFVSSREQMERDIQNHLFIEAGQYNDNLYGTSVASVREVAEKGKHCILDVSGNAIKRLQVAQLYPVAVFIKPKSVD--SVMEMNRRMTEEQAKKTYERAIKMEQEFGEYFTGVVQGDTIEEIYSKVKSMIWS-QSGPTIWVPSKE 968          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Fly
Match: dlg1 (gene:FBgn0001624 transcript:FBtr0112812)

HSP 1 Score: 133.65 bits (335), Expect = 2.685e-32
Identity = 114/373 (30.56%), Postives = 191/373 (51.21%), Query Frame = 1
Query:  403 QTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRK-PMEKS---------------ICGTDLENNFTNP-------YEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPT-WVAAED 1449
            ++ Y+R L  Y+P+ D GLP +GL FK GD+L V NA+D +WWQA  +  +                 G++PS  R + K R + R V+F   A       K           S+ D K+ + F  SRK P  KS               +C T  + N           YE +++  I  TRP++++GP KD++ + L+ EY D + + +PHTTRP R  E DG DYHF+S+++++E +  +  +I+ G++  N Y  S+ SV++   K K+ +LD+S N I++L+ A +YP+ + I   S+     ++ + R      + T +  IK+E+EF   F  ++   T  E+  +V  ++ + Q  PT WV +++
Sbjct:  562 RSLYVRALFDYDPNRDDGLPSRGLPFKHGDILHVTNASDDEWWQARRVLGDNEDEQI-----------GIVPSKRRWERKMRARDRSVKFQGHAAANNNLDKQ----------STLDRKK-KNFTFSRKFPFMKSRDEKNEDGSDQEPFMLCYTQDDANAEGASEENVLSYEAVQRLSINYTRPVIILGPLKDRINDDLISEYPDKFGSCVPHTTRPKREYEVDGRDYHFVSSREQMERDIQNHLFIEAGQYNDNLYGTSVASVREVAEKGKHCILDVSGNAIKRLQVAQLYPVAVFIKPKSVDS--VMEMNRRMTEEQAKKTYERAIKMEQEFGEYFTGVVQGDTIEEIYSKVKSMIWS-QSGPTIWVPSKE 909          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Fly
Match: dlg1 (gene:FBgn0001624 transcript:FBtr0330390)

HSP 1 Score: 130.954 bits (328), Expect = 2.229e-31
Identity = 113/377 (29.97%), Postives = 189/377 (50.13%), Query Frame = 1
Query:  403 QTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRKPMEKSICGTDLENN------------------FTNP---------YEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPT-WVAAED 1449
            ++ Y+R L  Y+P+ D GLP +GL FK GD+L V NA+D +WWQA  +  +                 G++PS  R + K R + R V+F   A        L  +        +F   R   F  SR   EK+  G+D E N                     P         YE +++  I  TRP++++GP KD++ + L+ EY D + + +PHTTRP R  E DG DYHF+S+++++E +  +  +I+ G++  N Y  S+ SV++   K K+ +LD+S N I++L+ A +YP+ + I   S+     ++ + R      + T +  IK+E+EF   F  ++   T  E+  +V  ++ + Q  PT WV +++
Sbjct:  601 RSLYVRALFDYDPNRDDGLPSRGLPFKHGDILHVTNASDDEWWQARRVLGDNEDEQI-----------GIVPSKRRWERKMRARDRSVKFQGHAAA---NNNLDKQSTLDRKKKNFTFSRKFPFMKSRD--EKNEDGSDQEPNGVVSSTSEIDINNVNNNQSNEPQPSEENVLSYEAVQRLSINYTRPVIILGPLKDRINDDLISEYPDKFGSCVPHTTRPKREYEVDGRDYHFVSSREQMERDIQNHLFIEAGQYNDNLYGTSVASVREVAEKGKHCILDVSGNAIKRLQVAQLYPVAVFIKPKSVD--SVMEMNRRMTEEQAKKTYERAIKMEQEFGEYFTGVVQGDTIEEIYSKVKSMIWS-QSGPTIWVPSKE 958          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Zebrafish
Match: dlg1 (discs, large homolog 1 (Drosophila) [Source:NCBI gene;Acc:114446])

HSP 1 Score: 144.821 bits (364), Expect = 7.679e-36
Identity = 107/350 (30.57%), Postives = 190/350 (54.29%), Query Frame = 1
Query:  403 QTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRKPMEKSICGTDLENNFTNPYEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPTWVAAEDQ 1452
            +T Y+R L  Y+ + D GLP +GL F+ GD+L V+NA+D +WWQA H+  +  +              G+IPS +RV+ K R + + V+F+S++                      D K ++   ++    E S  G   + ++   YE + QQ +  +RP++++GP KD++ + L+ E+ D + + +PHTTRP R  E DG DYHF+++++++E +    K+I+ G++  + Y  S++SV++   K K+ +LD+S N I++L+ A +YPI + I   S+     L+ + R +    + T D  +KLE+EF   F  I+   T  E+  QV Q++        WV  +++
Sbjct:  590 RTLYVRALFDYDITKDSGLPSQGLNFRFGDILHVLNASDEEWWQARHVTTDGEMEEM-----------GVIPSKKRVERKERARLKTVKFNSKS---------------RDKADLSDDKGLKHVTSNASDSESSFRG---QEDYVLSYETVTQQEVSYSRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVNSREQMEKDIQDHKFIEAGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKRLQLAQLYPIAVFIKPKSVE--NILEMNKRLMEEQGRKTYDRAMKLEQEFLEHFTAIVQGDTLEEIYNQVKQIIEEQSGPFIWVPVKEK 908          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Zebrafish
Match: dlg1 (discs, large homolog 1 (Drosophila) [Source:NCBI gene;Acc:114446])

HSP 1 Score: 141.354 bits (355), Expect = 9.198e-35
Identity = 104/350 (29.71%), Postives = 188/350 (53.71%), Query Frame = 1
Query:  403 QTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRKPMEKSICGTDLENNFTNPYEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPTWVAAEDQ 1452
            +T Y+R L  Y+ + D GLP +GL F+ GD+L V+NA+D +WWQA H+  +  +              G+IPS +RV+ K R + + V+F+S++       +  +++ +  G S                          + ++   YE + QQ +  +RP++++GP KD++ + L+ E+ D + + +PHTTRP R  E DG DYHF+++++++E +    K+I+ G++  + Y  S++SV++   K K+ +LD+S N I++L+ A +YPI + I   S+     L+ + R +    + T D  +KLE+EF   F  I+   T  E+  QV Q++        WV  +++
Sbjct:  454 RTLYVRALFDYDITKDSGLPSQGLNFRFGDILHVLNASDEEWWQARHVTTDGEMEEM-----------GVIPSKKRVERKERARLKTVKFNSKS-------RDKADLSDDKGLSG-------------------------QEDYVLSYETVTQQEVSYSRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVNSREQMEKDIQDHKFIEAGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKRLQLAQLYPIAVFIKPKSVEN--ILEMNKRLMEEQGRKTYDRAMKLEQEFLEHFTAIVQGDTLEEIYNQVKQIIEEQSGPFIWVPVKEK 758          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Zebrafish
Match: dlg3 (discs, large homolog 3 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-050208-93])

HSP 1 Score: 133.65 bits (335), Expect = 7.004e-34
Identity = 115/373 (30.83%), Postives = 187/373 (50.13%), Query Frame = 1
Query:  403 QTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRK-PMEKSI------------CGTDL----------ENNFTNPYEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPTWVAAEDQ 1452
            ++ Y+R L  Y+ + D  LP +GL F  GD+L VINA+D +WWQA  +  +                 G+IPS +RV+ K R + + V+F +R      TG + S   N P      +KR + FN SRK P  KS             C T            + +    YE + +Q I  TRP++++GP KD++ + L+ E+   + + +PHTTRP R  E DG DYHF+ +++++E +   +K+I+ G+F  N Y  SI SV+    + K+ +LD+S N I++L+ A +YPI I I   S+     L  + RQ         D  +KLE+EF   F  I+   +  E+  ++  ++        W+ + ++
Sbjct:   19 RSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGESEQI-----------GVIPSKKRVEKKERARLKTVKFHAR------TGMIES---NRP----VKVKRKKSFNLSRKFPFYKSKENIVQELVETEQCLTSNTSDSESSSKGQEDTILSYEPVIRQEIHYTRPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRENEMDGQDYHFVGSREQMEKDIQDNKFIEAGQFNENLYGTSILSVRAVAERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSVEALMEL--NKRQTYEQANKVFDKAMKLEQEFGEFFTAIVQGDSLDEIYNKIKLIIEEQSGPYIWIPSAEK 365          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Zebrafish
Match: dlg3 (discs, large homolog 3 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-050208-93])

HSP 1 Score: 133.65 bits (335), Expect = 7.004e-34
Identity = 115/373 (30.83%), Postives = 187/373 (50.13%), Query Frame = 1
Query:  403 QTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRK-PMEKSI------------CGTDL----------ENNFTNPYEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPTWVAAEDQ 1452
            ++ Y+R L  Y+ + D  LP +GL F  GD+L VINA+D +WWQA  +  +                 G+IPS +RV+ K R + + V+F +R      TG + S   N P      +KR + FN SRK P  KS             C T            + +    YE + +Q I  TRP++++GP KD++ + L+ E+   + + +PHTTRP R  E DG DYHF+ +++++E +   +K+I+ G+F  N Y  SI SV+    + K+ +LD+S N I++L+ A +YPI I I   S+     L  + RQ         D  +KLE+EF   F  I+   +  E+  ++  ++        W+ + ++
Sbjct:   19 RSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGESEQI-----------GVIPSKKRVEKKERARLKTVKFHAR------TGMIES---NRP----VKVKRKKSFNLSRKFPFYKSKENIVQELVETEQCLTSNTSDSESSSKGQEDTILSYEPVIRQEIHYTRPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRENEMDGQDYHFVGSREQMEKDIQDNKFIEAGQFNENLYGTSILSVRAVAERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSVEALMEL--NKRQTYEQANKVFDKAMKLEQEFGEFFTAIVQGDSLDEIYNKIKLIIEEQSGPYIWIPSAEK 365          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Zebrafish
Match: dlg3 (discs, large homolog 3 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-050208-93])

HSP 1 Score: 138.658 bits (348), Expect = 7.969e-34
Identity = 115/366 (31.42%), Postives = 187/366 (51.09%), Query Frame = 1
Query:  403 QTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRK-PMEKSI---------------CGTDLENNFTNPYEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPTWVAAEDQ 1452
            ++ Y+R L  Y+ + D  LP +GL F  GD+L VINA+D +WWQA  +  +                 G+IPS +RV+ K R + + V+F +R      TG + S   N P      +KR + FN SRK P  KS                 GT  + +    YE + +Q I  TRP++++GP KD++ + L+ E+   + + +PHTTRP R  E DG DYHF+ +++++E +   +K+I+ G+F  N Y  SI SV+    + K+ +LD+S N I++L+ A +YPI I I   S+     L  + RQ         D  +KLE+EF   F  I+   +  E+  ++  ++        W+ + ++
Sbjct:  520 RSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGESEQI-----------GVIPSKKRVEKKERARLKTVKFHAR------TGMIES---NRP----VKVKRKKSFNLSRKFPFYKSKENIVQELVETERKYERGTRGQEDTILSYEPVIRQEIHYTRPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRENEMDGQDYHFVGSREQMEKDIQDNKFIEAGQFNENLYGTSILSVRAVAERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSVEALMEL--NKRQTYEQANKVFDKAMKLEQEFGEFFTAIVQGDSLDEIYNKIKLIIEEQSGPYIWIPSAEK 859          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Xenopus
Match: hjv (hemojuvelin BMP co-receptor [Source:Xenbase;Acc:XB-GENE-922976])

HSP 1 Score: 150.214 bits (378), Expect = 1.430e-37
Identity = 119/378 (31.48%), Postives = 202/378 (53.44%), Query Frame = 1
Query:  355 MNHTQQNSYITV-DNKVQTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRK-PMEKSICGTDLENNFTNP----------YEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPTWVAAEDQ 1452
            MNH+  +   ++  N+ ++ Y+R +  YE S D GLP +GL F+ GD+L VINA+D +WWQA  + ++                 G+IPS  RV+ K R + + V+F+++  VI   G             SF+ KR + F  SRK P  K+   T+ E   ++P          YE + +Q I  TRP++++GP KD++ + L+ E+ D + + +PHTTRP R  E DG DYHF+++++++E +    K+I+ G++  N Y  S++SVK    + K+ +LD+S N I++L+ A +YPI I +   S+     ++   R      + T D  +KLE+EF   F  I+   T  ++     Q++        WV ++++
Sbjct:  464 MNHSMSSGSGSLRTNQKRSLYVRAMFDYEKSKDSGLPSQGLSFRYGDILHVINASDDEWWQARRVTQDGDSEEM-----------GVIPSKRRVERKERARLKTVKFNAKPGVIDSRG-------------SFNDKRKKSFIFSRKFPFFKNKDQTEQET--SDPERGQEDCILSYEPVTRQEINYTRPVIILGPMKDRVNDDLISEFPDKFGSCVPHTTRPKRDYEMDGRDYHFVASREQMEKDIQEHKFIEAGQYNDNLYGTSVQSVKFVAERGKHCILDVSGNAIKRLQVAQLYPIAIFLKPKSVES--LMEISKRLTEEQAKKTFDRALKLEQEFGEFFTAIVQGDTLEDIYNSCKQVIEEQSGPFIWVPSKEK 813          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Xenopus
Match: hjv (hemojuvelin BMP co-receptor [Source:Xenbase;Acc:XB-GENE-922976])

HSP 1 Score: 149.828 bits (377), Expect = 2.371e-37
Identity = 119/378 (31.48%), Postives = 202/378 (53.44%), Query Frame = 1
Query:  355 MNHTQQNSYITV-DNKVQTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRK-PMEKSICGTDLENNFTNP----------YEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPTWVAAEDQ 1452
            MNH+  +   ++  N+ ++ Y+R +  YE S D GLP +GL F+ GD+L VINA+D +WWQA  + ++                 G+IPS  RV+ K R + + V+F+++  VI   G             SF+ KR + F  SRK P  K+   T+ E   ++P          YE + +Q I  TRP++++GP KD++ + L+ E+ D + + +PHTTRP R  E DG DYHF+++++++E +    K+I+ G++  N Y  S++SVK    + K+ +LD+S N I++L+ A +YPI I +   S+     ++   R      + T D  +KLE+EF   F  I+   T  ++     Q++        WV ++++
Sbjct:  520 MNHSMSSGSGSLRTNQKRSLYVRAMFDYEKSKDSGLPSQGLSFRYGDILHVINASDDEWWQARRVTQDGDSEEM-----------GVIPSKRRVERKERARLKTVKFNAKPGVIDSRG-------------SFNDKRKKSFIFSRKFPFFKNKDQTEQET--SDPERGQEDCILSYEPVTRQEINYTRPVIILGPMKDRVNDDLISEFPDKFGSCVPHTTRPKRDYEMDGRDYHFVASREQMEKDIQEHKFIEAGQYNDNLYGTSVQSVKFVAERGKHCILDVSGNAIKRLQVAQLYPIAIFLKPKSVES--LMEISKRLTEEQAKKTFDRALKLEQEFGEFFTAIVQGDTLEDIYNSCKQVIEEQSGPFIWVPSKEK 869          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Xenopus
Match: hjv (hemojuvelin BMP co-receptor [Source:Xenbase;Acc:XB-GENE-922976])

HSP 1 Score: 149.828 bits (377), Expect = 2.581e-37
Identity = 119/378 (31.48%), Postives = 202/378 (53.44%), Query Frame = 1
Query:  355 MNHTQQNSYITV-DNKVQTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRK-PMEKSICGTDLENNFTNP----------YEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPTWVAAEDQ 1452
            MNH+  +   ++  N+ ++ Y+R +  YE S D GLP +GL F+ GD+L VINA+D +WWQA  + ++                 G+IPS  RV+ K R + + V+F+++  VI   G             SF+ KR + F  SRK P  K+   T+ E   ++P          YE + +Q I  TRP++++GP KD++ + L+ E+ D + + +PHTTRP R  E DG DYHF+++++++E +    K+I+ G++  N Y  S++SVK    + K+ +LD+S N I++L+ A +YPI I +   S+     ++   R      + T D  +KLE+EF   F  I+   T  ++     Q++        WV ++++
Sbjct:  503 MNHSMSSGSGSLRTNQKRSLYVRAMFDYEKSKDSGLPSQGLSFRYGDILHVINASDDEWWQARRVTQDGDSEEM-----------GVIPSKRRVERKERARLKTVKFNAKPGVIDSRG-------------SFNDKRKKSFIFSRKFPFFKNKDQTEQET--SDPERGQEDCILSYEPVTRQEINYTRPVIILGPMKDRVNDDLISEFPDKFGSCVPHTTRPKRDYEMDGRDYHFVASREQMEKDIQEHKFIEAGQYNDNLYGTSVQSVKFVAERGKHCILDVSGNAIKRLQVAQLYPIAIFLKPKSVES--LMEISKRLTEEQAKKTFDRALKLEQEFGEFFTAIVQGDTLEDIYNSCKQVIEEQSGPFIWVPSKEK 852          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Xenopus
Match: hjv (hemojuvelin BMP co-receptor [Source:Xenbase;Acc:XB-GENE-922976])

HSP 1 Score: 149.828 bits (377), Expect = 2.972e-37
Identity = 119/378 (31.48%), Postives = 202/378 (53.44%), Query Frame = 1
Query:  355 MNHTQQNSYITV-DNKVQTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRK-PMEKSICGTDLENNFTNP----------YEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPTWVAAEDQ 1452
            MNH+  +   ++  N+ ++ Y+R +  YE S D GLP +GL F+ GD+L VINA+D +WWQA  + ++                 G+IPS  RV+ K R + + V+F+++  VI   G             SF+ KR + F  SRK P  K+   T+ E   ++P          YE + +Q I  TRP++++GP KD++ + L+ E+ D + + +PHTTRP R  E DG DYHF+++++++E +    K+I+ G++  N Y  S++SVK    + K+ +LD+S N I++L+ A +YPI I +   S+     ++   R      + T D  +KLE+EF   F  I+   T  ++     Q++        WV ++++
Sbjct:  563 MNHSMSSGSGSLRTNQKRSLYVRAMFDYEKSKDSGLPSQGLSFRYGDILHVINASDDEWWQARRVTQDGDSEEM-----------GVIPSKRRVERKERARLKTVKFNAKPGVIDSRG-------------SFNDKRKKSFIFSRKFPFFKNKDQTEQET--SDPERGQEDCILSYEPVTRQEINYTRPVIILGPMKDRVNDDLISEFPDKFGSCVPHTTRPKRDYEMDGRDYHFVASREQMEKDIQEHKFIEAGQYNDNLYGTSVQSVKFVAERGKHCILDVSGNAIKRLQVAQLYPIAIFLKPKSVES--LMEISKRLTEEQAKKTFDRALKLEQEFGEFFTAIVQGDTLEDIYNSCKQVIEEQSGPFIWVPSKEK 912          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Xenopus
Match: hjv (hemojuvelin BMP co-receptor [Source:Xenbase;Acc:XB-GENE-922976])

HSP 1 Score: 143.665 bits (361), Expect = 2.853e-35
Identity = 113/385 (29.35%), Postives = 196/385 (50.91%), Query Frame = 1
Query:  355 MNHTQQNSYITV-DNKVQTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRK-PMEKSICGTDLENNFTNP----------YEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGER-------DGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPTWVAAEDQ 1452
            MNH+  +   ++  N+ ++ Y+R +  YE S D GLP +GL F+ GD+L VINA+D +WWQA  + ++                 G+IPS  RV+ K R + + V+F+++  VI   G             SF+ KR + F  SRK P  K+   T+ E   ++P          YE + +Q I  TRP++++GP KD++ + L+ E+ D + + +P          R       DG DYHF+++++++E +    K+I+ G++  N Y  S++SVK    + K+ +LD+S N I++L+ A +YPI I +   S+     ++   R      + T D  +KLE+EF   F  I+   T  ++     Q++        WV ++++
Sbjct:  491 MNHSMSSGSGSLRTNQKRSLYVRAMFDYEKSKDSGLPSQGLSFRYGDILHVINASDDEWWQARRVTQDGDSEEM-----------GVIPSKRRVERKERARLKTVKFNAKPGVIDSRG-------------SFNDKRKKSFIFSRKFPFFKNKDQTEQET--SDPERGQEDCILSYEPVTRQEINYTRPVIILGPMKDRVNDDLISEFPDKFGSCVPRNHFISIDTTRPKRDYEMDGRDYHFVASREQMEKDIQEHKFIEAGQYNDNLYGTSVQSVKFVAERGKHCILDVSGNAIKRLQVAQLYPIAIFLKPKSVES--LMEISKRLTEEQAKKTFDRALKLEQEFGEFFTAIVQGDTLEDIYNSCKQVIEEQSGPFIWVPSKEK 847          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Mouse
Match: Dlg2 (discs large MAGUK scaffold protein 2 [Source:MGI Symbol;Acc:MGI:1344351])

HSP 1 Score: 148.288 bits (373), Expect = 6.506e-37
Identity = 122/377 (32.36%), Postives = 202/377 (53.58%), Query Frame = 1
Query:  355 MNHTQQNSYITV-DNKVQTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRK-PMEKSICGTDLEN--------NFTNPYEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSP-TWVAAEDQ 1452
            MNH+  +   ++  N+ ++ Y+R +  Y+ S D GLP +GL FK GD+L VINA+D +WWQA  +  +                 G+IPS  RV+ K R + + V+F+++  VI   G             SF+ KR + F  SRK P  K+   ++ E         +    YE + +Q I  TRP++++GP KD++ + L+ E+ D + + +PHTTRP R  E DG DYHF+ +++++E +    K+I+ G++  N Y  S++SV+    + K+ +LD+S N I++L+ A +YPI I I   SL     ++ + R      + T D  IKLE+EF   F  I+   T  ++  Q  +LV   Q  P  W+ ++++
Sbjct:  520 MNHSMSSGSGSLRTNQKRSLYVRAMFDYDKSKDSGLPSQGLSFKYGDILHVINASDDEWWQARRVTLDGDSEEM-----------GVIPSKRRVERKERARLKTVKFNAKPGVIDSKG-------------SFNDKRKKSFIFSRKFPFYKNKEQSEQETSDPERGQEDLILSYEPVTRQEINYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVISREQMEKDIQEHKFIEAGQYNDNLYGTSVQSVRFVAERGKHCILDVSGNAIKRLQVAQLYPIAIFIKPKSLE--PLMEMNKRLTEEQAKKTYDRAIKLEQEFGEYFTAIVQGDTLEDIYNQ-CKLVIEEQSGPFIWIPSKEK 869          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Mouse
Match: Dlg1 (discs large MAGUK scaffold protein 1 [Source:MGI Symbol;Acc:MGI:107231])

HSP 1 Score: 147.517 bits (371), Expect = 1.234e-36
Identity = 109/351 (31.05%), Postives = 191/351 (54.42%), Query Frame = 1
Query:  403 QTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRI-RKFNNSRKPMEKSICGTDLENNFTNPYEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPTWVAAEDQ 1452
            ++ Y+R L  Y+ + D GLP +GL F+ GD+L VINA+D +WWQA  +  +                 G+IPS  RV+ K R + + V+F+S+    G  G++  +M       S  LK +    ++S     +  C    +  +   YE + QQ +  TRP++++GP KD++ + L+ E+ D + + +PHTTRP R  E DG DYHF+++++++E +    K+I+ G++  + Y  S++SV+    K K+ +LD+S N I++L+ A +YPI I I   S+     ++ + R      + T +  +KLE+EF+  F  I+   T  ++  QV Q++        WV A+++
Sbjct:  582 RSLYVRALFDYDKTKDSGLPSQGLNFRFGDILHVINASDDEWWQARQVTPDGESDEV-----------GVIPSKRRVEKKERARLKTVKFNSKTR--GDKGEIPDDM------GSKGLKHVTSNASDSESSYHEYGCSKGGQEEYVLSYEPVNQQEVNYTRPVIILGPMKDRVNDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVRAVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMEN--IMEMNKRLTEEQARKTFERAMKLEQEFTEHFTAIVQGDTLEDIYNQVKQIIEEQSGPYIWVPAKEK 911          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Mouse
Match: Dlg2 (discs large MAGUK scaffold protein 2 [Source:MGI Symbol;Acc:MGI:1344351])

HSP 1 Score: 143.665 bits (361), Expect = 1.763e-36
Identity = 122/391 (31.20%), Postives = 202/391 (51.66%), Query Frame = 1
Query:  355 MNHTQQNSYITV-DNKVQTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRK-PMEKSICGTDLEN----------------------NFTNPYEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSP-TWVAAEDQ 1452
            MNH+  +   ++  N+ ++ Y+R +  Y+ S D GLP +GL FK GD+L VINA+D +WWQA  +  +                 G+IPS  RV+ K R + + V+F+++  VI   G             SF+ KR + F  SRK P  K+   ++ E                       +    YE + +Q I  TRP++++GP KD++ + L+ E+ D + + +PHTTRP R  E DG DYHF+ +++++E +    K+I+ G++  N Y  S++SV+    + K+ +LD+S N I++L+ A +YPI I I   SL     ++ + R      + T D  IKLE+EF   F  I+   T  ++  Q  +LV   Q  P  W+ ++++
Sbjct:  117 MNHSMSSGSGSLRTNQKRSLYVRAMFDYDKSKDSGLPSQGLSFKYGDILHVINASDDEWWQARRVTLDGDSEEM-----------GVIPSKRRVERKERARLKTVKFNAKPGVIDSKG-------------SFNDKRKKSFIFSRKFPFYKNKEQSEQETSDPEQHVSSNASDSESSCRGQEDLILSYEPVTRQEINYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVISREQMEKDIQEHKFIEAGQYNDNLYGTSVQSVRFVAERGKHCILDVSGNAIKRLQVAQLYPIAIFIKPKSLE--PLMEMNKRLTEEQAKKTYDRAIKLEQEFGEYFTAIVQGDTLEDIYNQ-CKLVIEEQSGPFIWIPSKEK 480          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Mouse
Match: Dlg1 (discs large MAGUK scaffold protein 1 [Source:MGI Symbol;Acc:MGI:107231])

HSP 1 Score: 145.206 bits (365), Expect = 6.845e-36
Identity = 108/350 (30.86%), Postives = 191/350 (54.57%), Query Frame = 1
Query:  403 QTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRKPMEKSICGTDLENNFTNPYEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPTWVAAEDQ 1452
            ++ Y+R L  Y+ + D GLP +GL F+ GD+L VINA+D +WWQA  +  +                 G+IPS  RV+ K R + + V+F+S+    G  G++  +M +         K ++   ++    E S  G   +  +   YE + QQ +  TRP++++GP KD++ + L+ E+ D + + +PHTTRP R  E DG DYHF+++++++E +    K+I+ G++  + Y  S++SV+    K K+ +LD+S N I++L+ A +YPI I I   S+     ++ + R      + T +  +KLE+EF+  F  I+   T  ++  QV Q++        WV A+++
Sbjct:  549 RSLYVRALFDYDKTKDSGLPSQGLNFRFGDILHVINASDDEWWQARQVTPDGESDEV-----------GVIPSKRRVEKKERARLKTVKFNSKTR--GDKGEIPDDMGS---------KGLKHVTSNASDSESSYRG---QEEYVLSYEPVNQQEVNYTRPVIILGPMKDRVNDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVRAVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMEN--IMEMNKRLTEEQARKTFERAMKLEQEFTEHFTAIVQGDTLEDIYNQVKQIIEEQSGPYIWVPAKEK 871          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Mouse
Match: Dlg1 (discs large MAGUK scaffold protein 1 [Source:MGI Symbol;Acc:MGI:107231])

HSP 1 Score: 144.436 bits (363), Expect = 1.025e-35
Identity = 108/350 (30.86%), Postives = 191/350 (54.57%), Query Frame = 1
Query:  403 QTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRKPMEKSICGTDLENNFTNPYEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPTWVAAEDQ 1452
            ++ Y+R L  Y+ + D GLP +GL F+ GD+L VINA+D +WWQA  +  +                 G+IPS  RV+ K R + + V+F+S+    G  G++  +M +         K ++   ++    E S  G   +  +   YE + QQ +  TRP++++GP KD++ + L+ E+ D + + +PHTTRP R  E DG DYHF+++++++E +    K+I+ G++  + Y  S++SV+    K K+ +LD+S N I++L+ A +YPI I I   S+     ++ + R      + T +  +KLE+EF+  F  I+   T  ++  QV Q++        WV A+++
Sbjct:  582 RSLYVRALFDYDKTKDSGLPSQGLNFRFGDILHVINASDDEWWQARQVTPDGESDEV-----------GVIPSKRRVEKKERARLKTVKFNSKTR--GDKGEIPDDMGS---------KGLKHVTSNASDSESSYRG---QEEYVLSYEPVNQQEVNYTRPVIILGPMKDRVNDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVRAVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMEN--IMEMNKRLTEEQARKTFERAMKLEQEFTEHFTAIVQGDTLEDIYNQVKQIIEEQSGPYIWVPAKEK 904          
BLAST of 55 kDa erythrocyte membrane protein vs. UniProt/SwissProt
Match: sp|Q15700|DLG2_HUMAN (Disks large homolog 2 OS=Homo sapiens OX=9606 GN=DLG2 PE=1 SV=3)

HSP 1 Score: 147.902 bits (372), Expect = 4.940e-36
Identity = 122/377 (32.36%), Postives = 201/377 (53.32%), Query Frame = 1
Query:  355 MNHTQQNSYITV-DNKVQTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRK-PMEKSICGTDLEN--------NFTNPYEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSP-TWVAAEDQ 1452
            MNH+  +   ++  N+ ++ Y+R +  Y+ S D GLP +GL FK GD+L VINA+D +WWQA  +                    G+IPS  RV+ K R + + V+F+++  VI   G             SF+ KR + F  SRK P  K+   ++ E         +    YE + +Q I  TRP++++GP KD++ + L+ E+ D + + +PHTTRP R  E DG DYHF+ +++++E +    K+I+ G++  N Y  S++SV+    + K+ +LD+S N I++L+ A +YPI I I   SL     ++ + R      + T D  IKLE+EF   F  I+   T  ++  Q  +LV   Q  P  W+ ++++
Sbjct:  520 MNHSMSSGSGSLRTNQKRSLYVRAMFDYDKSKDSGLPSQGLSFKYGDILHVINASDDEWWQARRVMLEGDSEEM-----------GVIPSKRRVERKERARLKTVKFNAKPGVIDSKG-------------SFNDKRKKSFIFSRKFPFYKNKEQSEQETSDPERGQEDLILSYEPVTRQEINYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVISREQMEKDIQEHKFIEAGQYNDNLYGTSVQSVRFVAERGKHCILDVSGNAIKRLQVAQLYPIAIFIKPRSLE--PLMEMNKRLTEEQAKKTYDRAIKLEQEFGEYFTAIVQGDTLEDIYNQ-CKLVIEEQSGPFIWIPSKEK 869          
BLAST of 55 kDa erythrocyte membrane protein vs. UniProt/SwissProt
Match: sp|Q62696|DLG1_RAT (Disks large homolog 1 OS=Rattus norvegicus OX=10116 GN=Dlg1 PE=1 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 6.992e-36
Identity = 109/351 (31.05%), Postives = 192/351 (54.70%), Query Frame = 1
Query:  403 QTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRI-RKFNNSRKPMEKSICGTDLENNFTNPYEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPTWVAAEDQ 1452
            ++ Y+R L  Y+ + D GLP +GL FK GD+L VINA+D +WWQA  +  +                 G+IPS  RV+ K R + + V+F+S+    G  G++  +M       S  LK +    ++S     +  C    +  +   YE + QQ +  TRP++++GP KD++ + L+ E+ D + + +PHTTRP R  E DG DYHF+++++++E +    K+I+ G++  + Y  S++SV+    K K+ +LD+S N I++L+ A +YPI I I   S+     ++ + R  +   + T +  ++LE+EF+  F  I+   T  ++  QV Q++        WV A+++
Sbjct:  581 RSLYVRALFDYDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEV-----------GVIPSKRRVEKKERARLKTVKFNSKTR--GDKGEIPDDM------GSKGLKHVTSNASDSESSYHEYGCSKGGQEEYVLSYEPVNQQEVNYTRPVIILGPMKDRVNDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVRAVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMEN--IMEMNKRLTDEQARKTFERAVRLEQEFTEHFTAIVQGDTLEDIYNQVKQIIEEQSGPYIWVPAKEK 910          
BLAST of 55 kDa erythrocyte membrane protein vs. UniProt/SwissProt
Match: sp|Q12959|DLG1_HUMAN (Disks large homolog 1 OS=Homo sapiens OX=9606 GN=DLG1 PE=1 SV=2)

HSP 1 Score: 145.206 bits (365), Expect = 4.934e-35
Identity = 110/350 (31.43%), Postives = 191/350 (54.57%), Query Frame = 1
Query:  403 QTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRKPMEKSICGTDLENNFTNPYEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPTWVAAEDQ 1452
            ++ Y+R L  Y+ + D GLP +GL FK GD+L VINA+D +WWQA  +  +                 G+IPS  RV+ K R + + V+F+S+    G       E+ +  G      K ++   ++    E S  G   +  +   YE + QQ +  TRP++++GP KD++ + L+ E+ D + + +PHTTRP R  E DG DYHF+++++++E +    K+I+ G++  + Y  S++SV++   K K+ +LD+S N I++L+ A +YPI I I   S+     ++ + R      + T +  +KLE+EF+  F  I+   T  ++  QV Q++     S  WV A+++
Sbjct:  582 RSLYVRALFDYDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEV-----------GVIPSKRRVEKKERARLKTVKFNSKTRDKG-------EIPDDMGS-----KGLKHVTSNASDSESSYRG---QEEYVLSYEPVNQQEVNYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMEN--IMEMNKRLTEEQARKTFERAMKLEQEFTEHFTAIVQGDTLEDIYNQVKQIIEEQSGSYIWVPAKEK 903          
BLAST of 55 kDa erythrocyte membrane protein vs. UniProt/SwissProt
Match: sp|Q811D0|DLG1_MOUSE (Disks large homolog 1 OS=Mus musculus OX=10090 GN=Dlg1 PE=1 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 7.169e-35
Identity = 108/350 (30.86%), Postives = 191/350 (54.57%), Query Frame = 1
Query:  403 QTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRKPMEKSICGTDLENNFTNPYEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPTWVAAEDQ 1452
            ++ Y+R L  Y+ + D GLP +GL F+ GD+L VINA+D +WWQA  +  +                 G+IPS  RV+ K R + + V+F+S+    G  G++  +M +         K ++   ++    E S  G   +  +   YE + QQ +  TRP++++GP KD++ + L+ E+ D + + +PHTTRP R  E DG DYHF+++++++E +    K+I+ G++  + Y  S++SV+    K K+ +LD+S N I++L+ A +YPI I I   S+     ++ + R      + T +  +KLE+EF+  F  I+   T  ++  QV Q++        WV A+++
Sbjct:  582 RSLYVRALFDYDKTKDSGLPSQGLNFRFGDILHVINASDDEWWQARQVTPDGESDEV-----------GVIPSKRRVEKKERARLKTVKFNSKTR--GDKGEIPDDMGS---------KGLKHVTSNASDSESSYRG---QEEYVLSYEPVNQQEVNYTRPVIILGPMKDRVNDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVRAVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMEN--IMEMNKRLTEEQARKTFERAMKLEQEFTEHFTAIVQGDTLEDIYNQVKQIIEEQSGPYIWVPAKEK 904          
BLAST of 55 kDa erythrocyte membrane protein vs. UniProt/SwissProt
Match: sp|Q91XM9|DLG2_MOUSE (Disks large homolog 2 OS=Mus musculus OX=10090 GN=Dlg2 PE=1 SV=2)

HSP 1 Score: 143.28 bits (360), Expect = 1.826e-34
Identity = 115/368 (31.25%), Postives = 193/368 (52.45%), Query Frame = 1
Query:  355 MNHTQQNSYITV-DNKVQTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRKPMEKSICGTDLENNFTNPYEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSP-TWVAAEDQ 1452
            MNH+  +   ++  N+ ++ Y+R +  Y+ S D GLP +GL FK GD+L VINA+D +WWQA  +  +                 G+IPS  RV+ K R + + V+F+++  VI   G      I   G   +  K +R                  + +    YE + +Q I  TRP++++GP KD++ + L+ E+ D + + +PHTTRP R  E DG DYHF+ +++++E +    K+I+ G++  N Y  S++SV+    + K+ +LD+S N I++L+ A +YPI I I   SL     ++ + R      + T D  IKLE+EF   F  I+   T  ++  Q  +LV   Q  P  W+ ++++
Sbjct:  520 MNHSMSSGSGSLRTNQKRSLYVRAMFDYDKSKDSGLPSQGLSFKYGDILHVINASDDEWWQARRVTLDGDSEEM-----------GVIPSKRRVERKERARLKTVKFNAKPGVIDSKGD-----IPGLGDDGYGTKTLRG-----------------QEDLILSYEPVTRQEINYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVISREQMEKDIQEHKFIEAGQYNDNLYGTSVQSVRFVAERGKHCILDVSGNAIKRLQVAQLYPIAIFIKPKSLE--PLMEMNKRLTEEQAKKTYDRAIKLEQEFGEYFTAIVQGDTLEDIYNQ-CKLVIEEQSGPFIWIPSKEK 851          
BLAST of 55 kDa erythrocyte membrane protein vs. TrEMBL
Match: A0A0N8K059 (Disks large1-like (Fragment) OS=Scleropages formosus OX=113540 GN=Z043_109884 PE=4 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 1.199e-37
Identity = 115/350 (32.86%), Postives = 195/350 (55.71%), Query Frame = 1
Query:  403 QTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRKPMEKSICGTDLENNFTNPYEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPTWVAAEDQ 1452
            +T Y+R L  Y+ S D GLP +GL FK GD+L V+NA+D +WWQA H+  +  +              G+IPS  RV+ K + + + V+F+SR+   G       E+ +  G      K ++   ++    E S  G   +  +   YE + QQ +  TRP++V+GP KD++ + L+ E+ D + + +PHTTRP R  E DG DYHF+++++++E +    K+I+ G++  + Y  S++SV++   K K+ +LD+S N I++L++A +YPI I I   S+     L+ + R      + T D  +KLE+EF+  F  II   T  ++  Q+ Q++        WVAA+++
Sbjct:   51 RTLYVRALFDYDKSKDSGLPSQGLNFKFGDILHVVNASDDEWWQARHVTPHGEVEEI-----------GVIPSKRRVEKKEKARLKTVKFNSRSRDKG-------EIPDDMGS-----KGLKHVTSNASDSESSYRG---QEEYVLSYETVCQQEVNYTRPVIVLGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQDHKFIEAGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKRLQTAQLYPIAIFIKPKSVEN--ILEMNKRLTEEQGRKTFDRAMKLEQEFTEHFTSIIQGDTLEDIYNQIKQIIEEQSGPYIWVAAKEK 372          
BLAST of 55 kDa erythrocyte membrane protein vs. TrEMBL
Match: A0A2Y9PW17 (disks large homolog 2 isoform X19 OS=Delphinapterus leucas OX=9749 GN=DLG2 PE=4 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 4.619e-37
Identity = 123/377 (32.63%), Postives = 202/377 (53.58%), Query Frame = 1
Query:  355 MNHTQQNSYITV-DNKVQTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRK-PMEKSICGTDLEN--------NFTNPYEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSP-TWVAAEDQ 1452
            MNH+  +   ++  N+ ++ Y+R +  Y+ S D GLP +GL FK GD+L VINA+D +WWQA  +                    G+IPS  RV+ K R + + V+F+++  VI   G             SF+ KR + F  SRK P  K+   ++ E         +F   YE + +Q I  TRP++++GP KD++ + L+ E+ D + + +PHTTRP R  E DG DYHF+ +++++E +    K+I+ G++  N Y  S++SV+    + K+ +LD+S N I++L+ A +YPI I I   SL     ++ + R      + T D  IKLE+EF   F  I+   T  ++  Q  +LV   Q  P  W+ ++++
Sbjct:    2 MNHSMSSGSGSLRTNQKRSLYVRAMFDYDKSKDSGLPSQGLSFKYGDILHVINASDDEWWQARRVTLEGDSEEM-----------GVIPSKRRVERKERARLKTVKFNAKPGVIDSKG-------------SFNDKRKKSFIFSRKFPFYKNKEQSEQETSDPERGQEDFILSYEPVTRQEINYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVISREQMEKDIQEHKFIEAGQYNDNLYGTSVQSVRFVAERGKHCILDVSGNAIKRLQVAQLYPIAIFIKPKSLE--PLMEMNKRLTEEQAKKTYDRAIKLEQEFGEYFTAIVQGDTLEDIYNQ-CKLVIEEQSGPFIWIPSKEK 351          
BLAST of 55 kDa erythrocyte membrane protein vs. TrEMBL
Match: A0A2U4CFM6 (disks large homolog 2 isoform X5 OS=Tursiops truncatus OX=9739 GN=DLG2 PE=4 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 4.619e-37
Identity = 123/377 (32.63%), Postives = 202/377 (53.58%), Query Frame = 1
Query:  355 MNHTQQNSYITV-DNKVQTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRK-PMEKSICGTDLEN--------NFTNPYEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSP-TWVAAEDQ 1452
            MNH+  +   ++  N+ ++ Y+R +  Y+ S D GLP +GL FK GD+L VINA+D +WWQA  +                    G+IPS  RV+ K R + + V+F+++  VI   G             SF+ KR + F  SRK P  K+   ++ E         +F   YE + +Q I  TRP++++GP KD++ + L+ E+ D + + +PHTTRP R  E DG DYHF+ +++++E +    K+I+ G++  N Y  S++SV+    + K+ +LD+S N I++L+ A +YPI I I   SL     ++ + R      + T D  IKLE+EF   F  I+   T  ++  Q  +LV   Q  P  W+ ++++
Sbjct:    2 MNHSMSSGSGSLRTNQKRSLYVRAMFDYDKSKDSGLPSQGLSFKYGDILHVINASDDEWWQARRVTLEGDSEEM-----------GVIPSKRRVERKERARLKTVKFNAKPGVIDSKG-------------SFNDKRKKSFIFSRKFPFYKNKEQSEQETSDPERGQEDFILSYEPVTRQEINYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVISREQMEKDIQEHKFIEAGQYNDNLYGTSVQSVRFVAERGKHCILDVSGNAIKRLQVAQLYPIAIFIKPKSLE--PLMEMNKRLTEEQAKKTYDRAIKLEQEFGEYFTAIVQGDTLEDIYNQ-CKLVIEEQSGPFIWIPSKEK 351          
BLAST of 55 kDa erythrocyte membrane protein vs. TrEMBL
Match: D2HZ32 (Uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca OX=9646 GN=PANDA_018043 PE=4 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 6.826e-37
Identity = 123/377 (32.63%), Postives = 202/377 (53.58%), Query Frame = 1
Query:  355 MNHTQQNSYITV-DNKVQTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRK-PMEKSICGTDLEN--------NFTNPYEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSP-TWVAAEDQ 1452
            MNH+  +   ++  N+ ++ Y+R +  Y+ S D GLP +GL FK GD+L VINA+D +WWQA  +                    G+IPS  RV+ K R + + V+F+++  VI   G             SF+ KR + F  SRK P  K+   ++ E         +F   YE + +Q I  TRP++++GP KD++ + L+ E+ D + + +PHTTRP R  E DG DYHF+ +++++E +    K+I+ G++  N Y  S++SV+    + K+ +LD+S N I++L+ A +YPI I I   SL     ++ + R      + T D  IKLE+EF   F  I+   T  ++  Q  +LV   Q  P  W+ ++++
Sbjct:   17 MNHSMSSGSGSLRTNQKRSLYVRAMFDYDKSKDSGLPSQGLSFKYGDILHVINASDDEWWQARRVTLEGDSEEM-----------GVIPSKRRVERKERARLKTVKFNAKPGVIDSKG-------------SFNDKRKKSFIFSRKFPFYKNKEQSEQETSDPERGQEDFILSYEPVTRQEINYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKREYEVDGRDYHFVISREQMEKDIQEHKFIEAGQYNDNLYGTSVQSVRFVAERGKHCILDVSGNAIKRLQVAQLYPIAIFIKPKSLE--PLMEMNKRLTEEQAKKTYDRAIKLEQEFGEYFTAIVQGDTLEDIYNQ-CKLVIEEQSGPFIWIPSKEK 366          
BLAST of 55 kDa erythrocyte membrane protein vs. TrEMBL
Match: A0A2U4CFM2 (disks large homolog 2 isoform X4 OS=Tursiops truncatus OX=9739 GN=DLG2 PE=4 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 7.152e-37
Identity = 123/377 (32.63%), Postives = 202/377 (53.58%), Query Frame = 1
Query:  355 MNHTQQNSYITV-DNKVQTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRK-PMEKSICGTDLEN--------NFTNPYEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSP-TWVAAEDQ 1452
            MNH+  +   ++  N+ ++ Y+R +  Y+ S D GLP +GL FK GD+L VINA+D +WWQA  +                    G+IPS  RV+ K R + + V+F+++  VI   G             SF+ KR + F  SRK P  K+   ++ E         +F   YE + +Q I  TRP++++GP KD++ + L+ E+ D + + +PHTTRP R  E DG DYHF+ +++++E +    K+I+ G++  N Y  S++SV+    + K+ +LD+S N I++L+ A +YPI I I   SL     ++ + R      + T D  IKLE+EF   F  I+   T  ++  Q  +LV   Q  P  W+ ++++
Sbjct:   29 MNHSMSSGSGSLRTNQKRSLYVRAMFDYDKSKDSGLPSQGLSFKYGDILHVINASDDEWWQARRVTLEGDSEEM-----------GVIPSKRRVERKERARLKTVKFNAKPGVIDSKG-------------SFNDKRKKSFIFSRKFPFYKNKEQSEQETSDPERGQEDFILSYEPVTRQEINYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVISREQMEKDIQEHKFIEAGQYNDNLYGTSVQSVRFVAERGKHCILDVSGNAIKRLQVAQLYPIAIFIKPKSLE--PLMEMNKRLTEEQAKKTYDRAIKLEQEFGEYFTAIVQGDTLEDIYNQ-CKLVIEEQSGPFIWIPSKEK 378          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Cavefish
Match: dlg1 (disks large homolog 1 [Source:NCBI gene;Acc:103021716])

HSP 1 Score: 142.51 bits (358), Expect = 3.343e-35
Identity = 108/350 (30.86%), Postives = 188/350 (53.71%), Query Frame = 1
Query:  403 QTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRKPMEKSICGTDLENNFTNPYEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPTWVAAEDQ 1452
            +T Y+R L  Y+ + D GLP +GL F+ GD+L V+NA+D +WWQA  +  +  +              G+IPS  RV+ K R + + V+F+S++   G                  D K ++   ++    E S  G   +  +   YE + QQ +  TRP++++GP KD++ + L+ E+ D + + +PHTTRP R  E DG DYHF+ +++++E +    K+I+ G++  + Y  S++SV++   K K+ +LD+S N I++L+ A ++PI + +   S+     L+ + R      + T D  +KLE+EF+  F  I+   T  E+  QV Q++        WV A+D+
Sbjct:  560 RTLYVRALFDYDRTKDSGLPSQGLNFRFGDILHVLNASDDEWWQARQVTTDGEVEEI-----------GVIPSKRRVERKERARLKTVKFNSKSRDKGDLS---------------DDKGMKHVTSNASDSESSYRG---QEEYVLSYETVMQQEVSYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVVSREQMEKDIQDHKFIEAGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKRLQLAQLFPIAVFVKPKSVEN--ILEMNKRLSEEQGKKTFDRAMKLEQEFTEHFTSIVQGDTLEEIYNQVKQIIEEQSGPYIWVPAKDK 878          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Cavefish
Match: dlg1 (disks large homolog 1 [Source:NCBI gene;Acc:103021716])

HSP 1 Score: 142.51 bits (358), Expect = 3.646e-35
Identity = 108/350 (30.86%), Postives = 188/350 (53.71%), Query Frame = 1
Query:  403 QTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRKPMEKSICGTDLENNFTNPYEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPTWVAAEDQ 1452
            +T Y+R L  Y+ + D GLP +GL F+ GD+L V+NA+D +WWQA  +  +  +              G+IPS  RV+ K R + + V+F+S++   G                  D K ++   ++    E S  G   +  +   YE + QQ +  TRP++++GP KD++ + L+ E+ D + + +PHTTRP R  E DG DYHF+ +++++E +    K+I+ G++  + Y  S++SV++   K K+ +LD+S N I++L+ A ++PI + +   S+     L+ + R      + T D  +KLE+EF+  F  I+   T  E+  QV Q++        WV A+D+
Sbjct:  520 RTLYVRALFDYDRTKDSGLPSQGLNFRFGDILHVLNASDDEWWQARQVTTDGEVEEI-----------GVIPSKRRVERKERARLKTVKFNSKSRDKGDLS---------------DDKGMKHVTSNASDSESSYRG---QEEYVLSYETVMQQEVSYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVVSREQMEKDIQDHKFIEAGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKRLQLAQLFPIAVFVKPKSVEN--ILEMNKRLSEEQGKKTFDRAMKLEQEFTEHFTSIVQGDTLEEIYNQVKQIIEEQSGPYIWVPAKDK 838          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Cavefish
Match: dlg1 (disks large homolog 1 [Source:NCBI gene;Acc:103021716])

HSP 1 Score: 142.124 bits (357), Expect = 4.645e-35
Identity = 108/350 (30.86%), Postives = 188/350 (53.71%), Query Frame = 1
Query:  403 QTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRKPMEKSICGTDLENNFTNPYEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPTWVAAEDQ 1452
            +T Y+R L  Y+ + D GLP +GL F+ GD+L V+NA+D +WWQA  +  +  +              G+IPS  RV+ K R + + V+F+S++   G                  D K ++   ++    E S  G   +  +   YE + QQ +  TRP++++GP KD++ + L+ E+ D + + +PHTTRP R  E DG DYHF+ +++++E +    K+I+ G++  + Y  S++SV++   K K+ +LD+S N I++L+ A ++PI + +   S+     L+ + R      + T D  +KLE+EF+  F  I+   T  E+  QV Q++        WV A+D+
Sbjct:  588 RTLYVRALFDYDRTKDSGLPSQGLNFRFGDILHVLNASDDEWWQARQVTTDGEVEEI-----------GVIPSKRRVERKERARLKTVKFNSKSRDKGDLS---------------DDKGMKHVTSNASDSESSYRG---QEEYVLSYETVMQQEVSYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVVSREQMEKDIQDHKFIEAGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKRLQLAQLFPIAVFVKPKSVEN--ILEMNKRLSEEQGKKTFDRAMKLEQEFTEHFTSIVQGDTLEEIYNQVKQIIEEQSGPYIWVPAKDK 906          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Cavefish
Match: dlg1 (disks large homolog 1 [Source:NCBI gene;Acc:103021716])

HSP 1 Score: 139.813 bits (351), Expect = 2.431e-34
Identity = 108/356 (30.34%), Postives = 191/356 (53.65%), Query Frame = 1
Query:  403 QTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRKPMEKSICGTDLENNFTN------PYEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPTWVAAEDQ 1452
            +T Y+R L  Y+ + D GLP +GL F+ GD+L V+NA+D +WWQA  +  +  +              G+IPS  RV+ K R + + V+F+S++   G       + + S     +  K   +   S      +   +D E+++         YE + QQ +  TRP++++GP KD++ + L+ E+ D + + +PHTTRP R  E DG DYHF+ +++++E +    K+I+ G++  + Y  S++SV++   K K+ +LD+S N I++L+ A ++PI + +   S+     L+ + R      + T D  +KLE+EF+  F  I+   T  E+  QV Q++        WV A+D+
Sbjct:  512 RTLYVRALFDYDRTKDSGLPSQGLNFRFGDILHVLNASDDEWWQARQVTTDGEVEEI-----------GVIPSKRRVERKERARLKTVKFNSKSRDKGSLNDKRKKNLFSRKFPFYKNKEQSEQETSDLDQHVTSNASDSESSYRGQEEYVLSYETVMQQEVSYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVVSREQMEKDIQDHKFIEAGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKRLQLAQLFPIAVFVKPKSVEN--ILEMNKRLSEEQGKKTFDRAMKLEQEFTEHFTSIVQGDTLEEIYNQVKQIIEEQSGPYIWVPAKDK 854          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Cavefish
Match: dlg1 (disks large homolog 1 [Source:NCBI gene;Acc:103021716])

HSP 1 Score: 140.198 bits (352), Expect = 2.493e-34
Identity = 108/356 (30.34%), Postives = 191/356 (53.65%), Query Frame = 1
Query:  403 QTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRKPMEKSICGTDLENNFTN------PYEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPTWVAAEDQ 1452
            +T Y+R L  Y+ + D GLP +GL F+ GD+L V+NA+D +WWQA  +  +  +              G+IPS  RV+ K R + + V+F+S++   G       + + S     +  K   +   S      +   +D E+++         YE + QQ +  TRP++++GP KD++ + L+ E+ D + + +PHTTRP R  E DG DYHF+ +++++E +    K+I+ G++  + Y  S++SV++   K K+ +LD+S N I++L+ A ++PI + +   S+     L+ + R      + T D  +KLE+EF+  F  I+   T  E+  QV Q++        WV A+D+
Sbjct:  592 RTLYVRALFDYDRTKDSGLPSQGLNFRFGDILHVLNASDDEWWQARQVTTDGEVEEI-----------GVIPSKRRVERKERARLKTVKFNSKSRDKGSLNDKRKKNLFSRKFPFYKNKEQSEQETSDLDQHVTSNASDSESSYRGQEEYVLSYETVMQQEVSYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVVSREQMEKDIQDHKFIEAGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKRLQLAQLFPIAVFVKPKSVEN--ILEMNKRLSEEQGKKTFDRAMKLEQEFTEHFTSIVQGDTLEEIYNQVKQIIEEQSGPYIWVPAKDK 934          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Sea Lamprey
Match: mpp7a (membrane protein, palmitoylated 7a (MAGUK p55 subfamily member 7) [Source:NCBI gene;Acc:30166])

HSP 1 Score: 79.337 bits (194), Expect = 7.390e-16
Identity = 78/328 (23.78%), Postives = 143/328 (43.60%), Query Frame = 1
Query:  502 VINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRKPMEKSICGTDLENNFTNPYEIIEQ---QIIKTTRPIVVIGP---GKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQ----------INLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPTWV 1437
            V++ +DS WWQA                   +   GLIPS      K   ++R     +R     P  +  S+   S    SF L R  +   + K M +S    + + +  + YE + Q   Q     R IV++GP   G ++L   L+     +Y+  +P TTR  +  E+D  +Y+F+S +   E++ +++++++ G+FKGN Y  S+++++  +   K  LLD+S   I+ +R+    P  I +   SL + +  +G  +            + D Q       ++E +F  LFD  +     A    ++     + +R   WV
Sbjct:  264 VVSQDDSMWWQA-------------KRTEQSNMRAGLIPS------KHYMERR---LAARQPASPPIVQKSSKSRLSGLRRSFRLSR--QSRKTSKLMYESKRSAEYDASEVSTYEEVLQYQHQPGDKYRVIVLVGPPGVGINELKRRLIASDPSLYSGTVPTTTRQKKSHEKDSKEYYFVS-RHLFEADLHNNRFVEYGEFKGNLYGTSVDAIRSVVNAGKVCLLDVSPPAIKSIRTPEFKPFVIFVKPPSLERLRQTRGAAKSSGDKNPARNFTDEDFQEMLGTAARMEAQFGYLFDKTVVNDELAAAYRELRAAADSLERETMWV 566          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004699.1 (pep scaffold:Pmarinus_7.0:GL501143:686031:770336:1 gene:ENSPMAG00000004247.1 transcript:ENSPMAT00000004699.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.2478 bits (173), Expect = 2.458e-13
Identity = 48/197 (24.37%), Postives = 95/197 (48.22%), Query Frame = 1
Query:  871 KTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDG--------RQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPTWV 1437
            KT   I   G G+  L   LL+     Y   +P T+RPPR  E++G  Y+F+S  D +E++  + +Y++ G+++GN Y   IES+   +   K  +LD++   ++ LR+A   P  + ++  +L   + +               + D++ T D ++++++ +S  FD+ I          ++   +    + P WV
Sbjct:  262 KTLMLIGAQGVGRRSLKNRLLVANPSRYGMIVPFTSRPPRDDEKEGQGYYFVSRAD-MEADIRAGRYLESGEYEGNLYGTKIESIHGVVRTGKMCILDVNPQALKVLRTAEFMPFVVFVAAPTLETLRAMHRAALDAGATSKHLTDTDLKKTVDESVRIQRAYSHFFDLKIVNNNMDVAFAKLRAALEGLGKGPQWV 457          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Sea Lamprey
Match: MPP5 (membrane palmitoylated protein 5 [Source:HGNC Symbol;Acc:HGNC:18669])

HSP 1 Score: 68.1662 bits (165), Expect = 3.017e-13
Identity = 50/178 (28.09%), Postives = 91/178 (51.12%), Query Frame = 1
Query:  859 QQIIKTTRPIVVIGP---GKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQG--------DGRQINLDVQSTRDYTIKLEKEFSVLFDVII 1359
             Q     RPIV+IGP   G+++L   L+   +D +    PHTTR  R  E DG DYHF+S +   E++    K+I+ G+F+ N Y  SI+SV+Q +   K  +L++    ++ L+++ + P  I ++  S  + + +            R +  +++   +   ++E+ +   FD II
Sbjct:   35 HQPANRKRPIVLIGPPNCGRNELRTRLMESDADRFAAATPHTTRGMRDNEVDGRDYHFVS-RQAFEADIGVHKFIEHGEFEKNLYGTSIDSVRQVINSGKICVLNLHTQSLKLLKNSDLKPYIIFVAPPSQERLRAMMAKESKNPKVSARFLPEELREVIEKAREMEQGYGHYFDGII 211          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Sea Lamprey
Match: guk1b (guanylate kinase 1b [Source:ZFIN;Acc:ZDB-GENE-020916-1])

HSP 1 Score: 66.2402 bits (160), Expect = 1.181e-12
Identity = 41/124 (33.06%), Postives = 72/124 (58.06%), Query Frame = 1
Query:  880 RPIVVIGP---GKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSL 1242
            RP+V+ GP   GK  L + L+ EY+D++   + HTTR PR GE DG DYHF+  ++E+E    + ++I+  +F GN Y  S ++V+     ++  +LD+   G+  ++   + P+ + I   S+
Sbjct:   20 RPVVLSGPSGAGKSTLVKRLMQEYADVFGFSVSHTTRNPRAGEVDGKDYHFVC-REEMEKGILADEFIEHAEFSGNLYGTSKKAVEVIRDHNQICILDLDIQGVRSMKRTTLNPLYLSIHPPSI 142          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006611.1 (pep scaffold:Pmarinus_7.0:GL481772:5454:8357:-1 gene:ENSPMAG00000005965.1 transcript:ENSPMAT00000006611.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.4698 bits (158), Expect = 1.681e-12
Identity = 57/181 (31.49%), Postives = 92/181 (50.83%), Query Frame = 1
Query:  880 RPIVVIGP---GKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSV---LFDVIISPTTAAELKEQVVQL 1404
            RP+V+ GP   GK  L + L+ E+  ++   + HTTR PRPGE  G DYHF++ ++E+     + ++I+  ++ GN Y  S  +V+  L K++  +LDI   G+  ++   + P+ I I   S++  +      +  N D    R    K E EFS     FD I+      EL+E   QL
Sbjct:    5 RPVVLSGPSGCGKSTLIKKLMSEFEGVFGLSVSHTTRNPRPGEVTGKDYHFVT-REEMLRLIAAREFIEHAEYSGNLYGTSKSAVRAVLDKNQICILDIDMQGVHSMKKTDLNPLYISIQPPSITILEERLRLRKTENDDSLKRRLKAAKKEIEFSKEPGAFDAIV---VNDELQEAYAQL 181          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Yeast
Match: GUK1 (Guanylate kinase; converts GMP to GDP; required for growth and mannose outer chain elongation of cell wall N-linked glycoproteins [Source:SGD;Acc:S000002862])

HSP 1 Score: 68.9366 bits (167), Expect = 4.657e-14
Identity = 42/110 (38.18%), Postives = 67/110 (60.91%), Query Frame = 1
Query:  877 TRPIVVIGP---GKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRS 1197
            +RPIV+ GP   GK  L + L  EY D +   +  TTR PR GE +G DY+F+S  DE +S   ++++I+  +F GN+Y +++ SVKQ     K  +LDI   G++ +++
Sbjct:    2 SRPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRAGEVNGKDYNFVS-VDEFKSMIKNNEFIEWAQFSGNYYGSTVASVKQVSKSGKTCILDIDMQGVKSVKA 110          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Nematostella
Match: EDO46060 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR66])

HSP 1 Score: 140.198 bits (352), Expect = 9.007e-37
Identity = 115/370 (31.08%), Postives = 188/370 (50.81%), Query Frame = 1
Query:  409 FYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRK----PMEKSICGTDLENNFTN------------------PYEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPTWVAAEDQ 1452
             Y+R L  Y+ + D GLP +GL FK GD+L V NA+D +WWQA  +                    G+IPS  RV+ + + + + V+F   +       KL     +  G       R R F  S+K      E  +  +D++ ++T+                   YE ++Q  +K TRP++V+GP KD++ + L+ E+ D + + +PHTTRP R  E+DG+DYHF+ +++E+E    +  +I+ G++  N Y  S+ESVK    KSK+ +LD+S   I++L+ A +YPI I I   S+   + L  + R      Q T D  +KLE+EF   F  I+   T  EL  +V +++        WV ++++
Sbjct:   17 LYVRALFDYDKTKDSGLPSQGLSFKYGDILHVTNASDDEWWQARKLNAVGEEEGR-----------GVIPSKRRVERREKARMKSVKFTRTS-----DDKLRGSFNDGTGSV-----RKRSFKFSKKLPFFKKESDLETSDVDPSYTSNASDSESSTSARAEEPILSYEAVQQHELKYTRPVIVLGPLKDRINDDLISEFPDKFGSCVPHTTRPRRDYEKDGLDYHFVESREEMERAIQNHMFIEAGQYNDNLYGTSVESVKIVAEKSKHCILDVSGYAIKRLQVAGLYPIAIFIKPKSMESIREL--NKRLTEEQAQKTFDRALKLEQEFGEYFTAIVQGDTYDELYNRVKEVIRQQSGPVIWVPSKER 363          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Nematostella
Match: EDO37539 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFE1])

HSP 1 Score: 63.929 bits (154), Expect = 8.610e-12
Identity = 43/188 (22.87%), Postives = 94/188 (50.00%), Query Frame = 1
Query:  898 GPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDG--------RQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPTWV 1437
            G G+  L   L++     + T IPHT+R  R GE+ G  Y F+S ++E+E +  + KY++ G++ GN Y   I+++++ +   K  ++D++   ++ L++    P  + I++ S  + K  Q           ++ + +++ T + + +L   ++  FD+ I+     E   ++   + +    P WV
Sbjct:    4 GVGRRTLKNKLIMSDRKRFGTTIPHTSRQMREGEQSGRGYFFVS-REEMERDIRAGKYLEFGEYGGNMYGTKIDTIREVMRSGKMCVVDVNPTALKVLKTPEFMPYIVCIASPSFEELKEFQSKALSEGIVNKKRSDDELRKTVEDSERLYNSYAHYFDLTIANDNVEEAFNKLQNAIESLSTHPQWV 190          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Nematostella
Match: EDO37538 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFE0])

HSP 1 Score: 66.6254 bits (161), Expect = 1.209e-11
Identity = 54/242 (22.31%), Postives = 113/242 (46.69%), Query Frame = 1
Query:  787 KPMEKSICGT--------------DLENNFTNPYEIIEQQIIKTTRPIVVIGP---GKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDG--------RQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPTWV 1437
            KP  K +CG+              D E +    YE + +      + +V+IG    G+  L   L++     + T IPHT+R  R GE+ G  Y F+S ++E+E +  + KY++ G++ GN Y   I+++++ +   K  ++D++   ++ L++    P  + I++ S  + K  Q           ++ + +++ T + + +L   ++  FD+ I+     E   ++   + +    P WV
Sbjct:  265 KPGSKFLCGSKKKQKVMYKSSKNFDFEKHELPIYEEVAKMPPFQRKTLVMIGAQGVGRRTLKNKLIMSDRKRFGTTIPHTSRQMREGEQSGRGYFFVS-REEMERDIRAGKYLEFGEYGGNMYGTKIDTIREVMRSGKMCVVDVNPTALKVLKTPEFMPYIVCIASPSFEELKEFQSKALSEGIVNKKRSDDELRKTVEDSERLYNSYAHYFDLTIANDNVEEAFNKLQNAIESLSTHPQWV 505          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Nematostella
Match: EDO33577 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRU3])

HSP 1 Score: 64.3142 bits (155), Expect = 7.837e-11
Identity = 54/203 (26.60%), Postives = 102/203 (50.25%), Query Frame = 1
Query:  880 RPIVVIGP---GKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGD--------------GRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPTWV 1437
            RPIV+IGP   G+ +L + L+    D +   IPHT+RP +PGE +  DYHF+  +    ++  + K+++ G+ + +FY  S +++K  +   K  +L++    ++ LR++ I P  I IS+ S  + + L+                 R+I+  V   R+    +E+ +   FD  I+ T      +++ Q++   +  P WV
Sbjct:  419 RPIVLIGPPKIGRKELRQRLIQYDPDRFAGAIPHTSRPIKPGEINDHDYHFVP-RHTFVTDIVAHKFVEHGELQDHFYGTSFDAIKMVINAGKTCILNLHCEALKTLRASNIKPYVIFISSPSYERVRALRRGKIDPFNPKLNVALTDREIHEMVAKARE----MEEAYGHYFDHTITNTDFERTFDELRQVIARLEDEPQWV 616          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Nematostella
Match: EDO31281 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYD3])

HSP 1 Score: 56.9954 bits (136), Expect = 1.286e-9
Identity = 33/108 (30.56%), Postives = 56/108 (51.85%), Query Frame = 1
Query: 1129 QALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPTWVAAEDQ 1452
            Q  ++SK+ +LD+S   I++L+ A +YPI I I   S+   + L  + R      Q T D  +KLE+EF   F  I+   T  EL  +V +++        WV ++++
Sbjct:   57 QTYSESKHCILDVSGYAIKRLQVAGLYPIAIFIKPKSMESIREL--NKRLTEEQAQKTFDRALKLEQEFGEYFTAIVQGDTYDELYNRVKEVIRQQSGPVIWVPSKER 162          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Medaka
Match: dlg2 (disks large homolog 2 [Source:NCBI gene;Acc:101168565])

HSP 1 Score: 144.436 bits (363), Expect = 8.053e-36
Identity = 114/375 (30.40%), Postives = 195/375 (52.00%), Query Frame = 1
Query:  355 MNHTQQNSYITV-DNKVQTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRK-PM----EKSICGTDLENNFTN---PYEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPTWVAAEDQ 1452
            MNH+  +   ++  N+ ++ Y+R L  YE S D GLP +GL F+ GD+L VINA D +WWQA  +  +                 G+IPS  RV+ K R + + V+F+++             + +S   +SF     + F  +RK P     E    G+D + N       YE + +Q I   RP++++GP KD++ E L+ E+ D + + +PHTTR  R GE DG DYHF+++++++E +    K+I+ G++  N Y  S++SVK    + K+ +LD+S N I++L+ A ++PI I I   S+     L  + R      +   D  +KLE+EF   F  ++   +  ++  Q  Q++        W+ A+++
Sbjct:  439 MNHSMSSGSGSLRTNQKKSLYVRALFDYEKSKDSGLPSQGLSFRYGDILHVINAADDEWWQARRVTLHGDSEEM-----------GVIPSKRRVERKDRARLKTVKFNAK-------------LGSSDSRASFTDTHKKNFTFTRKFPFYKNKEDEQDGSDSQRNKDEGILSYESVLRQEIDYARPVIILGPMKDRINEDLISEFPDKFGSCVPHTTRQRRDGEVDGRDYHFVTSREQMERDIQEHKFIEAGQYNDNLYGTSVQSVKYVAERGKHCILDVSGNAIKRLQVAHLFPIAIFIKPKSVES--LLDMNKRLSEEQARKMFDRAMKLEQEFGEFFTAMVQGDSLEDMYNQCKQVIEENSGPYIWIPAKEK 787          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Medaka
Match: dlg2 (disks large homolog 2 [Source:NCBI gene;Acc:101168565])

HSP 1 Score: 144.436 bits (363), Expect = 9.162e-36
Identity = 114/375 (30.40%), Postives = 195/375 (52.00%), Query Frame = 1
Query:  355 MNHTQQNSYITV-DNKVQTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRK-PM----EKSICGTDLENNFTN---PYEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPTWVAAEDQ 1452
            MNH+  +   ++  N+ ++ Y+R L  YE S D GLP +GL F+ GD+L VINA D +WWQA  +  +                 G+IPS  RV+ K R + + V+F+++             + +S   +SF     + F  +RK P     E    G+D + N       YE + +Q I   RP++++GP KD++ E L+ E+ D + + +PHTTR  R GE DG DYHF+++++++E +    K+I+ G++  N Y  S++SVK    + K+ +LD+S N I++L+ A ++PI I I   S+     L  + R      +   D  +KLE+EF   F  ++   +  ++  Q  Q++        W+ A+++
Sbjct:  494 MNHSMSSGSGSLRTNQKKSLYVRALFDYEKSKDSGLPSQGLSFRYGDILHVINAADDEWWQARRVTLHGDSEEM-----------GVIPSKRRVERKDRARLKTVKFNAK-------------LGSSDSRASFTDTHKKNFTFTRKFPFYKNKEDEQDGSDSQRNKDEGILSYESVLRQEIDYARPVIILGPMKDRINEDLISEFPDKFGSCVPHTTRQRRDGEVDGRDYHFVTSREQMERDIQEHKFIEAGQYNDNLYGTSVQSVKYVAERGKHCILDVSGNAIKRLQVAHLFPIAIFIKPKSVES--LLDMNKRLSEEQARKMFDRAMKLEQEFGEFFTAMVQGDSLEDMYNQCKQVIEENSGPYIWIPAKEK 842          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Medaka
Match: dlg2 (disks large homolog 2 [Source:NCBI gene;Acc:101168565])

HSP 1 Score: 144.05 bits (362), Expect = 9.583e-36
Identity = 114/375 (30.40%), Postives = 195/375 (52.00%), Query Frame = 1
Query:  355 MNHTQQNSYITV-DNKVQTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRK-PM----EKSICGTDLENNFTN---PYEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPTWVAAEDQ 1452
            MNH+  +   ++  N+ ++ Y+R L  YE S D GLP +GL F+ GD+L VINA D +WWQA  +  +                 G+IPS  RV+ K R + + V+F+++             + +S   +SF     + F  +RK P     E    G+D + N       YE + +Q I   RP++++GP KD++ E L+ E+ D + + +PHTTR  R GE DG DYHF+++++++E +    K+I+ G++  N Y  S++SVK    + K+ +LD+S N I++L+ A ++PI I I   S+     L  + R      +   D  +KLE+EF   F  ++   +  ++  Q  Q++        W+ A+++
Sbjct:  476 MNHSMSSGSGSLRTNQKKSLYVRALFDYEKSKDSGLPSQGLSFRYGDILHVINAADDEWWQARRVTLHGDSEEM-----------GVIPSKRRVERKDRARLKTVKFNAK-------------LGSSDSRASFTDTHKKNFTFTRKFPFYKNKEDEQDGSDSQRNKDEGILSYESVLRQEIDYARPVIILGPMKDRINEDLISEFPDKFGSCVPHTTRQRRDGEVDGRDYHFVTSREQMERDIQEHKFIEAGQYNDNLYGTSVQSVKYVAERGKHCILDVSGNAIKRLQVAHLFPIAIFIKPKSVES--LLDMNKRLSEEQARKMFDRAMKLEQEFGEFFTAMVQGDSLEDMYNQCKQVIEENSGPYIWIPAKEK 824          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Medaka
Match: dlg3 (discs large MAGUK scaffold protein 3 [Source:NCBI gene;Acc:101169708])

HSP 1 Score: 133.65 bits (335), Expect = 5.729e-34
Identity = 114/373 (30.56%), Postives = 189/373 (50.67%), Query Frame = 1
Query:  403 QTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRK-PMEKSICG-----TDLENNFTN-----------------PYEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPTWVAAEDQ 1452
            ++ Y+R L  Y+ + D  LP +GL F  GD+L VINA+D +WWQA  +  +                 G+IPS +RV+ K R + + V+F +R      TG + S   N P      +KR + FN SRK P  KS         D E   T+                  YE + +Q I  TRP++++GP KD++ + L+ E+   + + +PHTTRP R  E DG DYHF+++++++E +   +K+I+ G+F  N Y  SI SV+    + K+ +LD+S N I++L+ A +YPI I I   S+     ++ + RQ         D  +KLE++F   F  I+   +  E+  ++  ++        W+ + ++
Sbjct:   19 RSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGESEQI-----------GVIPSKKRVEKKERARLKTVKFHAR------TGMIES---NRP----VKVKRKKSFNLSRKFPFYKSKENIAYEQVDPEQCLTSNTSDSESSSKGQEDTILSYEPVIRQEIHYTRPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRENEMDGQDYHFVASREQMEKDIQDNKFIEAGQFNENLYGTSILSVRTVAERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSIE--ALMEMNKRQTYDQANKVFDKAVKLEQDFGEFFTAIVQGDSLEEIYNKIKLIIEEQSGPYIWIPSSEK 365          
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Medaka
Match: dlg2 (disks large homolog 2 [Source:NCBI gene;Acc:101168565])

HSP 1 Score: 138.272 bits (347), Expect = 9.352e-34
Identity = 113/377 (29.97%), Postives = 187/377 (49.60%), Query Frame = 1
Query:  355 MNHTQQNSYITV-DNKVQTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEF-------DSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRKPMEKSICGTDLENNFTN---PYEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPTWVAAEDQ 1452
            MNH+  +   ++  N+ ++ Y+R L  YE S D GLP +GL F+ GD+L VINA D +WWQA  +  +                 G+IPS  RV+ K R + + V+F       DSRA ++G         I   G                        GT +  N       YE + +Q I   RP++++GP KD++ E L+ E+ D + + +PHTTR  R GE DG DYHF+++++++E +    K+I+ G++  N Y  S++SVK    + K+ +LD+S N I++L+ A ++PI I I   S+     L  + R      +   D  +KLE+EF   F  ++   +  ++  Q  Q++        W+ A+++
Sbjct:  494 MNHSMSSGSGSLRTNQKKSLYVRALFDYEKSKDSGLPSQGLSFRYGDILHVINAADDEWWQARRVTLHGDSEEM-----------GVIPSKRRVERKDRARLKTVKFNAKLGSSDSRADILG---------IGDDGY-----------------------GTKISRNKDEGILSYESVLRQEIDYARPVIILGPMKDRINEDLISEFPDKFGSCVPHTTRQRRDGEVDGRDYHFVTSREQMERDIQEHKFIEAGQYNDNLYGTSVQSVKYVAERGKHCILDVSGNAIKRLQVAHLFPIAIFIKPKSVES--LLDMNKRLSEEQARKMFDRAMKLEQEFGEFFTAMVQGDSLEDMYNQCKQVIEENSGPYIWIPAKEK 825          
BLAST of 55 kDa erythrocyte membrane protein vs. Planmine SMEST
Match: SMESG000017603.1 (SMESG000017603.1)

HSP 1 Score: 638.262 bits (1645), Expect = 0.000e+0
Identity = 369/371 (99.46%), Postives = 371/371 (100.00%), Query Frame = 1
Query:  355 MNHTQQNSYITVDNKVQTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRKPMEKSICGTDLENNFTNPYEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPTWVAAEDQSLLNI 1467
            MNHTQQNSYITVDNKVQTFYIRTLCSYEPSLDKGLPGKGLKFKPGDLLLVINANDSQWWQAVHIRRNLFLSSNNLHNSSLSRERGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSE+INSPGCSSFDLKRIRKFNNSRKPMEKSICGTDLENNFTNPYEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNTPIPHTTRPPRPGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPT+AAELKEQVVQLVHAYQRSPTWVAAEDQSLLNI
Sbjct:    1 MNHTQQNSYITVDNKVQTFYIRTLCSYEPSLDKGLPGKGLKFKPGDLLLVINANDSQWWQAVHIRRNLFLSSNNLHNSSLSRERGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEIINSPGCSSFDLKRIRKFNNSRKPMEKSICGTDLENNFTNPYEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNTPIPHTTRPPRPGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTSAAELKEQVVQLVHAYQRSPTWVAAEDQSLLNI 371          
BLAST of 55 kDa erythrocyte membrane protein vs. Planmine SMEST
Match: SMESG000045568.1 (SMESG000045568.1)

HSP 1 Score: 160.614 bits (405), Expect = 8.702e-44
Identity = 119/365 (32.60%), Postives = 197/365 (53.97%), Query Frame = 1
Query:  382 ITVDNKVQTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINS---PGCSSFDLKRIRKFNNSRKPMEKSICGTDLENNFTNPYEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPTWVAAEDQSLLNI 1467
            I +D+K+++FY++TL  Y    D  LP KGL F+ G++L + NAND  WW A  +         +          G+IPS  R+  K + ++  V F+ + ++I   G    + INS   PG SS DLKR R+    +  M++++  TD + +  + YEI+E       RP++ IGPG+ +LY+ L++ Y +I+ +P+ HTTRP R  E +G DYHFI NK++  ++  +  +I+  ++ GNFY  S+ +V+  +   ++ ++D +   I+ L    I PI ILI   + + AK+L G+     L V+++  Y+  L  +    FDV +      EL ++    V   Q+   W  AEDQSL+ I
Sbjct:    8 IAIDDKIKSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDE--------GIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRKRQ----QATMQQNLTKTDQKMSINDFYEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEKL-VKNSMQYSSMLNSKERKSFDVKLKCQNMEELVKETFISVTNCQKWGVWKRAEDQSLIEI 359          
BLAST of 55 kDa erythrocyte membrane protein vs. Planmine SMEST
Match: SMESG000034854.1 (SMESG000034854.1)

HSP 1 Score: 100.138 bits (248), Expect = 1.318e-21
Identity = 105/365 (28.77%), Postives = 187/365 (51.23%), Query Frame = 1
Query:  409 FYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRKPM----EKSICGTDLENNFTNP------YEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDY--TIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPTWVAAEDQSLLNI 1467
            FY+R L  ++P ++K LP + L F   D++L++N+ D  WWQA  +  N                 G+IPS  R+  K +  K+ V FDS+  ++    K  S   N  G  SF +KR++  + S+       +KS     +   FT        YE + +  +   RP+V+IGP +D++ + L+ E+ +++ + +PHTTR  +P E  G DY+F+ ++ E+E +    ++I+ G++K N Y  SI +V+  +AK K+ +LD++   I++L +A + PI ILI   S+   K L     +I +  Q+ R+     +L+ + S  F  ++   +   L  Q+  +V     S  WV   +Q+ +N+
Sbjct:  762 FYVRALFEFDPDVEKNLPSRPLAFLTNDIILIVNSADPDWWQARVVEDNNENGPL-----------GIIPSPNRLYRKEKRNKKKVNFDSQ--LVSKNSKKNSLPRN--GKPSF-IKRMQLGSMSKSAQNITEDKSYADEYMNEKFTEANLMLLYYEPLVKISLDYVRPVVIIGPLRDKINDTLIDEHPNLFASCVPHTTRSKKPFEVHGKDYYFVKDRSEMEEQIKHQEFIEAGQYKDNLYGTSIAAVRD-VAKLKHCVLDVNALAIKRLVAANLLPITILIKPPSV---KALCNLSSKITV-AQADREVKKAEELQSKISHYFTAVVWEDSFNGLYSQIKSIVQCNSGSDIWVPT-NQNTVNL 1104          
BLAST of 55 kDa erythrocyte membrane protein vs. Planmine SMEST
Match: SMESG000034854.1 (SMESG000034854.1)

HSP 1 Score: 100.138 bits (248), Expect = 1.369e-21
Identity = 105/365 (28.77%), Postives = 187/365 (51.23%), Query Frame = 1
Query:  409 FYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRKPM----EKSICGTDLENNFTNP------YEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDY--TIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPTWVAAEDQSLLNI 1467
            FY+R L  ++P ++K LP + L F   D++L++N+ D  WWQA  +  N                 G+IPS  R+  K +  K+ V FDS+  ++    K  S   N  G  SF +KR++  + S+       +KS     +   FT        YE + +  +   RP+V+IGP +D++ + L+ E+ +++ + +PHTTR  +P E  G DY+F+ ++ E+E +    ++I+ G++K N Y  SI +V+  +AK K+ +LD++   I++L +A + PI ILI   S+   K L     +I +  Q+ R+     +L+ + S  F  ++   +   L  Q+  +V     S  WV   +Q+ +N+
Sbjct:  750 FYVRALFEFDPDVEKNLPSRPLAFLTNDIILIVNSADPDWWQARVVEDNNENGPL-----------GIIPSPNRLYRKEKRNKKKVNFDSQ--LVSKNSKKNSLPRN--GKPSF-IKRMQLGSMSKSAQNITEDKSYADEYMNEKFTEANLMLLYYEPLVKISLDYVRPVVIIGPLRDKINDTLIDEHPNLFASCVPHTTRSKKPFEVHGKDYYFVKDRSEMEEQIKHQEFIEAGQYKDNLYGTSIAAVRD-VAKLKHCVLDVNALAIKRLVAANLLPITILIKPPSV---KALCNLSSKITV-AQADREVKKAEELQSKISHYFTAVVWEDSFNGLYSQIKSIVQCNSGSDIWVPT-NQNTVNL 1092          
BLAST of 55 kDa erythrocyte membrane protein vs. Planmine SMEST
Match: SMESG000060935.1 (SMESG000060935.1)

HSP 1 Score: 79.337 bits (194), Expect = 2.434e-15
Identity = 103/382 (26.96%), Postives = 180/382 (47.12%), Query Frame = 1
Query:  403 QTFYIRTLCSYEPSXXXXXXXXXXXXXXXXXXXVINANDSQWWQAVHIXXXXXXXXXXXXXXXXXXXXGLIPSLERV--KNKSRFQKRHVEFDSRAMVIGPTG---------------KLVSEMINSPGCSSF-DLKR------IRKFNN-SRKPMEKSICGTDLENNFT---------NPYEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNXXXXXXXXXXXXGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNF-YANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQLVHAYQRSPTWVAA 1443
            +T Y+R L +Y+ + D GLP KGL FK GD+L V NA+DS+WWQA  +         +L         G+IPS  RV  +NK++ +K  +  D    ++                   KL +  +  P      D K+        +F   S+   + +    + EN+ T           Y+ + Q+     RP++++G  K+++ + LL EY++ +   +PHTTRP    + DG D++F+S   E+    ++ ++I+ G+  GNF Y  S++S+       K+ +LDIS   I++L    I+PI ILI   S+   ++L          +++    + +LE+EF      IIS +    + +QV+Q +        W+ +
Sbjct:  174 KTLYVRALFNYQVNKDCGLPNKGLSFKFGDILHVTNASDSEWWQARKVNLTTGEDETDL---------GIIPSKNRVERQNKTKQKKVRICVDDTIPIVDENDEYTISTSLSQSVGDIKLTANSLPRPQNGKIIDCKKQTNGGLFSRFKGKSKNKCQSNSINQESENDVTLARNSTESIQSYQPVIQEENSLIRPVIILGVAKEEINKSLLKEYNEEFGVCVPHTTRPIETDDIDGKDFYFVS-VSEMNELMSNHQFIETGR-SGNFLYGTSVQSIIDVAEAGKHCILDISSMAIKRLYIREIWPITILIQVQSIDDYRSLISKPVSEEQSLKALSKLS-RLEQEFLPFITAIISGSNFESVYQQVIQTIAINNGRKVWLPS 543          
The following BLAST results are available for this feature:
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DLG26.359e-3831.79discs large MAGUK scaffold protein 2 [Source:HGNC ... [more]
DLG21.024e-3731.25discs large MAGUK scaffold protein 2 [Source:HGNC ... [more]
DLG28.782e-3732.36discs large MAGUK scaffold protein 2 [Source:HGNC ... [more]
DLG29.610e-3732.36discs large MAGUK scaffold protein 2 [Source:HGNC ... [more]
DLG19.698e-3731.34discs large MAGUK scaffold protein 1 [Source:HGNC ... [more]
back to top
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dlg-11.463e-2629.64Disks large homolog 1 [Source:UniProtKB/Swiss-Pro... [more]
magu-29.602e-825.48MAGUK family [Source:UniProtKB/TrEMBL;Acc:A0A3B1D... [more]
magu-29.602e-825.48MAGUK family [Source:UniProtKB/TrEMBL;Acc:A0A3B1D... [more]
magu-21.451e-725.48MAGUK family [Source:UniProtKB/TrEMBL;Acc:A0A3B1D... [more]
magu-21.451e-725.48MAGUK family [Source:UniProtKB/TrEMBL;Acc:A0A3B1D... [more]
back to top
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dlg11.916e-3431.82gene:FBgn0001624 transcript:FBtr0333262[more]
dlg11.824e-3230.56gene:FBgn0001624 transcript:FBtr0073490[more]
dlg12.606e-3230.56gene:FBgn0001624 transcript:FBtr0073488[more]
dlg12.685e-3230.56gene:FBgn0001624 transcript:FBtr0112812[more]
dlg12.229e-3129.97gene:FBgn0001624 transcript:FBtr0330390[more]
back to top
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dlg17.679e-3630.57discs, large homolog 1 (Drosophila) [Source:NCBI g... [more]
dlg19.198e-3529.71discs, large homolog 1 (Drosophila) [Source:NCBI g... [more]
dlg37.004e-3430.83discs, large homolog 3 (Drosophila) [Source:ZFIN;A... [more]
dlg37.004e-3430.83discs, large homolog 3 (Drosophila) [Source:ZFIN;A... [more]
dlg37.969e-3431.42discs, large homolog 3 (Drosophila) [Source:ZFIN;A... [more]
back to top
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hjv1.430e-3731.48hemojuvelin BMP co-receptor [Source:Xenbase;Acc:XB... [more]
hjv2.371e-3731.48hemojuvelin BMP co-receptor [Source:Xenbase;Acc:XB... [more]
hjv2.581e-3731.48hemojuvelin BMP co-receptor [Source:Xenbase;Acc:XB... [more]
hjv2.972e-3731.48hemojuvelin BMP co-receptor [Source:Xenbase;Acc:XB... [more]
hjv2.853e-3529.35hemojuvelin BMP co-receptor [Source:Xenbase;Acc:XB... [more]
back to top
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dlg26.506e-3732.36discs large MAGUK scaffold protein 2 [Source:MGI S... [more]
Dlg11.234e-3631.05discs large MAGUK scaffold protein 1 [Source:MGI S... [more]
Dlg21.763e-3631.20discs large MAGUK scaffold protein 2 [Source:MGI S... [more]
Dlg16.845e-3630.86discs large MAGUK scaffold protein 1 [Source:MGI S... [more]
Dlg11.025e-3530.86discs large MAGUK scaffold protein 1 [Source:MGI S... [more]
back to top
BLAST of 55 kDa erythrocyte membrane protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q15700|DLG2_HUMAN4.940e-3632.36Disks large homolog 2 OS=Homo sapiens OX=9606 GN=D... [more]
sp|Q62696|DLG1_RAT6.992e-3631.05Disks large homolog 1 OS=Rattus norvegicus OX=1011... [more]
sp|Q12959|DLG1_HUMAN4.934e-3531.43Disks large homolog 1 OS=Homo sapiens OX=9606 GN=D... [more]
sp|Q811D0|DLG1_MOUSE7.169e-3530.86Disks large homolog 1 OS=Mus musculus OX=10090 GN=... [more]
sp|Q91XM9|DLG2_MOUSE1.826e-3431.25Disks large homolog 2 OS=Mus musculus OX=10090 GN=... [more]
back to top
BLAST of 55 kDa erythrocyte membrane protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0N8K0591.199e-3732.86Disks large1-like (Fragment) OS=Scleropages formos... [more]
A0A2Y9PW174.619e-3732.63disks large homolog 2 isoform X19 OS=Delphinapteru... [more]
A0A2U4CFM64.619e-3732.63disks large homolog 2 isoform X5 OS=Tursiops trunc... [more]
D2HZ326.826e-3732.63Uncharacterized protein (Fragment) OS=Ailuropoda m... [more]
A0A2U4CFM27.152e-3732.63disks large homolog 2 isoform X4 OS=Tursiops trunc... [more]
back to top
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dlg13.343e-3530.86disks large homolog 1 [Source:NCBI gene;Acc:103021... [more]
dlg13.646e-3530.86disks large homolog 1 [Source:NCBI gene;Acc:103021... [more]
dlg14.645e-3530.86disks large homolog 1 [Source:NCBI gene;Acc:103021... [more]
dlg12.431e-3430.34disks large homolog 1 [Source:NCBI gene;Acc:103021... [more]
dlg12.493e-3430.34disks large homolog 1 [Source:NCBI gene;Acc:103021... [more]
back to top
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mpp7a7.390e-1623.78membrane protein, palmitoylated 7a (MAGUK p55 subf... [more]
ENSPMAT00000004699.12.458e-1324.37pep scaffold:Pmarinus_7.0:GL501143:686031:770336:1... [more]
MPP53.017e-1328.09membrane palmitoylated protein 5 [Source:HGNC Symb... [more]
guk1b1.181e-1233.06guanylate kinase 1b [Source:ZFIN;Acc:ZDB-GENE-0209... [more]
ENSPMAT00000006611.11.681e-1231.49pep scaffold:Pmarinus_7.0:GL481772:5454:8357:-1 ge... [more]
back to top
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
GUK14.657e-1438.18Guanylate kinase; converts GMP to GDP; required fo... [more]
back to top
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO460609.007e-3731.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375398.610e-1222.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375381.209e-1122.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO335777.837e-1126.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO312811.286e-930.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 55 kDa erythrocyte membrane protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dlg28.053e-3630.40disks large homolog 2 [Source:NCBI gene;Acc:101168... [more]
dlg29.162e-3630.40disks large homolog 2 [Source:NCBI gene;Acc:101168... [more]
dlg29.583e-3630.40disks large homolog 2 [Source:NCBI gene;Acc:101168... [more]
dlg35.729e-3430.56discs large MAGUK scaffold protein 3 [Source:NCBI ... [more]
dlg29.352e-3429.97disks large homolog 2 [Source:NCBI gene;Acc:101168... [more]
back to top
BLAST of 55 kDa erythrocyte membrane protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017603.10.000e+099.46SMESG000017603.1[more]
SMESG000045568.18.702e-4432.60SMESG000045568.1[more]
SMESG000034854.11.318e-2128.77SMESG000034854.1[more]
SMESG000034854.11.369e-2128.77SMESG000034854.1[more]
SMESG000060935.12.434e-1526.96SMESG000060935.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016632 ID=SMED30016632|Name=55 kDa erythrocyte membrane protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1800bp
ATTTAATACATTATTGATTTAATATCGATCTATAAATAGATACAAGATTT
TTTTAATGGAAATTATTCTTTGTATTATGTGATTTAAGACAACGGTATTA
AGCACCGAAAATTTATGGAAAATCGAGTCGGATCTCGATTGCATAGCCAA
AATGTGTAATGAATAATTGATATTATCAGTGATAACACAGTCGATTCCGA
TATTAATTCAGTTGTTATGCTTAGTGTGCTAACTAATAAAACATAACTGA
TGACATAATTCTTTCTATTCATTGTTTTCCAATATTCGAGAATCAACTGG
TACGTTTCTATTGTCTCAATTTCATAAAATTTAGTGCAAGTGCCACAATT
TCACATGAATCATACCCAGCAAAATAGCTATATTACTGTGGATAACAAAG
TTCAGACATTTTATATCAGAACTCTTTGTTCCTATGAACCGTCATTAGAC
AAAGGTCTTCCTGGAAAGGGCCTGAAATTCAAACCTGGTGATTTACTTCT
TGTGATAAATGCGAACGACAGCCAGTGGTGGCAGGCTGTTCATATTAGAA
GAAATTTATTTTTATCTTCGAATAATCTGCACAATTCATCTTTATCTAGA
GAAAGAGGACTTATTCCAAGCCTTGAAAGAGTTAAAAACAAAAGTCGATT
TCAGAAACGACATGTTGAATTTGACTCAAGAGCAATGGTTATAGGTCCTA
CAGGAAAGTTAGTTTCAGAAATGATTAATAGTCCAGGGTGCAGTTCATTT
GATTTAAAAAGAATCAGGAAGTTTAATAATAGTCGAAAACCCATGGAGAA
AAGTATATGTGGCACAGATTTAGAAAACAATTTTACTAACCCATACGAAA
TTATCGAACAACAGATCATTAAAACAACTCGTCCCATTGTTGTAATTGGA
CCTGGAAAAGATCAACTTTATGAATATTTATTAATTGAATATTCTGACAT
CTACAATACTCCAATACCACATACTACAAGACCACCACGACCCGGTGAAC
GAGATGGGGTTGATTACCATTTCATTAGCAATAAGGATGAATTAGAGAGT
GAGACCAATTCATCAAAATATATTGATGTTGGGAAGTTCAAGGGAAATTT
TTACGCAAATAGTATCGAATCTGTCAAACAGGCATTAGCGAAAAGCAAAT
ATCCATTGTTGGATATCAGTCACAATGGAATCGAAAAACTCCGTTCAGCG
GCTATTTACCCTATCTGTATTCTAATATCTACATCGTCTCTCAGTCAAGC
CAAAACATTACAAGGGGATGGACGACAAATTAATCTTGATGTTCAGTCTA
CCAGAGATTATACTATAAAATTGGAAAAAGAATTCTCAGTTCTGTTTGAT
GTTATAATCTCTCCAACAACTGCAGCAGAATTGAAAGAGCAAGTAGTTCA
ATTAGTGCACGCATATCAAAGATCACCGACTTGGGTAGCAGCAGAAGATC
AGTCATTATTAAACATCAGTAGCAGTGAAAAAGAATCATAGCAGTAAAAA
TAGCAGTCCAATAGATATTAATATCCAATTTTTACACAAGCAATCTTTGT
TGCGTAGAAATGCTCTATTTTGTGCTTTGATACTTGTTCTGTAATTCGGT
CCTTCCACCGTTCGTGATATAGAGTTGAAATGTTTAGGTTTCTTGATTGA
ATGAATAGTTTTATTATTTTGATTACGCTGATAATTTTTATATTTCTCTA
TTTTAAATAATTATTTATTTGAGATTTTGCAAGTTTGAATGTTTGTTTTA
TCTTTGACTGTACAGAACTGTGATTATAGAGGAATATAAAATGCTTTCAC
back to top

protein sequence of SMED30016632-orf-1

>SMED30016632-orf-1 ID=SMED30016632-orf-1|Name=SMED30016632-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=379bp
MNHTQQNSYITVDNKVQTFYIRTLCSYEPSLDKGLPGKGLKFKPGDLLLV
INANDSQWWQAVHIRRNLFLSSNNLHNSSLSRERGLIPSLERVKNKSRFQ
KRHVEFDSRAMVIGPTGKLVSEMINSPGCSSFDLKRIRKFNNSRKPMEKS
ICGTDLENNFTNPYEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIY
NTPIPHTTRPPRPGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFY
ANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAK
TLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTTAAELKEQVVQL
VHAYQRSPTWVAAEDQSLLNISSSEKES*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016740transferase activity
GO:0005515protein binding
GO:0004385guanylate kinase activity
GO:0008022protein C-terminus binding
GO:0019894kinesin binding
GO:0019901protein kinase binding
GO:0019902phosphatase binding
GO:0030165PDZ domain binding
GO:0035255ionotropic glutamate receptor binding
Vocabulary: cellular component
TermDefinition
GO:0030863cortical cytoskeleton
GO:0032420stereocilium
GO:0034451centriolar satellite
GO:0042995cell projection
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0005829cytosol
GO:0005886plasma membrane
GO:0005902microvillus
GO:0009925basal plasma membrane
GO:0014069postsynaptic density
GO:0016020membrane
GO:0016323basolateral plasma membrane
GO:0030054cell junction
GO:0030315T-tubule
GO:0033270paranode region of axon
GO:0042383sarcolemma
GO:0042734presynaptic membrane
GO:0043005neuron projection
GO:0045202synapse
GO:0045211postsynaptic membrane
Vocabulary: biological process
TermDefinition
GO:0090022regulation of neutrophil chemotaxis
GO:0001935endothelial cell proliferation
GO:0007015actin filament organization
GO:0007155cell adhesion
GO:0007268chemical synaptic transmission
GO:0007399nervous system development
GO:0016337single organismal cell-cell adhesion
GO:0030866cortical actin cytoskeleton organization
GO:0032880regulation of protein localization
GO:0043113receptor clustering
GO:0043268positive regulation of potassium ion transport
GO:0045197establishment or maintenance of epithelial cell apical/basal polarity
GO:0045930negative regulation of mitotic cell cycle
GO:0046037GMP metabolic process
GO:0046710GDP metabolic process
GO:0097120receptor localization to synapse
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036028SH3-like_dom_sf
IPR008145GK/Ca_channel_bsu
IPR027417P-loop_NTPase
IPR020590Guanylate_kinase_CS
IPR008144Guanylate_kin-like_dom
IPR001452SH3_domain
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008145Guanylate kinase/L-type calcium channel beta subunitSMARTSM00072gk_7coord: 174..355
e-value: 2.0E-31
score: 120.4
IPR008145Guanylate kinase/L-type calcium channel beta subunitPFAMPF00625Guanylate_kincoord: 175..350
e-value: 9.3E-35
score: 119.9
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 169..354
e-value: 6.8E-45
score: 154.8
NoneNo IPR availableGENE3DG3DSA:2.30.30.40coord: 11..115
e-value: 2.8E-18
score: 67.8
NoneNo IPR availablePANTHERPTHR23122:SF70coord: 15..366
NoneNo IPR availablePANTHERPTHR23122MEMBRANE-ASSOCIATED GUANYLATE KINASE MAGUKcoord: 15..366
IPR020590Guanylate kinase, conserved sitePROSITEPS00856GUANYLATE_KINASE_1coord: 207..224
IPR008144Guanylate kinase-like domainPROSITEPS50052GUANYLATE_KINASE_2coord: 175..355
score: 32.516
IPR001452SH3 domainPROSITEPS50002SH3coord: 16..97
score: 13.012
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 177..363
IPR036028SH3-like domain superfamilySUPERFAMILYSSF50044SH3-domaincoord: 10..106