cyclin-dependent kinase 20-like

Overview
Namecyclin-dependent kinase 20-like
Smed IDSMED30016627
Length (bp)3094
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of cyclin-dependent kinase 20-like (SMED30016627) t-SNE clustered cells

Violin plots show distribution of expression levels for cyclin-dependent kinase 20-like (SMED30016627) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of cyclin-dependent kinase 20-like (SMED30016627) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for cyclin-dependent kinase 20-like (SMED30016627) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016627

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30016627 SmedASXL_070670SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
X1 cellSMED30016627SMESG000021734.1 SmedASXL_008772SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
headSMED30016627SMESG000035458.1 dd_Smed_v6_14306_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Human
Match: CDK20 (cyclin dependent kinase 20 [Source:HGNC Symbol;Acc:HGNC:21420])

HSP 1 Score: 133.265 bits (334), Expect = 2.230e-33
Identity = 80/149 (53.69%), Postives = 104/149 (69.80%), Query Frame = 3
Query: 2541 RAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSATEXXXXXXXXXXXXXXXKSELPRPERSKIFNTHAH----QLYDTSPNIPIEDSCIDP 2975
            R+VGCI GELLN SPLFPG+NDIEQLC VLR+LGTPN  +WPE+ +LPDYNKISF    P+P E VLPD   +A+ L+   L+Y   +R++A++ALLH YFF  PLPA  SELP P+R       AH     ++D   + P+E+S ++P
Sbjct:  167 RSVGCIMGELLNGSPLFPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIAASKALLHQYFFTAPLPAHPSELPIPQRLGGPAPKAHPGPPHIHDFHVDRPLEESLLNP 315          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Human
Match: CDK20 (cyclin dependent kinase 20 [Source:HGNC Symbol;Acc:HGNC:21420])

HSP 1 Score: 133.265 bits (334), Expect = 3.485e-33
Identity = 80/149 (53.69%), Postives = 104/149 (69.80%), Query Frame = 3
Query: 2541 RAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSATEXXXXXXXXXXXXXXXKSELPRPERSKIFNTHAH----QLYDTSPNIPIEDSCIDP 2975
            R+VGCI GELLN SPLFPG+NDIEQLC VLR+LGTPN  +WPE+ +LPDYNKISF    P+P E VLPD   +A+ L+   L+Y   +R++A++ALLH YFF  PLPA  SELP P+R       AH     ++D   + P+E+S ++P
Sbjct:  180 RSVGCIMGELLNGSPLFPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIAASKALLHQYFFTAPLPAHPSELPIPQRLGGPAPKAHPGPPHIHDFHVDRPLEESLLNP 328          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Human
Match: OTUD6B (OTU deubiquitinase 6B [Source:HGNC Symbol;Acc:HGNC:24281])

HSP 1 Score: 131.339 bits (329), Expect = 5.084e-33
Identity = 96/280 (34.29%), Postives = 148/280 (52.86%), Query Frame = 2
Query:   89 QNHKKELKSLQIEIQKLKKSVAKGDKKRLKEVQLTISNLEKETLERQKKEIDDFELSNF----------IQEVILPETXXXXXXXXXXXXXXXXXXXLYEEIIKNHEANELNSDSHKELEIIKKKLTDRDLLFIDIPADGNCLFNAIGYQCIRHKILDFSTEFSKSEDASLYLRELVYKELMKKQEFYSAFISDEDSS------EFSTYCEQIRSTRAWGGQLEINALSEVLECSIEVIQAYAPSIIIGAFNNKPQLIITYHKFAYGLGEHYNTCNLINN 880
            + H+KE K LQ +IQ +K +V K DKKR K++   ++ LEKE  ++ ++E++  +L+            I  ++L      I   + +R KK    K  EE I   E   L    H E E + + L  R L    IP+DG+C++ AI  Q ++ K    +    +S+ A  Y++  V        E +  F+++ ++       EF  YCE I +T AWGGQLE+ ALS +L+  IE+IQA +P II+G   +K  LI+ Y + AYGLGEHYN+   + N
Sbjct:   17 RRHRKEKKELQAKIQGMKNAVPKNDKKRRKQLTEDVAKLEKEMEQKHREELEQLKLTTKENKIDSVAVNISNLVLENQPPRISKAQKRREKKAALEKEREERIAEAEIENLTGARHMESEKLAQILAARQLEIKQIPSDGHCMYKAIEDQ-LKEKDCALTVVALRSQTAE-YMQSHV--------EDFLPFLTNPNTGDMYTPEEFQKYCEDIVNTAAWGGQLELRALSHILQTPIEIIQADSPPIIVGEEYSKKPLILVYMRHAYGLGEHYNSVTRLVN 286          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Human
Match: CDK20 (cyclin dependent kinase 20 [Source:HGNC Symbol;Acc:HGNC:21420])

HSP 1 Score: 132.109 bits (331), Expect = 8.563e-33
Identity = 80/151 (52.98%), Postives = 105/151 (69.54%), Query Frame = 3
Query: 2535 NLRAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSATEXXXXXXXXXXXXXXXKSELPRPERSKIFNTHAH----QLYDTSPNIPIEDSCIDP 2975
            +L +VGCI GELLN SPLFPG+NDIEQLC VLR+LGTPN  +WPE+ +LPDYNKISF    P+P E VLPD   +A+ L+   L+Y   +R++A++ALLH YFF  PLPA  SELP P+R       AH     ++D   + P+E+S ++P
Sbjct:  186 DLWSVGCIMGELLNGSPLFPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIAASKALLHQYFFTAPLPAHPSELPIPQRLGGPAPKAHPGPPHIHDFHVDRPLEESLLNP 336          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Human
Match: OTUD6B (OTU deubiquitinase 6B [Source:HGNC Symbol;Acc:HGNC:24281])

HSP 1 Score: 131.339 bits (329), Expect = 1.125e-32
Identity = 96/280 (34.29%), Postives = 148/280 (52.86%), Query Frame = 2
Query:   89 QNHKKELKSLQIEIQKLKKSVAKGDKKRLKEVQLTISNLEKETLERQKKEIDDFELSNF----------IQEVILPETXXXXXXXXXXXXXXXXXXXLYEEIIKNHEANELNSDSHKELEIIKKKLTDRDLLFIDIPADGNCLFNAIGYQCIRHKILDFSTEFSKSEDASLYLRELVYKELMKKQEFYSAFISDEDSS------EFSTYCEQIRSTRAWGGQLEINALSEVLECSIEVIQAYAPSIIIGAFNNKPQLIITYHKFAYGLGEHYNTCNLINN 880
            + H+KE K LQ +IQ +K +V K DKKR K++   ++ LEKE  ++ ++E++  +L+            I  ++L      I   + +R KK    K  EE I   E   L    H E E + + L  R L    IP+DG+C++ AI  Q ++ K    +    +S+ A  Y++  V        E +  F+++ ++       EF  YCE I +T AWGGQLE+ ALS +L+  IE+IQA +P II+G   +K  LI+ Y + AYGLGEHYN+   + N
Sbjct:   47 RRHRKEKKELQAKIQGMKNAVPKNDKKRRKQLTEDVAKLEKEMEQKHREELEQLKLTTKENKIDSVAVNISNLVLENQPPRISKAQKRREKKAALEKEREERIAEAEIENLTGARHMESEKLAQILAARQLEIKQIPSDGHCMYKAIEDQ-LKEKDCALTVVALRSQTAE-YMQSHV--------EDFLPFLTNPNTGDMYTPEEFQKYCEDIVNTAAWGGQLELRALSHILQTPIEIIQADSPPIIVGEEYSKKPLILVYMRHAYGLGEHYNSVTRLVN 316          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Celegans
Match: otub-3 (OTUBain deubiquitylating protease homolog [Source:UniProtKB/TrEMBL;Acc:Q19681])

HSP 1 Score: 75.485 bits (184), Expect = 1.440e-14
Identity = 53/169 (31.36%), Postives = 84/169 (49.70%), Query Frame = 2
Query:  395 SDSHKELEIIKKKLTDRDLLFIDIPADGNCLFNAIGYQCIRHKILDFSTEFSKSEDASLYLRELVYKELMKKQEFYSAFISD----EDSSEFSTYCEQIRSTR----AWGGQLEINALSEVLECSIEVIQAYAPSIIIGAFNNKPQ---LIITYHKFAYGLGEHYN-TC 865
            SD   E   +K+ L +  +  IDIPADG+C++NAI +Q ++ + ++ S    +      Y+RE          E +  FI D    +  S ++TY   + +       WGG+LE+ A S + E +I V + Y     IG   + P+   L + + + AY LGEHYN TC
Sbjct:  108 SDRQMEKAAVKEMLAEDHMKMIDIPADGDCMYNAISHQ-LQEEGIEISVRKLRKR-CGTYMRE--------HSEDFRPFIEDMANMDSDSSWATYLGGVENVAEIGGVWGGELELKACSMIFEKTIVVYKQYGGRHTIGEEYSSPKDRALRVVFLRHAYSLGEHYNSTC 266          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Celegans
Match: otub-3 (OTUBain deubiquitylating protease homolog [Source:UniProtKB/TrEMBL;Acc:Q19681])

HSP 1 Score: 75.8702 bits (185), Expect = 1.978e-14
Identity = 53/169 (31.36%), Postives = 84/169 (49.70%), Query Frame = 2
Query:  395 SDSHKELEIIKKKLTDRDLLFIDIPADGNCLFNAIGYQCIRHKILDFSTEFSKSEDASLYLRELVYKELMKKQEFYSAFISD----EDSSEFSTYCEQIRSTR----AWGGQLEINALSEVLECSIEVIQAYAPSIIIGAFNNKPQ---LIITYHKFAYGLGEHYN-TC 865
            SD   E   +K+ L +  +  IDIPADG+C++NAI +Q ++ + ++ S    +      Y+RE          E +  FI D    +  S ++TY   + +       WGG+LE+ A S + E +I V + Y     IG   + P+   L + + + AY LGEHYN TC
Sbjct:  149 SDRQMEKAAVKEMLAEDHMKMIDIPADGDCMYNAISHQ-LQEEGIEISVRKLRKR-CGTYMRE--------HSEDFRPFIEDMANMDSDSSWATYLGGVENVAEIGGVWGGELELKACSMIFEKTIVVYKQYGGRHTIGEEYSSPKDRALRVVFLRHAYSLGEHYNSTC 307          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Celegans
Match: otub-3 (OTUBain deubiquitylating protease homolog [Source:UniProtKB/TrEMBL;Acc:Q19681])

HSP 1 Score: 75.8702 bits (185), Expect = 1.978e-14
Identity = 53/169 (31.36%), Postives = 84/169 (49.70%), Query Frame = 2
Query:  395 SDSHKELEIIKKKLTDRDLLFIDIPADGNCLFNAIGYQCIRHKILDFSTEFSKSEDASLYLRELVYKELMKKQEFYSAFISD----EDSSEFSTYCEQIRSTR----AWGGQLEINALSEVLECSIEVIQAYAPSIIIGAFNNKPQ---LIITYHKFAYGLGEHYN-TC 865
            SD   E   +K+ L +  +  IDIPADG+C++NAI +Q ++ + ++ S    +      Y+RE          E +  FI D    +  S ++TY   + +       WGG+LE+ A S + E +I V + Y     IG   + P+   L + + + AY LGEHYN TC
Sbjct:  149 SDRQMEKAAVKEMLAEDHMKMIDIPADGDCMYNAISHQ-LQEEGIEISVRKLRKR-CGTYMRE--------HSEDFRPFIEDMANMDSDSSWATYLGGVENVAEIGGVWGGELELKACSMIFEKTIVVYKQYGGRHTIGEEYSSPKDRALRVVFLRHAYSLGEHYNSTC 307          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Celegans
Match: otub-3 (OTUBain deubiquitylating protease homolog [Source:UniProtKB/TrEMBL;Acc:Q19681])

HSP 1 Score: 75.485 bits (184), Expect = 2.944e-14
Identity = 53/169 (31.36%), Postives = 84/169 (49.70%), Query Frame = 2
Query:  395 SDSHKELEIIKKKLTDRDLLFIDIPADGNCLFNAIGYQCIRHKILDFSTEFSKSEDASLYLRELVYKELMKKQEFYSAFISD----EDSSEFSTYCEQIRSTR----AWGGQLEINALSEVLECSIEVIQAYAPSIIIGAFNNKPQ---LIITYHKFAYGLGEHYN-TC 865
            SD   E   +K+ L +  +  IDIPADG+C++NAI +Q ++ + ++ S    +      Y+RE          E +  FI D    +  S ++TY   + +       WGG+LE+ A S + E +I V + Y     IG   + P+   L + + + AY LGEHYN TC
Sbjct:  170 SDRQMEKAAVKEMLAEDHMKMIDIPADGDCMYNAISHQ-LQEEGIEISVRKLRKR-CGTYMRE--------HSEDFRPFIEDMANMDSDSSWATYLGGVENVAEIGGVWGGELELKACSMIFEKTIVVYKQYGGRHTIGEEYSSPKDRALRVVFLRHAYSLGEHYNSTC 328          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Celegans
Match: dyf-5 (Serine/threonine-protein kinase dyf-5 [Source:UniProtKB/Swiss-Prot;Acc:B3WFY8])

HSP 1 Score: 69.3218 bits (168), Expect = 6.218e-12
Identity = 33/96 (34.38%), Postives = 55/96 (57.29%), Query Frame = 3
Query: 2535 NLRAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSATE 2822
            ++ A+GCI  EL    PLFPG ++++QL  ++ +LGTPN+  WPE   L       F      P E V+    KE +KL+  +++++ +KR +A +
Sbjct:  189 DMWALGCIMAELYILRPLFPGTSEMDQLFKIISILGTPNKDEWPEGYQLASAMNFRFQQVVATPMEQVVNTISKEGMKLMMDMMLWNPEKRPNANQ 284          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Fly
Match: CG7857 (gene:FBgn0026738 transcript:FBtr0075605)

HSP 1 Score: 99.3673 bits (246), Expect = 3.221e-22
Identity = 92/297 (30.98%), Postives = 140/297 (47.14%), Query Frame = 2
Query:   74 MDDLLQNHKKELKSLQIEIQKLKKSVAKGDKKRLKEVQLTISNLEKETLERQKKEI---DDFELSNFIQEVIL-----PETX-----------------XXXXXXXXXXXXXXXXXXLYEEIIKNHEANELNSDSHK--ELEIIKKKLTDRDLLFIDIPADGNCLFNAIGYQCIRHKILDFSTEFSKSEDASLYLRELVYKELMKKQEFYSAFISDE-----DSSEFSTYCEQIRSTRAWGGQLEINALSEVLECSIEVIQAYAPSIIIGA--FNNKPQLIITYHKFAYGLGEHYNT 862
            ++D+   H++E K LQ ++Q +KK+  K +K + KE    ++ LE E  +R K E+   +  E    ++ V+      PETE                   +   + +R KK    +  E  IK    N  N  + K  EL+ I  KL+ R L   +IP+DG+CL+ +I +Q I + +   S +  + E A+ Y+R         K    S  I  E     +  +F  YC  I  T AWGG +E+ A+S +L   IEVIQA     ++G   F   P LII YH+  Y LG HYN+
Sbjct:   20 LEDIGARHRRERKDLQAKLQAMKKNAPKNNKNKRKEFLEEMARLEGELEQRHKAELKAAEAMEAPVLVEPVVKEPAEKPETEVTDDDGIEEKEEQLAPNQRVSKAQKRRDKKAKEARAREAEIKTELQNAANQPTPKLIELQQITAKLSQRQLSLHNIPSDGDCLYQSIRHQLIVNALPGHSVQELREETAN-YVR-------AHKDSLISYMIHPETGDILNDQQFEQYCHDIAKTHAWGGHIELKAISSLLRVPIEVIQAEGAPTLLGQEEFGGSP-LIICYHRHIYQLGAHYNS 307          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Fly
Match: CG6800 (gene:FBgn0038902 transcript:FBtr0084132)

HSP 1 Score: 81.2629 bits (199), Expect = 3.188e-16
Identity = 38/97 (39.18%), Postives = 56/97 (57.73%), Query Frame = 3
Query: 2535 NLRAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEA-IKLIEGILVYSSKKRLSATE 2822
            ++ A GC+  E+L   PLF G  DIEQL  ++R LG+P    WPE+  LPDY+KI F     + ++ + P       I L+  ++VY+ K RL A+E
Sbjct:  191 DMWAAGCVVAEMLRGVPLFAGTTDIEQLAIIIRTLGSPRLNQWPELTSLPDYSKIRFPNSVGIHWDNLFPSCTHAVEINLVSNLVVYNPKNRLKASE 287          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Fly
Match: Cdk1 (gene:FBgn0004106 transcript:FBtr0080051)

HSP 1 Score: 72.7886 bits (177), Expect = 1.918e-13
Identity = 37/101 (36.63%), Postives = 58/101 (57.43%), Query Frame = 3
Query: 2523 FSC-SNLRAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSATE 2822
            +SC  ++ ++GCIF E+  R PLF G+++I+QL  + R+L TP E +WP +  LPDY K +F           L +     I LI+ +L+Y    R+SA +
Sbjct:  181 YSCPVDIWSIGCIFAEMATRKPLFQGDSEIDQLFRMFRILKTPTEDIWPGVTSLPDY-KNTFPCWSTNQLTNQLKNLDANGIDLIQKMLIYDPVHRISAKD 280          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Fly
Match: Cdk7 (gene:FBgn0263237 transcript:FBtr0070756)

HSP 1 Score: 66.6254 bits (161), Expect = 3.937e-11
Identity = 32/96 (33.33%), Postives = 51/96 (53.12%), Query Frame = 3
Query: 2535 NLRAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSATE 2822
            ++ AVGCI  EL+ R P  PG++D++QL  +   LGTP E  WP +  L DY  + F      P + +   A  + I L++ +   +  +R+S  E
Sbjct:  195 DMWAVGCILAELMLRVPFMPGDSDLDQLTRIFSTLGTPTEAEWPHLSKLHDY--LQFRNFPGTPLDNIFTAAGNDLIHLMQRLFAMNPLRRVSCRE 288          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Fly
Match: Cdk2 (gene:FBgn0004107 transcript:FBtr0083922)

HSP 1 Score: 65.4698 bits (158), Expect = 6.383e-11
Identity = 36/102 (35.29%), Postives = 56/102 (54.90%), Query Frame = 3
Query: 2517 FLFSCSNLRAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSATE 2822
            F  +  ++ ++GCIF E++ R  LFPG+++I+QL  + R L TP+E  WP +  LPD+ K  F   +        P    EA +LI  +L Y    R+SA +
Sbjct:  182 FYSTGVDIWSLGCIFSEMIMRRSLFPGDSEIDQLYRIFRTLSTPDETNWPGVTQLPDF-KTKFPRWEGTNMPQ--PITEHEAHELIMSMLCYDPNLRISAKD 280          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Zebrafish
Match: cdk20 (cyclin-dependent kinase 20 [Source:NCBI gene;Acc:494112])

HSP 1 Score: 147.517 bits (371), Expect = 3.485e-39
Identity = 85/151 (56.29%), Postives = 111/151 (73.51%), Query Frame = 3
Query: 2535 NLRAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSATEXXXXXXXXXXXXXXXKSELPRPERSKIFNTHAHQ-LYDTSPNIPIEDSCIDPMFL 2984
            +L AVGCIFGELLN SPLFPGENDIEQLCCVLRVLGTPN+ +WPE+ +LPDYNKI+F    P+P E ++PD   +A+ L++  LVY SK+R+SA +ALLHPYFF  PLPA  SELP P+R    +    Q  ++ + + P+ +S +DP  +
Sbjct:  103 DLWAVGCIFGELLNNSPLFPGENDIEQLCCVLRVLGTPNQKVWPEITELPDYNKITFKENPPIPLEEIVPDTSPQAVDLLKKFLVYPSKQRISARQALLHPYFFTDPLPAHHSELPIPQRGGKHSRQRMQPPHEFTVDRPLHESVVDPSLI 253          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Zebrafish
Match: cdk20 (cyclin-dependent kinase 20 [Source:NCBI gene;Acc:494112])

HSP 1 Score: 147.902 bits (372), Expect = 2.443e-38
Identity = 86/154 (55.84%), Postives = 112/154 (72.73%), Query Frame = 3
Query: 2535 NLRAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSATEXXXXXXXXXXXXXXXKSELPRPERSKIFNTHAHQL----YDTSPNIPIEDSCIDPMFL 2984
            +L AVGCIFGELLN SPLFPGENDIEQLCCVLRVLGTPN+ +WPE+ +LPDYNKI+F    P+P E ++PD   +A+ L++  LVY SK+R+SA +ALLHPYFF  PLPA  SELP P+R      H+ Q     ++ + + P+ +S +DP  +
Sbjct:  186 DLWAVGCIFGELLNNSPLFPGENDIEQLCCVLRVLGTPNQKVWPEITELPDYNKITFKENPPIPLEEIVPDTSPQAVDLLKKFLVYPSKQRISARQALLHPYFFTDPLPAHHSELPIPQRG---GKHSRQRMQPPHEFTVDRPLHESVVDPSLI 336          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Zebrafish
Match: otud6b (OTU deubiquitinase 6B [Source:NCBI gene;Acc:393194])

HSP 1 Score: 128.642 bits (322), Expect = 2.609e-32
Identity = 88/289 (30.45%), Postives = 147/289 (50.87%), Query Frame = 2
Query:   77 DDLLQNHKKELKSLQIEIQKLKKSVAKGDKKRLKEVQLTISNLEKETLERQKKEI---------------DDFELSNFIQEVILPETXXXXXXXXXXXXXXXXXXXLYEEIIKNHEANELNSDSHKELEIIKKKLTDRDLLFIDIPADGNCLFNAIGYQCIRHKILDFSTEFSKSEDASLYLRELVYKELMKKQEFYSAFISDEDSS------EFSTYCEQIRSTRAWGGQLEINALSEVLECSIEVIQAYAPSIIIGAFNNKPQLIITYHKFAYGLGEHYNTCNLINN 880
            + L + H+KE K LQ +IQ +K +V K DKKR K++   I+ LE E  ++ + E+               D   ++N  +E   P  ++     + +R KK    K  E  I   E   L+   H+E   +++KL +R L   +I +DG+C+     Y+ + H++ +        E     LR+   + +    + +  F+++ ++       EF  YC  +  T AWGGQLE+ ALS+VL+  +EVIQA +P I IG   +KP++ + Y + AYGLGEHYN+   + +
Sbjct:    9 EQLAKQHRKEKKDLQAKIQSMKNAVPKNDKKRRKQLTEDIAKLEAELSQKHENELKLQNTSSVEEVSVALDSMSVANH-EEQSDPSKQSRTSKAQKRRDKKAALEKEREMRIAEAEVENLSGSRHQEGLKLREKLVERHLQIKEISSDGHCM-----YRAVEHQLTERGLALGLKE-----LRDQTAQYMRSHADDFMPFLTNPNTGDMYTAEEFEKYCTDVADTAAWGGQLELKALSQVLQLPLEVIQADSPCITIGEEYDKPKITLIYMRHAYGLGEHYNSVEPLKD 286          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Zebrafish
Match: cdk2 (cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2741])

HSP 1 Score: 76.2554 bits (186), Expect = 1.999e-14
Identity = 38/102 (37.25%), Postives = 61/102 (59.80%), Query Frame = 3
Query: 2511 KYFLFSCSNLRAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSA 2816
            KY+  +  ++ ++GCIF E++ R  LFPG+++I+QL  + R LGTP+E +WP +  +PDY K SF          V+P   ++   L+  +L Y   KR+SA
Sbjct:  178 KYY-STAVDIWSLGCIFAEMITRRALFPGDSEIDQLFRIFRTLGTPDESIWPGVTSMPDY-KPSFPKWARQDLSKVVPPLDEDGRDLLGQMLTYDPNKRISA 277          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Zebrafish
Match: cdk7 (cyclin-dependent kinase 7 [Source:ZFIN;Acc:ZDB-GENE-010320-2])

HSP 1 Score: 76.2554 bits (186), Expect = 2.075e-14
Identity = 47/121 (38.84%), Postives = 67/121 (55.37%), Query Frame = 3
Query: 2535 NLRAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSATEXXXXXXXXXXXXXXXKSELPRPERS 2897
            ++ AVGCI  ELL R P   G++D++QL  +   LGTP + +WP M  LPDY  +SF      P E +   A  + ++L+ G+  Y+   R +A +AL   YF   P P P  +LPRP  S
Sbjct:  161 DMWAVGCILAELLLRVPFLAGDSDLDQLTKIFEALGTPTDEIWPGMSSLPDY--VSFKPFPGTPLEHIFSAAGDDLLELLRGLFTYNPCSRTTAMQALKMKYFSNRPGPTPGPQLPRPNSS 279          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Xenopus
Match: otud6b (OTU deubiquitinase 6B [Source:NCBI gene;Acc:496720])

HSP 1 Score: 129.413 bits (324), Expect = 2.432e-32
Identity = 91/286 (31.82%), Postives = 148/286 (51.75%), Query Frame = 2
Query:   83 LLQNHKKELKSLQIEIQKLKKSVAKGDKKRLKEVQLTISNLEKETLERQKKEIDDFE-----------LSNFIQEVIL----PETXXXXXXXXXXXXXXXXXXXLYEEIIKNHEANELNSDSHKELEIIKKKLTDRDLLFIDIPADGNCLFNAIGYQCIRHKILDFSTEFSKSEDASLYLRELVYKELMKKQEFYSAFISDEDSS------EFSTYCEQIRSTRAWGGQLEINALSEVLECSIEVIQAYAPSIIIGAFNNKPQLIITYHKFAYGLGEHYNTCNLIN 877
            L++ H+KE + LQ +IQ +K SV K DKKR K++   I+ LE +   R K+E++ F            ++N +  + L    P  +      + +R KK    K  +E I   E   L+   H E + + + L +R+L    IP+DG+C++ AI +Q +R +  D +    +S+ A           +    E +  F+++  +       EF  YC  I +T AWGGQLE+ ALS +L+ +IEVIQA +  I+IG   +   + + Y + AYGLGEHYN+  L++
Sbjct:   13 LIKQHRKEKRDLQAKIQSMKNSVPKNDKKRRKQLTEDIAKLEADLDVRHKEELEAFAQKQPEPTQVSGITNGVTSLDLGNEAPVQQPRQSKAQKRREKKAAQEKERDERIAEAEIANLSGARHLESQKLARILAERELQIRQIPSDGHCMYRAIEHQ-LRERGNDLTVANLRSQTADY---------MQNHAEDFLPFLTNSSTGDMYTQEEFLKYCTDIVNTPAWGGQLELRALSHILKTAIEVIQAESSPIVIGEEYSSKAITLVYMRHAYGLGEHYNSVELLD 288          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Xenopus
Match: cdk2 (cyclin-dependent kinase 2 [Source:NCBI gene;Acc:493498])

HSP 1 Score: 80.1073 bits (196), Expect = 1.356e-15
Identity = 39/100 (39.00%), Postives = 60/100 (60.00%), Query Frame = 3
Query: 2517 FLFSCSNLRAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSA 2816
            F  +  ++ ++GCIF E++ R  LFPG+++I+QL  + R LGTP+EV WP +  +PDY K +F       F  V+P    +   L+  +L Y S KR+SA
Sbjct:  179 FYSTAVDIWSLGCIFAEMITRRALFPGDSEIDQLFRIFRTLGTPDEVSWPGVTTMPDY-KSTFPKWVRQDFSKVVPPLDDDGRDLLAQMLQYDSNKRISA 277          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Xenopus
Match: eps15 (epidermal growth factor receptor pathway substrate 15 [Source:Xenbase;Acc:XB-GENE-6070905])

HSP 1 Score: 70.8626 bits (172), Expect = 2.853e-12
Identity = 36/94 (38.30%), Postives = 53/94 (56.38%), Query Frame = 3
Query: 2535 NLRAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSA 2816
            +L +VGCIF E+  R PLF G +D++QL  +  V+G P E  WP  V +P   + +F   QP P E V+P   ++   L+   L +S   R+SA
Sbjct:  203 DLWSVGCIFAEMFRRKPLFRGNSDVDQLGKIFDVIGLPEEEEWPHDVAVP---RNAFHFRQPQPIENVVPGIDEQGKDLLIKCLTFSPANRISA 293          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Xenopus
Match: dnajc3 (DnaJ heat shock protein family (Hsp40) member C3 [Source:Xenbase;Acc:XB-GENE-997043])

HSP 1 Score: 71.2478 bits (173), Expect = 5.150e-12
Identity = 33/96 (34.38%), Postives = 57/96 (59.38%), Query Frame = 3
Query: 2535 NLRAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSATE 2822
            ++ AVG I  EL    PLFPG ++++Q+  + +VLGTP +  WPE   L       F  C P+  +T++P+A ++A+ L+   + +  KKR +A++
Sbjct:  182 DIWAVGSIMAELYTLRPLFPGTSEVDQIFKICQVLGTPKKNDWPEGYQLAASMNFRFPQCVPINLKTLIPNASEDALSLMRDTMQWDPKKRPTASQ 277          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Xenopus
Match: dnajc3 (DnaJ heat shock protein family (Hsp40) member C3 [Source:Xenbase;Acc:XB-GENE-997043])

HSP 1 Score: 71.633 bits (174), Expect = 5.193e-12
Identity = 33/96 (34.38%), Postives = 57/96 (59.38%), Query Frame = 3
Query: 2535 NLRAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSATE 2822
            ++ AVG I  EL    PLFPG ++++Q+  + +VLGTP +  WPE   L       F  C P+  +T++P+A ++A+ L+   + +  KKR +A++
Sbjct:  182 DIWAVGSIMAELYTLRPLFPGTSEVDQIFKICQVLGTPKKNDWPEGYQLAASMNFRFPQCVPINLKTLIPNASEDALSLMRDTMQWDPKKRPTASQ 277          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Mouse
Match: Cdk20 (cyclin-dependent kinase 20 [Source:MGI Symbol;Acc:MGI:2145349])

HSP 1 Score: 141.739 bits (356), Expect = 1.722e-36
Identity = 84/154 (54.55%), Postives = 109/154 (70.78%), Query Frame = 3
Query: 2535 NLRAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSATEXXXXXXXXXXXXXXXKSELPRPERSKIFNTHAH----QLYDTSPNIPIEDSCIDPMFL 2984
            +L AVGCI GELLN SPLFPGENDIEQLCCVLR+LGTP+  +WPE+ +LPDYNKISF    PVP E VLPDA  +A+ L+   L+Y  ++R++A++ALLH YFF  PLPA  SELP P+R       AH     ++D   + P+E+S ++P  +
Sbjct:  160 DLWAVGCIMGELLNGSPLFPGENDIEQLCCVLRILGTPSPRVWPEITELPDYNKISFKEQAPVPLEEVLPDASPQALDLLGQFLLYPPRQRIAASQALLHQYFFTAPLPAHPSELPIPQRPGGPAPKAHPGPPHVHDFHVDRPLEESLLNPELI 313          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Mouse
Match: Cdk20 (cyclin-dependent kinase 20 [Source:MGI Symbol;Acc:MGI:2145349])

HSP 1 Score: 141.739 bits (356), Expect = 3.670e-36
Identity = 84/151 (55.63%), Postives = 108/151 (71.52%), Query Frame = 3
Query: 2535 NLRAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSATEXXXXXXXXXXXXXXXKSELPRPERSKIFNTHAH----QLYDTSPNIPIEDSCIDP 2975
            +L AVGCI GELLN SPLFPGENDIEQLCCVLR+LGTP+  +WPE+ +LPDYNKISF    PVP E VLPDA  +A+ L+   L+Y  ++R++A++ALLH YFF  PLPA  SELP P+R       AH     ++D   + P+E+S ++P
Sbjct:  186 DLWAVGCIMGELLNGSPLFPGENDIEQLCCVLRILGTPSPRVWPEITELPDYNKISFKEQAPVPLEEVLPDASPQALDLLGQFLLYPPRQRIAASQALLHQYFFTAPLPAHPSELPIPQRPGGPAPKAHPGPPHVHDFHVDRPLEESLLNP 336          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Mouse
Match: Otud6b (OTU domain containing 6B [Source:MGI Symbol;Acc:MGI:1919451])

HSP 1 Score: 126.331 bits (316), Expect = 1.712e-31
Identity = 90/288 (31.25%), Postives = 147/288 (51.04%), Query Frame = 2
Query:   77 DDLLQNHKKELKSLQIEIQKLKKSVAKGDKKRLKEVQLTISNLEKETLERQKKEIDDFELSNF-----------IQEVILPETXXXXXXXXXXXXXXXXXXXLYEEIIKNHEANELNSDSHKELEIIKKKLTDRDLLFIDIPADGNCLFNAIGYQCIRHKILDFSTEFSKSEDASLY---LRELVYKELMKKQEFYSAFISDEDSS------EFSTYCEQIRSTRAWGGQLEINALSEVLECSIEVIQAYAPSIIIGAFNNKPQLIITYHKFAYGLGEHYNTCNLINN 880
            + L++ H+KE K LQ +IQ +K +V K DKKR K++   ++ LE+E  ++ ++E++  +   F           I  ++L      I   + +R KK    K  EE I   E   L+   H E E + + L  R+L    IP+DG+C++ A+  Q              + +D +L    LR    + +    + +  F+++  +       EF  YC+ I +T AWGGQLE+ ALS +L+  IE++QA AP II+G    +  L++ Y + AYGLGEHYN+   + N
Sbjct:   13 EQLVRRHRKEKKELQAKIQGMKNAVPKNDKKRRKQLTEDVAKLEREMEQKHREELEQLKQLTFKDSKIDSVAVNISNLVLENQPPRISKAQKRREKKAALEKEREERIAEAEIENLSGARHLESEKLAQILAARELEIKQIPSDGHCMYGALEDQL-------------REQDCALTVASLRRQTAEYMQTHSDDFLPFLTNPSTGDMYTPEEFGKYCDDIVNTAAWGGQLELRALSHILQTPIEILQADAPPIIVGEEYPRNPLVLVYMRHAYGLGEHYNSVTRLVN 287          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Mouse
Match: Otud6b (OTU domain containing 6B [Source:MGI Symbol;Acc:MGI:1919451])

HSP 1 Score: 126.716 bits (317), Expect = 3.106e-31
Identity = 90/288 (31.25%), Postives = 147/288 (51.04%), Query Frame = 2
Query:   77 DDLLQNHKKELKSLQIEIQKLKKSVAKGDKKRLKEVQLTISNLEKETLERQKKEIDDFELSNF-----------IQEVILPETXXXXXXXXXXXXXXXXXXXLYEEIIKNHEANELNSDSHKELEIIKKKLTDRDLLFIDIPADGNCLFNAIGYQCIRHKILDFSTEFSKSEDASLY---LRELVYKELMKKQEFYSAFISDEDSS------EFSTYCEQIRSTRAWGGQLEINALSEVLECSIEVIQAYAPSIIIGAFNNKPQLIITYHKFAYGLGEHYNTCNLINN 880
            + L++ H+KE K LQ +IQ +K +V K DKKR K++   ++ LE+E  ++ ++E++  +   F           I  ++L      I   + +R KK    K  EE I   E   L+   H E E + + L  R+L    IP+DG+C++ A+  Q              + +D +L    LR    + +    + +  F+++  +       EF  YC+ I +T AWGGQLE+ ALS +L+  IE++QA AP II+G    +  L++ Y + AYGLGEHYN+   + N
Sbjct:   44 EQLVRRHRKEKKELQAKIQGMKNAVPKNDKKRRKQLTEDVAKLEREMEQKHREELEQLKQLTFKDSKIDSVAVNISNLVLENQPPRISKAQKRREKKAALEKEREERIAEAEIENLSGARHLESEKLAQILAARELEIKQIPSDGHCMYGALEDQL-------------REQDCALTVASLRRQTAEYMQTHSDDFLPFLTNPSTGDMYTPEEFGKYCDDIVNTAAWGGQLELRALSHILQTPIEILQADAPPIIVGEEYPRNPLVLVYMRHAYGLGEHYNSVTRLVN 318          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Mouse
Match: Otud6a (OTU domain containing 6A [Source:MGI Symbol;Acc:MGI:3644685])

HSP 1 Score: 120.553 bits (301), Expect = 1.536e-29
Identity = 85/290 (29.31%), Postives = 140/290 (48.28%), Query Frame = 2
Query:   83 LLQNHKKELKSLQIEIQKLKKSVAKGDKKRLKEVQLTISNLEKETLERQKKEIDDF---------ELSNFIQEVILPETXXXXXXXXXXXXXXXXXXXLYEEIIKNHEANELNSDSHKELEIIKKKLTDRDLLFIDIPADGNCLFNAIGYQCI----------------RHKILDFSTEFSKSEDASLYLRELVYKELMKKQEFYSAFISDEDSSEFSTYCEQIRSTRAWGGQLEINALSEVLECSIEVIQAYAPSIIIG-AFNNKPQLIITYHKFAYGLGEHYNTCNLI 874
            +++ H +E + LQ  IQ LK SV K DK R K++   IS LE E  +R K+E++ F          ++  ++++ L          + +R ++ +  + ++E +   +A +L ++  +E E +   L  ++L    IPADG+C++ AI  Q +                R  I DF   F++ E  + Y RE                       +F  YC+ I    +WGGQLE+ ALS VL+  IEV+QA +P+I+IG  +  KP  ++  H +A   GEHYN+   I
Sbjct:   11 VIRRHYREKRELQAHIQTLKASVPKNDKGRRKQMLADISRLEAEMEQRHKQELEKFGENPDSSVDSVTADLEKMNLENMPPRPPKAQKRRDRRAHQERRHQERMPAAQAEQLAANRREEEEKVAAILGAKNLEMKTIPADGHCMYRAIQDQLVFSVTIESLRYRTAYYMRKHIDDFLPFFTEPEAGNFYTRE-----------------------DFLRYCDDIVHNASWGGQLELRALSHVLQTPIEVVQANSPTIVIGEEYTRKPVTLVYLH-YACDFGEHYNSVKPI 276          
BLAST of cyclin-dependent kinase 20-like vs. UniProt/SwissProt
Match: sp|A8WIP6|CDK20_DANRE (Cyclin-dependent kinase 20 OS=Danio rerio OX=7955 GN=cdk20 PE=2 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 1.844e-37
Identity = 86/154 (55.84%), Postives = 112/154 (72.73%), Query Frame = 3
Query: 2535 NLRAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSATEXXXXXXXXXXXXXXXKSELPRPERSKIFNTHAHQL----YDTSPNIPIEDSCIDPMFL 2984
            +L AVGCIFGELLN SPLFPGENDIEQLCCVLRVLGTPN+ +WPE+ +LPDYNKI+F    P+P E ++PD   +A+ L++  LVY SK+R+SA +ALLHPYFF  PLPA  SELP P+R      H+ Q     ++ + + P+ +S +DP  +
Sbjct:  186 DLWAVGCIFGELLNNSPLFPGENDIEQLCCVLRVLGTPNQKVWPEITELPDYNKITFKENPPIPLEEIVPDTSPQAVDLLKKFLVYPSKQRISARQALLHPYFFTDPLPAHHSELPIPQRG---GKHSRQRMQPPHEFTVDRPLHESVVDPSLI 336          
BLAST of cyclin-dependent kinase 20-like vs. UniProt/SwissProt
Match: sp|Q4KM34|CDK20_RAT (Cyclin-dependent kinase 20 OS=Rattus norvegicus OX=10116 GN=Cdk20 PE=2 SV=2)

HSP 1 Score: 142.51 bits (358), Expect = 1.146e-35
Identity = 84/151 (55.63%), Postives = 108/151 (71.52%), Query Frame = 3
Query: 2535 NLRAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSATEXXXXXXXXXXXXXXXKSELPRPERSKIFNTHAH----QLYDTSPNIPIEDSCIDP 2975
            +L AVGCI GELLN SPLFPGENDIEQLCCVLR+LGTP+  +WPE+ +LPDYNKISF    PVP E VLPDA  +A+ L+   L+Y  ++R++A++ALLH YFF  PLPA  SELP P+R       AH     ++D   + P+E+S ++P
Sbjct:  186 DLWAVGCIMGELLNGSPLFPGENDIEQLCCVLRILGTPSPRVWPEITELPDYNKISFKEQAPVPLEEVLPDASHQALDLLGQFLLYPPRQRIAASQALLHQYFFTAPLPAHPSELPIPQRPGGPTPKAHPGPPHVHDFHVDRPLEESLLNP 336          
BLAST of cyclin-dependent kinase 20-like vs. UniProt/SwissProt
Match: sp|Q9JHU3|CDK20_MOUSE (Cyclin-dependent kinase 20 OS=Mus musculus OX=10090 GN=Cdk20 PE=1 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 2.567e-35
Identity = 84/151 (55.63%), Postives = 108/151 (71.52%), Query Frame = 3
Query: 2535 NLRAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSATEXXXXXXXXXXXXXXXKSELPRPERSKIFNTHAH----QLYDTSPNIPIEDSCIDP 2975
            +L AVGCI GELLN SPLFPGENDIEQLCCVLR+LGTP+  +WPE+ +LPDYNKISF    PVP E VLPDA  +A+ L+   L+Y  ++R++A++ALLH YFF  PLPA  SELP P+R       AH     ++D   + P+E+S ++P
Sbjct:  186 DLWAVGCIMGELLNGSPLFPGENDIEQLCCVLRILGTPSPRVWPEITELPDYNKISFKEQAPVPLEEVLPDASPQALDLLGQFLLYPPRQRIAASQALLHQYFFTAPLPAHPSELPIPQRPGGPAPKAHPGPPHVHDFHVDRPLEESLLNP 336          
BLAST of cyclin-dependent kinase 20-like vs. UniProt/SwissProt
Match: sp|Q5R7I7|CDK20_PONAB (Cyclin-dependent kinase 20 OS=Pongo abelii OX=9601 GN=CDK20 PE=2 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 1.045e-34
Identity = 83/151 (54.97%), Postives = 109/151 (72.19%), Query Frame = 3
Query: 2535 NLRAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSATEXXXXXXXXXXXXXXXKSELPRPERSKIFNTHAH----QLYDTSPNIPIEDSCIDP 2975
            +L AVGCI GELLN SPLFPG+NDIEQLC VLR+LGTPN  +WPE+ +LPDYNKISF    PVP E VLPDA  +A+ L+   L+Y  ++R++A++ALLH YFF  PLPA  SELP P+R  +    AH    +++D   + P+E+S ++P
Sbjct:  186 DLWAVGCIMGELLNGSPLFPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQAPVPLEEVLPDASPQALDLLGQFLLYPPRQRIAASKALLHQYFFTAPLPAHPSELPIPQRLGVPAPKAHPGPPRIHDFYVDRPLEESLLNP 336          
BLAST of cyclin-dependent kinase 20-like vs. UniProt/SwissProt
Match: sp|Q8N6M0|OTU6B_HUMAN (Deubiquitinase OTUD6B OS=Homo sapiens OX=9606 GN=OTUD6B PE=1 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 2.442e-32
Identity = 96/280 (34.29%), Postives = 148/280 (52.86%), Query Frame = 2
Query:   89 QNHKKELKSLQIEIQKLKKSVAKGDKKRLKEVQLTISNLEKETLERQKKEIDDFELSNF----------IQEVILPETXXXXXXXXXXXXXXXXXXXLYEEIIKNHEANELNSDSHKELEIIKKKLTDRDLLFIDIPADGNCLFNAIGYQCIRHKILDFSTEFSKSEDASLYLRELVYKELMKKQEFYSAFISDEDSS------EFSTYCEQIRSTRAWGGQLEINALSEVLECSIEVIQAYAPSIIIGAFNNKPQLIITYHKFAYGLGEHYNTCNLINN 880
            + H+KE K LQ +IQ +K +V K DKKR K++   ++ LEKE  ++ ++E++  +L+            I  ++L      I   + +R KK    K  EE I   E   L    H E E + + L  R L    IP+DG+C++ AI  Q ++ K    +    +S+ A  Y++  V        E +  F+++ ++       EF  YCE I +T AWGGQLE+ ALS +L+  IE+IQA +P II+G   +K  LI+ Y + AYGLGEHYN+   + N
Sbjct:   17 RRHRKEKKELQAKIQGMKNAVPKNDKKRRKQLTEDVAKLEKEMEQKHREELEQLKLTTKENKIDSVAVNISNLVLENQPPRISKAQKRREKKAALEKEREERIAEAEIENLTGARHMESEKLAQILAARQLEIKQIPSDGHCMYKAIEDQ-LKEKDCALTVVALRSQTAE-YMQSHV--------EDFLPFLTNPNTGDMYTPEEFQKYCEDIVNTAAWGGQLELRALSHILQTPIEIIQADSPPIIVGEEYSKKPLILVYMRHAYGLGEHYNSVTRLVN 286          
BLAST of cyclin-dependent kinase 20-like vs. TrEMBL
Match: A0A1W2W4A6 (cyclin-dependent kinase 20-like OS=Ciona intestinalis OX=7719 GN=LOC100179255 PE=3 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 7.495e-40
Identity = 90/151 (59.60%), Postives = 113/151 (74.83%), Query Frame = 3
Query: 2535 NLRAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSATEXXXXXXXXXXXXXXXKSELPRPERSKIFNTHAHQLYDTSPNIPIEDSCIDPMFLA 2987
            +L AVGCIFGE+LN SPLFPGENDIEQLCCVLRVLGTPNE +WP M  LPDYNKI+F    P+P E ++PDA ++A+ L++  LVY S +R++AT ALLHPYFF  PLPA  SELP P+R++  + H     +   ++PIE SCIDP  +A
Sbjct:  190 DLWAVGCIFGEMLNNSPLFPGENDIEQLCCVLRVLGTPNETIWPGMSILPDYNKITFPENPPIPLEEIVPDASEDALDLLKKFLVYPSNQRIAATHALLHPYFFTEPLPAHHSELPIPQRARKSSRHRSNFKEYDIDVPIEHSCIDPALIA 340          
BLAST of cyclin-dependent kinase 20-like vs. TrEMBL
Match: F6Z8X9 (Protein kinase domain-containing protein OS=Ciona intestinalis OX=7719 PE=3 SV=2)

HSP 1 Score: 161.77 bits (408), Expect = 8.056e-40
Identity = 90/151 (59.60%), Postives = 113/151 (74.83%), Query Frame = 3
Query: 2535 NLRAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSATEXXXXXXXXXXXXXXXKSELPRPERSKIFNTHAHQLYDTSPNIPIEDSCIDPMFLA 2987
            +L AVGCIFGE+LN SPLFPGENDIEQLCCVLRVLGTPNE +WP M  LPDYNKI+F    P+P E ++PDA ++A+ L++  LVY S +R++AT ALLHPYFF  PLPA  SELP P+R++  + H     +   ++PIE SCIDP  +A
Sbjct:  190 DLWAVGCIFGEMLNNSPLFPGENDIEQLCCVLRVLGTPNETIWPGMSILPDYNKITFPENPPIPLEEIVPDASEDALDLLKKFLVYPSNQRIAATHALLHPYFFTEPLPAHHSELPIPQRARKSSRHRSNFKEYDIDVPIEHSCIDPALIA 340          
BLAST of cyclin-dependent kinase 20-like vs. TrEMBL
Match: A0A210R3R5 (Cyclin-dependent kinase 20 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT11300 PE=3 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 3.134e-39
Identity = 91/151 (60.26%), Postives = 115/151 (76.16%), Query Frame = 3
Query: 2535 NLRAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSATEXXXXXXXXXXXXXXXKSELPRPERSKIFNTHAHQLYDTSPNIPIEDSCIDPMFLA 2987
            ++ AVGCIFGELLN SPLFPGENDIEQLCCVLRVLGTPNE +WP + +LPDYNKI+F   QP+P E ++PDA  EA+ L++ +LVY +K R+SA +ALLHPYFF  PLPA  SELP P+RS+       Q ++ + ++P+E S IDP  LA
Sbjct:  186 DIWAVGCIFGELLNNSPLFPGENDIEQLCCVLRVLGTPNESIWPGISELPDYNKITFPDNQPIPLEEIVPDATHEALSLLKKLLVYPTKSRISAKDALLHPYFFSEPLPAHHSELPIPQRSRRGLPRRQQTHEYNIDLPLEKSLIDPDLLA 336          
BLAST of cyclin-dependent kinase 20-like vs. TrEMBL
Match: A0A4S2LBE3 (Protein kinase domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008523 PE=4 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 3.543e-39
Identity = 88/163 (53.99%), Postives = 115/163 (70.55%), Query Frame = 3
Query: 2526 SCSNLRAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSATEXXXXXXXXXXXXXXXKSELPR--PERSKIFNT--HAHQLYDTSPNIPIEDSCIDPMFLANGSQL 3002
            +  +L A+GCIFGELLN SPLFPGENDIEQL  V+++LGTPNE +WPE+ DLPDYNKI+F+ C+P PFE VLPDA +EA+ LI+  L+YS  +R+SA+ AL H YF   PLPA  S+LPR  P RS +  +  H   +YD+  + P+E        L +G+QL
Sbjct:  136 AAVDLWAIGCIFGELLNNSPLFPGENDIEQLWVVIKILGTPNETIWPELKDLPDYNKITFNACEPTPFEDVLPDASREAVDLIKQFLIYSPDERISASRALQHSYFTTDPLPAHHSQLPRPGPNRSGLTTSILHPQHIYDSCLSCPLESILASHEMLFDGAQL 298          
BLAST of cyclin-dependent kinase 20-like vs. TrEMBL
Match: H2YSW5 (Protein kinase domain-containing protein OS=Ciona savignyi OX=51511 PE=3 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 3.581e-39
Identity = 89/151 (58.94%), Postives = 113/151 (74.83%), Query Frame = 3
Query: 2535 NLRAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSATEXXXXXXXXXXXXXXXKSELPRPERSKIFNTHAHQLYDTSPNIPIEDSCIDPMFLA 2987
            +L AVGCIFGE+LN SPLFPGENDIEQLCCVLRVLGTPNE +WP M  LPDYNKI+F    P+P E ++PDA ++A+ L++  L+Y S +R++A EALLHPYFF  PLPA  SELP P+R++  + H     +   ++PIE SCIDP  +A
Sbjct:  190 DLWAVGCIFGEMLNNSPLFPGENDIEQLCCVLRVLGTPNEAIWPGMSMLPDYNKITFPENPPIPLEEIVPDASEDALDLLKKFLLYPSNERIAAMEALLHPYFFTEPLPAHHSELPIPQRARKSSRHRSNFKEYDIDVPIEQSCIDPSLIA 340          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Cavefish
Match: cdk20 (cyclin dependent kinase 20 [Source:NCBI gene;Acc:103031389])

HSP 1 Score: 149.443 bits (376), Expect = 3.484e-39
Identity = 87/152 (57.24%), Postives = 111/152 (73.03%), Query Frame = 3
Query: 2541 RAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSATEXXXXXXXXXXXXXXXKSELPRPERSKIFNTHAHQL----YDTSPNIPIEDSCIDPMFL 2984
            RAVGCIFGELLN SPLFPGENDIEQLCCVLRVLGTPN+ +WPE+ +LPDYNKI+F    P+P E ++PD   +A+ L++  LVY SK+R+SA +ALLHPYFF  PLPA  SELP P+R      H+ Q     ++ S + P+ +S +DP  +
Sbjct:  167 RAVGCIFGELLNNSPLFPGENDIEQLCCVLRVLGTPNQKVWPEITELPDYNKITFKENPPIPLEEIVPDTSPQAVDLLKKFLVYPSKQRISARQALLHPYFFTDPLPAHHSELPIPQRG---GKHSRQRLQPPFEFSVDRPLSESLVDPSLI 315          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Cavefish
Match: cdk20 (cyclin dependent kinase 20 [Source:NCBI gene;Acc:103031389])

HSP 1 Score: 147.132 bits (370), Expect = 3.086e-38
Identity = 86/154 (55.84%), Postives = 112/154 (72.73%), Query Frame = 3
Query: 2535 NLRAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSATEXXXXXXXXXXXXXXXKSELPRPERSKIFNTHAHQL----YDTSPNIPIEDSCIDPMFL 2984
            ++ AVGCIFGELLN SPLFPGENDIEQLCCVLRVLGTPN+ +WPE+ +LPDYNKI+F    P+P E ++PD   +A+ L++  LVY SK+R+SA +ALLHPYFF  PLPA  SELP P+R      H+ Q     ++ S + P+ +S +DP  +
Sbjct:  186 DIWAVGCIFGELLNNSPLFPGENDIEQLCCVLRVLGTPNQKVWPEITELPDYNKITFKENPPIPLEEIVPDTSPQAVDLLKKFLVYPSKQRISARQALLHPYFFTDPLPAHHSELPIPQRG---GKHSRQRLQPPFEFSVDRPLSESLVDPSLI 336          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Cavefish
Match: otud6b (OTU deubiquitinase 6B [Source:NCBI gene;Acc:103036662])

HSP 1 Score: 113.62 bits (283), Expect = 3.953e-27
Identity = 87/285 (30.53%), Postives = 141/285 (49.47%), Query Frame = 2
Query:   83 LLQNHKKELKSLQIEIQKLKKSVAKGDKKRLKEVQLTISNLEKETLERQKKEIDDF-----------ELSNFIQEVILPETXXX------XXXXXXXXXXXXXXXXLYEEIIKNHEANELNSDSHKELEIIKKKLTDRDLLFIDIPADGNCLFNAIGYQCI-RHKILDFSTEFSKSEDASLYLRELVYKELMKKQEFYSAFISDEDSS------EFSTYCEQIRSTRAWGGQLEINALSEVLECSIEVIQAYAPSIIIGAFNNKPQLIITYHKFAYGLGEHYNTC 865
            L++  ++E K LQ +IQ +K +V K DKKR K++   I+ LE E  ++ + E+              E+S+ +  + L   E        +   + +R KK    K  E  I   E   L    H+E   +K+KLT++ L   +I +DG+C++ A+  Q + R + L               LR    + +      +  F+++ ++       EF  YC  +  T AWGGQLE+ AL++VL   IEVIQA +P+I+IG   +K  + + Y + AYGLGEHYN+ 
Sbjct:   11 LVKEQRREKKELQAKIQSMKNAVPKNDKKRRKQLTEDIAKLEAELSQKHENELKLLQTNSNAAEKVEEVSSAVNSINLSGGEQADGKQPRVTKAQKRRDKKAAQEKERENRIAEAELENLLGSRHQEGLKLKQKLTEKHLQIKEISSDGHCMYRAVEDQLVERGRALGIQE-----------LRAQTAQYMRSHSGDFLPFLTNPNTGDMYTEEEFEKYCSDVAETAAWGGQLELRALTQVLHLPIEVIQADSPAIVIGEEYDKLPITLIYMRHAYGLGEHYNSV 284          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Cavefish
Match: cdk2 (cyclin dependent kinase 2 [Source:NCBI gene;Acc:103028318])

HSP 1 Score: 74.7146 bits (182), Expect = 5.960e-14
Identity = 38/102 (37.25%), Postives = 61/102 (59.80%), Query Frame = 3
Query: 2511 KYFLFSCSNLRAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSA 2816
            KY+  +  ++ ++GCIF E++ R  LFPG+++I+QL  + R LGTP+E +WP +  +PDY K SF          V+P   ++   L+  +L Y   KR+SA
Sbjct:  181 KYY-STAVDIWSLGCIFAEMITRRALFPGDSEIDQLFRIFRTLGTPDETVWPGVTSMPDY-KPSFPKWALQDLAKVVPPLDEDGRDLLGQMLNYDPNKRISA 280          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Cavefish
Match: cdk1 (cyclin dependent kinase 1 [Source:NCBI gene;Acc:103047431])

HSP 1 Score: 73.9442 bits (180), Expect = 9.928e-14
Identity = 35/96 (36.46%), Postives = 60/96 (62.50%), Query Frame = 3
Query: 2535 NLRAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSATE 2822
            ++ ++G IF EL  + PLF G+++I+QL  + R+LGTPN  +WP++  LPDY K +F   +     +++ +  K  I L+  +L+Y   KR+SA +
Sbjct:  186 DVWSIGTIFAELATKKPLFHGDSEIDQLFRIFRILGTPNNDVWPDVESLPDY-KNTFPKWKTGNLSSMVKNLDKNGIDLLGKMLIYDPLKRISARQ 280          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Sea Lamprey
Match: cdk20 (cyclin-dependent kinase 20 [Source:NCBI gene;Acc:494112])

HSP 1 Score: 141.354 bits (355), Expect = 7.000e-38
Identity = 81/121 (66.94%), Postives = 98/121 (80.99%), Query Frame = 3
Query: 2535 NLRAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSATEXXXXXXXXXXXXXXXKSELPRPERS 2897
            +L AVGCI GELLN SPLFPGENDIEQLCCVLRVLGTPN+ +WPE+ +LPDYNKI+F     +P E V+PDAP EA++L+  +LVY S++R+ A+EALLHPYFF  PLPA  SELP P+R 
Sbjct:  131 DLWAVGCILGELLNCSPLFPGENDIEQLCCVLRVLGTPNQHVWPEITELPDYNKIAFRENAALPLEEVVPDAPPEAVELLRRLLVYPSRQRIPASEALLHPYFFTAPLPAHHSELPIPQRG 251          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001709.1 (pep scaffold:Pmarinus_7.0:GL480466:152796:160657:1 gene:ENSPMAG00000001541.1 transcript:ENSPMAT00000001709.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 125.176 bits (313), Expect = 9.485e-32
Identity = 90/295 (30.51%), Postives = 142/295 (48.14%), Query Frame = 2
Query:   77 DDLLQNHKKELKSLQIEIQKLKKSVAKGDKKRLKEVQLTISNLEKETLERQKKE----------------------IDDFELSNFIQEVILPETXXXXXXXXXXXXXXXXXXXLYEEIIKNHEANELNSDS-HKELEIIKKKLTDRDLLFIDIPADGNCLFNAIGYQCIRHKILDFSTEFSKSEDASLYLRELVYKELMKKQEFYSAFISDEDSSE------FSTYCEQIRSTRAWGGQLEINALSEVLECSIEVIQAYAPSIIIGAFNNKPQLIITYHKFAYGLGEHYNTCNLI 874
            ++L Q HK+E K LQ  +Q +K +V K DKKR K++   ++  E E   R ++E                      +   EL++  +     ET+  +   + +R KK  + +  E  I   E NEL   + H E   +   L  R L    +P DG+C++ A+ +Q         S    ++  AS Y+R+        + EF + F++   + E      F  YC+++  T AWGGQLE+ ALS  LE  +EV+QA AP+I IG   + P + + Y + AYGLGEHY++   I
Sbjct:   16 EELSQRHKREKKELQGRVQAMKNAVPKNDKKRRKQLADEVAQTEAELEARHERERLALAGEHSESQAATVGSVLDALASVELTSVAENAGTTETQLRVSKAQKRRDKKAASEREREARIVAAELNELTHGARHLEGRRVADLLAARGLHARPVPPDGHCMYAAVRHQLEARAGPALSIAELRTRAAS-YIRQ-------HRDEF-APFLTQAGTGEAYTDEEFDKYCDEVEKTAAWGGQLELRALSHALETPLEVVQASAPTITIGDEYHVPPITLIYMRHAYGLGEHYDSVEPI 301          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Sea Lamprey
Match: cdk7 (cyclin-dependent kinase 7 [Source:ZFIN;Acc:ZDB-GENE-010320-2])

HSP 1 Score: 87.8113 bits (216), Expect = 1.059e-18
Identity = 51/133 (38.35%), Postives = 79/133 (59.40%), Query Frame = 3
Query: 2505 LFKYFLFSCS-NLRAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSATEXXXXXXXXXXXXXXXKSELPRPERSK 2900
            LF   ++    ++ AVGCI  ELL R+P  PG++D++QL  +   LGTP E LWP M +LPDY  + +      P E +   A  + ++L++G+  +S   RL+AT+A+  PYF   P P P ++LPRP  ++
Sbjct:  198 LFGARMYGVGVDMWAVGCILAELLLRTPFLPGDSDLDQLSKIFEALGTPTEELWPGMTNLPDY--VEYKSFPGTPLENIFTAATDDLLELLQGLFTFSPAARLTATQAMQMPYFSNRPGPTPPAQLPRPSFAR 328          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Sea Lamprey
Match: cdk1 (cyclin-dependent kinase 1 [Source:ZFIN;Acc:ZDB-GENE-010320-1])

HSP 1 Score: 77.0258 bits (188), Expect = 1.602e-15
Identity = 37/94 (39.36%), Postives = 59/94 (62.77%), Query Frame = 3
Query: 2535 NLRAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSA 2816
            ++ +VG I  E++N+ PLF G+++I+QL  + R+LGTP   +WP++V LPDY K SF    P      +P   ++ I L+E +L Y   +R+SA
Sbjct:  176 DMWSVGTILAEMVNKRPLFHGDSEIDQLFRIFRILGTPTTEVWPDVVTLPDY-KPSFPKWVPSGLVAHVPGLNQDGIDLLEKMLTYDPARRISA 268          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Sea Lamprey
Match: cdk2 (cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2741])

HSP 1 Score: 74.3294 bits (181), Expect = 1.374e-14
Identity = 37/97 (38.14%), Postives = 58/97 (59.79%), Query Frame = 3
Query: 2526 SCSNLRAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSA 2816
            +  ++ ++GCIF E+L R  LFPG+++I+QL  + R LGTP+EV+WP +  LPDY K +F          V+P    E   L+  +L Y   +R++A
Sbjct:  182 TSVDVWSIGCIFAEMLTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVSQLPDY-KSTFPRWANQELTKVVPTLNFEGRDLLALMLQYDPNQRVTA 277          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Yeast
Match: CDC28 (Cyclin-dependent kinase (CDK) catalytic subunit; master regulator of mitotic and meiotic cell cycles; alternately associates with G1, S, G2/M phase cyclins, which provide substrate specificity; regulates metabolism, basal transcription, chromosome dynamics, growth and morphogenesis; transcript induction in osmostress involves antisense RNA; human homologs CDK1, CDK2, CDK3 can complement yeast conditional cdc28 mutants; human CDK1, CDK2 can complement yeast cdc28 null mutant [Source:SGD;Acc:S000000364])

HSP 1 Score: 80.1073 bits (196), Expect = 9.390e-17
Identity = 38/91 (41.76%), Postives = 58/91 (63.74%), Query Frame = 3
Query: 2544 AVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSA 2816
            ++GCIF E+ NR P+F G+++I+Q+  + RVLGTPNE +WP++V LPD+ K SF   +      V+P      I L++ +L Y    R+SA
Sbjct:  197 SIGCIFAEMCNRKPIFSGDSEIDQIFKIFRVLGTPNEAIWPDIVYLPDF-KPSFPQWRRKDLSQVVPSLDPRGIDLLDKLLAYDPINRISA 286          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Yeast
Match: OTU2 (Protein of unknown function; may interact with ribosomes, based on co-purification experiments; member of the ovarian tumor-like (OTU) superfamily of predicted cysteine proteases; shows cytoplasmic localization; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000001005])

HSP 1 Score: 76.2554 bits (186), Expect = 2.271e-15
Identity = 45/140 (32.14%), Postives = 74/140 (52.86%), Query Frame = 2
Query:  461 DIPADGNCLFNAIGYQC-IRH--KILDFSTEFSKSEDASLYLRELVYKELMKKQEFYSAFISDEDS---SEFSTYCEQIRSTRAWGGQLEINALSEVLECSIEVIQAYAPSIIIGAFNNKPQLIITYHKFAYGLGEHYNT 862
            DI  DG+CLF +I  Q  +RH  K LD   +  K       LR L    + + ++ +  ++ DE++    +   Y +++  T  WGG++EI ALS V +C I ++ +  P  +       P+L + Y+K +Y LGEHYN+
Sbjct:  171 DIQPDGHCLFASILDQLKLRHDPKKLDQDMDVMK-------LRWLSCNYVQEHRDDFIPYLFDEETMKMKDIDEYTKEMEHTAQWGGEIEILALSHVFDCPISILMSGRPIQVYNECGKNPELKLVYYKHSYALGEHYNS 303          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Yeast
Match: PHO85 (Cyclin-dependent kinase; has ten cyclin partners; involved in regulating the cellular response to nutrient levels and environmental conditions and progression through the cell cycle; human lissencephaly-associated homolog CDK5 functionally complements null mutation [Source:SGD;Acc:S000005952])

HSP 1 Score: 66.6254 bits (161), Expect = 3.314e-12
Identity = 37/101 (36.63%), Postives = 52/101 (51.49%), Query Frame = 3
Query: 2535 NLRAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKE-----AIKLIEGILVYSSKKRLSATE 2822
            ++ + GCI  E++   PLFPG ND EQL  +  ++GTPNE LWP +  LP YN  +     P     VL    KE      +  + G+L  +   RLSA +
Sbjct:  191 DIWSCGCILAEMITGKPLFPGTNDEEQLKLIFDIMGTPNESLWPSVTKLPKYNP-NIQQRPPRDLRQVLQPHTKEPLDGNLMDFLHGLLQLNPDMRLSAKQ 290          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Yeast
Match: KDX1 (Protein kinase; implicated in Slt2p mitogen-activated (MAP) kinase signaling pathway; interacts with numerous components in the mating pheromone and CWI MAPK pathways; associates with Rlm1p; KDX1 has a paralog, SLT2, that arose from the whole genome duplication [Source:SGD;Acc:S000001644])

HSP 1 Score: 65.4698 bits (158), Expect = 1.889e-11
Identity = 34/97 (35.05%), Postives = 57/97 (58.76%), Query Frame = 3
Query: 2535 NLRAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKI-SFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSATE 2822
            ++ + GCI  ELL R P+F G++ ++ L  +L++LGTP E    E+     YN I  F       FE++LP A  EA++L++ +L +  KKR++  +
Sbjct:  215 DIWSTGCILAELLGRKPMFEGKDYVDHLNHILQILGTPPEETLQEIASQKVYNYIFQFGNIPGRSFESILPGANPEALELLKKMLEFDPKKRITVED 311          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Yeast
Match: KIN28 (Serine/threonine protein kinase, subunit of transcription factor TFIIH; involved in transcription initiation at RNA polymerase II promoters; phosphorylates Ser5 residue of the PolII C-terminal domain (CTD) at gene promoters; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000002266])

HSP 1 Score: 62.7734 bits (151), Expect = 7.361e-11
Identity = 35/103 (33.98%), Postives = 54/103 (52.43%), Query Frame = 3
Query: 2526 SCSNLRAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPD----APKEAIKLIEGILVYSSKKRLSATE 2822
            S  ++ +VG IF EL+ R P  PG+ND++Q+    R LGTP +  WPE+     YNK+      P P    L      A + A+  + G+L  + +KR +A +
Sbjct:  184 SAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQI---YPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQ 283          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Nematostella
Match: EDO49865 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7REX1])

HSP 1 Score: 142.124 bits (357), Expect = 7.792e-37
Identity = 89/154 (57.79%), Postives = 110/154 (71.43%), Query Frame = 3
Query: 2535 NLRAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSATEXXXXXXXXXXXXXXXKSELPRPER----SKIFNTHAHQLYDTSPNIPIEDSCIDPMFL 2984
            +L AVGCIFGELLN SPLFPGENDIEQLCCVL+ LGTPNE +WP M DLPDYNKI+F     +P E ++PDA  EA+ L++  LVY SKKR+ A+EALLHPYFF+ PLPA  SELP P R    + +  +H  + +D S    +E S ++P  L
Sbjct:  189 DLWAVGCIFGELLNNSPLFPGENDIEQLCCVLKTLGTPNEEIWPGMTDLPDYNKITFPDMPAIPLEKIVPDASPEAMDLLKRFLVYPSKKRIPASEALLHPYFFMEPLPAHHSELPIPSRNSRKASLRASHGKR-FDISTK--LEKSLVNPARL 339          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Nematostella
Match: EDO45974 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRA0])

HSP 1 Score: 132.88 bits (333), Expect = 1.985e-34
Identity = 101/277 (36.46%), Postives = 150/277 (54.15%), Query Frame = 2
Query:   77 DDLLQNHKKELKSLQIEIQKLKKSVAKGDKKRLKEVQLTISNLEKETLERQKKEIDDFELSNFIQEVILPET-------XXXXXXXXXXXXXXXXXXXLYEEIIKNHEANELNSDSHKELEIIKKKLTDRDLLFIDIPADGNCLFNAIGYQCIRHKILDFSTEFSKSEDASLYLRELVYKELMKKQEFYSAFISDEDSS------EFSTYCEQIRSTRAWGGQLEINALSEVLECSIEVIQAYAPSIIIGA-FNNKPQLIITYHKFAYGLGEHYNTC 865
            +D+ Q HK+E K LQ +IQ LK SV KGDKK+ KEV L I+ +E +  +R K+E +  + S   ++  L ET       E ++   + +R KK +     E+ I   +   +NS  + E   IK++L + +L  ++I  DG+CL+NA+  Q  R             E   L LR+     +    E +  F++  D+       +FS YCE I  T  WGGQLE+ ALS VL   IE++QA AP+I IG  F  +P + ++YH+ AYGLGEHYN+ 
Sbjct:   12 EDISQRHKRERKELQAKIQALKHSVPKGDKKKKKEVTLEIAKIEADQEKRHKQEQEKNKKSTEPEK--LEETHISSGCSEEKVSRAQKRRVKKASKENEREQRIAAADLENVNSARNVEAMKIKQRLKEINLEIVEILPDGHCLYNAVADQMKR----------RNKEIKMLSLRQQTADYMSSHSEDFLPFLTHPDTGDMYTPEQFSKYCEDIAETSVWGGQLELRALSHVLRLPIEILQADAPAIKIGEEFEEQP-ITLSYHRHAYGLGEHYNSV 275          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Nematostella
Match: EDO25906 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TDE0])

HSP 1 Score: 115.931 bits (289), Expect = 1.090e-30
Identity = 54/78 (69.23%), Postives = 61/78 (78.21%), Query Frame = 3
Query: 2535 NLRAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIK 2768
            +L AVGCIFGELLN SPLFPGENDIEQLCCVL+ LGTPNE +WP M DLPDYNKI+F     +P E ++PDA  E  K
Sbjct:   24 DLWAVGCIFGELLNNSPLFPGENDIEQLCCVLKTLGTPNEEIWPGMTDLPDYNKITFPDMPAIPLEKIVPDASPEVRK 101          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Nematostella
Match: EDO41403 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4F0])

HSP 1 Score: 78.1814 bits (191), Expect = 1.426e-15
Identity = 38/94 (40.43%), Postives = 57/94 (60.64%), Query Frame = 3
Query: 2535 NLRAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSA 2816
            ++ ++GCIF E+  R  LFPG+++I+QL  + R LGTP++ +WP + +LPDY K SF          VLP     AI L++ +L Y    R+SA
Sbjct:  185 DVWSIGCIFAEMKTRRALFPGDSEIDQLFRIFRTLGTPDDKVWPGVSELPDY-KTSFPKWPVQSIRHVLPTLDNTAIDLLQKMLTYQPNARISA 277          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Nematostella
Match: EDO37567 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFE6])

HSP 1 Score: 68.1662 bits (165), Expect = 3.659e-12
Identity = 34/96 (35.42%), Postives = 57/96 (59.38%), Query Frame = 3
Query: 2535 NLRAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSATE 2822
            ++ +V CI  EL NR PLF G+ND++QL  +  ++G+P++  WP+ V LP     SFS      F+ ++P+   E   L++ +L +  + R SA+E
Sbjct:  194 DIWSVACILAELFNRRPLFEGKNDVDQLDKIFSIIGSPSQDEWPQNVSLP---WTSFSRYTTGSFQALVPEMCTEGTTLLKEMLQFLPRSRPSASE 286          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Medaka
Match: cdk20 (cyclin dependent kinase 20 [Source:NCBI gene;Acc:101166132])

HSP 1 Score: 139.043 bits (349), Expect = 1.146e-35
Identity = 92/171 (53.80%), Postives = 110/171 (64.33%), Query Frame = 3
Query: 2490 FSLLQLFKY---FLFSCS-NLRAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSATEXXXXXXXXXXXXXXXKSELPRPERSK--IFNTHAHQLYDTSPNIPIEDSCIDPMFL 2984
            F L +LF +    L+S     RAVGCIFGELLN SPLFPGENDIEQLCCVLRVLGTP    WPEM++LPDYNKI+F     +P E ++PD P + I L+   LVY S +R SA+EALLHPYFF  PLPA  SELP P R              D S N+ ++ S + P+ L
Sbjct:  146 FGLARLFSHEGRRLYSHQVATRAVGCIFGELLNSSPLFPGENDIEQLCCVLRVLGTPTVDSWPEMLELPDYNKITFKENPAIPLEEIVPDTPPQGIHLLYRFLVYPSSQRCSASEALLHPYFFSCPLPAHHSELPIPHRGGRPPHQHPQAPPPDFSVNLSLQSSVVAPVLL 316          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Medaka
Match: cdk20 (cyclin dependent kinase 20 [Source:NCBI gene;Acc:101166132])

HSP 1 Score: 137.502 bits (345), Expect = 7.800e-35
Identity = 86/152 (56.58%), Postives = 102/152 (67.11%), Query Frame = 3
Query: 2535 NLRAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSATEXXXXXXXXXXXXXXXKSELPRPERSK--IFNTHAHQLYDTSPNIPIEDSCIDPMFL 2984
            +L AVGCIFGELLN SPLFPGENDIEQLCCVLRVLGTP    WPEM++LPDYNKI+F     +P E ++PD P + I L+   LVY S +R SA+EALLHPYFF  PLPA  SELP P R              D S N+ ++ S + P+ L
Sbjct:  188 DLWAVGCIFGELLNSSPLFPGENDIEQLCCVLRVLGTPTVDSWPEMLELPDYNKITFKENPAIPLEEIVPDTPPQGIHLLYRFLVYPSSQRCSASEALLHPYFFSCPLPAHHSELPIPHRGGRPPHQHPQAPPPDFSVNLSLQSSVVAPVLL 339          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Medaka
Match: otud6b (OTU deubiquitinase 6B [Source:NCBI gene;Acc:101159449])

HSP 1 Score: 121.709 bits (304), Expect = 5.961e-30
Identity = 86/292 (29.45%), Postives = 146/292 (50.00%), Query Frame = 2
Query:   83 LLQNHKKELKSLQIEIQKLKKSVAKGDKKRLKEVQLTISNLEKETLERQKKEIDDF---------ELSNFIQ----------EVILPE-TXXXXXXXXXXXXXXXXXXXLYEEIIKNHEANELNSDSHKELEIIKKKLTDRDLLFIDIPADGNCLFNAIGYQCIRHKILDFSTEFSKSEDASLYLRELVYKELMKKQEFYSAFISDEDSS------EFSTYCEQIRSTRAWGGQLEINALSEVLECSIEVIQAYAPSIIIGAFNNKPQLIITYHKFAYGLGEHYNTCNLINN 880
            L++ H+KE K LQ +IQ +K +V K DKKR K++   I+ LE +  +R + E+            E +N ++          EV  P  T+ + + +K   ++K+ + ++ E  ++N     L    H+E   + +KL ++ L   +I +DG+C++ A+  Q  +      +  F +       LR    + +    E +  F+S+  +       EF  YC ++  T AWGGQLE+ AL+ VL   IEVIQA +P++ IG   +   + + Y   AYGLGEHYN+   + N
Sbjct:   11 LIKQHRKEKKDLQAKIQSMKNAVPKNDKKRRKQLTEDIAKLEADLSQRHEDELQQLKSAPDKDVEEAANGVETLKVEAGEQEEVKQPRVTKAQKRRDKKAAQEKERDSRIAEAEVQN-----LQGVRHQEGVKLAQKLAEKTLQIKEISSDGHCMYRAVEDQLTQRSKPGLNVTFKE-------LRSRTAEHMRNNPENFLPFLSNPTTGDTITTDEFEKYCSEVEHTAAWGGQLELRALTHVLRLPIEVIQADSPTLKIGEEYDAEPITLVYMHHAYGLGEHYNSVEPLKN 290          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Medaka
Match: cdk2 (cyclin dependent kinase 2 [Source:NCBI gene;Acc:101161880])

HSP 1 Score: 75.0998 bits (183), Expect = 2.472e-14
Identity = 37/97 (38.14%), Postives = 58/97 (59.79%), Query Frame = 3
Query: 2526 SCSNLRAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSA 2816
            +  ++ ++GCIF E++ R  LFPG+++I+QL  + R LGTP+E  WP +  +PDY K SF          V+P   ++  +L+  +L Y   KRLSA
Sbjct:  156 TAVDVWSLGCIFAEMITRRALFPGDSEIDQLFRIFRTLGTPDETAWPGVTSMPDY-KPSFPKWARQDLSKVVPLLDEDGRELLGEMLKYDPNKRLSA 251          
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Medaka
Match: cdk2 (cyclin dependent kinase 2 [Source:NCBI gene;Acc:101161880])

HSP 1 Score: 75.0998 bits (183), Expect = 3.626e-14
Identity = 39/102 (38.24%), Postives = 61/102 (59.80%), Query Frame = 3
Query: 2511 KYFLFSCSNLRAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSA 2816
            KY+  +  ++ ++GCIF E++ R  LFPG+++I+QL  + R LGTP+E  WP +  +PDY K SF          V+P   ++  +L+  +L Y   KRLSA
Sbjct:  178 KYY-STAVDVWSLGCIFAEMITRRALFPGDSEIDQLFRIFRTLGTPDETAWPGVTSMPDY-KPSFPKWARQDLSKVVPLLDEDGRELLGEMLKYDPNKRLSA 277          
BLAST of cyclin-dependent kinase 20-like vs. Planmine SMEST
Match: SMESG000021734.1 (SMESG000021734.1)

HSP 1 Score: 501.516 bits (1290), Expect = 4.720e-171
Identity = 271/271 (100.00%), Postives = 271/271 (100.00%), Query Frame = 2
Query:   74 MDDLLQNHKKELKSLQIEIQKLKKSVAKGDKKRLKEVQLTISNLEKETLERQKKEIDDFELSNFIQEVILPETXXXXXXXXXXXXXXXXXXXLYEEIIKNHEANELNSDSHKELEIIKKKLTDRDLLFIDIPADGNCLFNAIGYQCIRHKILDFSTEFSKSEDASLYLRELVYKELMKKQEFYSAFISDEDSSEFSTYCEQIRSTRAWGGQLEINALSEVLECSIEVIQAYAPSIIIGAFNNKPQLIITYHKFAYGLGEHYNTCNLINNEK 886
            MDDLLQNHKKELKSLQIEIQKLKKSVAKGDKKRLKEVQLTISNLEKETLERQKKEIDDFELSNFIQEVILPETENEIKIEKPKRRKKKNNVKLYEEIIKNHEANELNSDSHKELEIIKKKLTDRDLLFIDIPADGNCLFNAIGYQCIRHKILDFSTEFSKSEDASLYLRELVYKELMKKQEFYSAFISDEDSSEFSTYCEQIRSTRAWGGQLEINALSEVLECSIEVIQAYAPSIIIGAFNNKPQLIITYHKFAYGLGEHYNTCNLINNEK
Sbjct:    1 MDDLLQNHKKELKSLQIEIQKLKKSVAKGDKKRLKEVQLTISNLEKETLERQKKEIDDFELSNFIQEVILPETENEIKIEKPKRRKKKNNVKLYEEIIKNHEANELNSDSHKELEIIKKKLTDRDLLFIDIPADGNCLFNAIGYQCIRHKILDFSTEFSKSEDASLYLRELVYKELMKKQEFYSAFISDEDSSEFSTYCEQIRSTRAWGGQLEINALSEVLECSIEVIQAYAPSIIIGAFNNKPQLIITYHKFAYGLGEHYNTCNLINNEK 271          
BLAST of cyclin-dependent kinase 20-like vs. Planmine SMEST
Match: SMESG000035458.1 (SMESG000035458.1)

HSP 1 Score: 295.819 bits (756), Expect = 2.184e-91
Identity = 160/162 (98.77%), Postives = 161/162 (99.38%), Query Frame = 3
Query: 2535 NLRAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSATEXXXXXXXXXXXXXXXKSELPRPERSKIFNTHAHQLYDTSPNIPIEDSCIDPMFLANGSQLSMFYNH 3020
            +L AVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSATEALLHPYFFLPPLPAPKSELPRPERSKIFNTHAHQLYDTSPNIPIEDSCIDPMFLANGSQLSMFYNH
Sbjct:  186 DLWAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSATEALLHPYFFLPPLPAPKSELPRPERSKIFNTHAHQLYDTSPNIPIEDSCIDPMFLANGSQLSMFYNH 347          
BLAST of cyclin-dependent kinase 20-like vs. Planmine SMEST
Match: SMESG000035458.1 (SMESG000035458.1)

HSP 1 Score: 295.049 bits (754), Expect = 5.224e-91
Identity = 159/159 (100.00%), Postives = 159/159 (100.00%), Query Frame = 3
Query: 2544 AVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSATEXXXXXXXXXXXXXXXKSELPRPERSKIFNTHAHQLYDTSPNIPIEDSCIDPMFLANGSQLSMFYNH 3020
            AVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSATEALLHPYFFLPPLPAPKSELPRPERSKIFNTHAHQLYDTSPNIPIEDSCIDPMFLANGSQLSMFYNH
Sbjct:  195 AVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSATEALLHPYFFLPPLPAPKSELPRPERSKIFNTHAHQLYDTSPNIPIEDSCIDPMFLANGSQLSMFYNH 353          
BLAST of cyclin-dependent kinase 20-like vs. Planmine SMEST
Match: SMESG000079369.1 (SMESG000079369.1)

HSP 1 Score: 68.5514 bits (166), Expect = 6.206e-12
Identity = 33/96 (34.38%), Postives = 52/96 (54.17%), Query Frame = 3
Query: 2535 NLRAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSATE 2822
            ++ A+GCI  E+  R P FPG++D+ Q+  +  V+G P+   WP+       NK++FS   P PFE +    P + I L+  +L     KR + TE
Sbjct:  198 DMWAIGCIIAEICLRRPFFPGDSDLHQISLIFEVIGVPDNNNWPDYKYFE--NKMTFSSSNPTPFEQIFTAIPDDLIDLLYRLLSLDPLKRGTCTE 291          
BLAST of cyclin-dependent kinase 20-like vs. Planmine SMEST
Match: SMESG000057110.1 (SMESG000057110.1)

HSP 1 Score: 68.1662 bits (165), Expect = 7.924e-12
Identity = 36/107 (33.64%), Postives = 61/107 (57.01%), Query Frame = 3
Query: 2499 LQLFKYFLFSCSNLRAVGCIFGELLNRSPLFPGENDIEQLCCVLRVLGTPNEVLWPEMVDLPDYNKISFSVCQPV-PFETVLPDAPKEAIKLIEGILVYSSKKRLSA 2816
            +Q F   ++SC      GCI  ELL   P+ PG+ +I+Q+  ++++LGTPNE +WP++V+LP Y K  F + QP    ++  P       +++  + VY   +R +A
Sbjct:  210 IQTFNTDMWSC------GCIMAELLLNKPILPGKGEIQQIDLIIKLLGTPNENIWPDIVNLPLYKKQVF-IQQPYNNLKSHFPWVSDSCYRILNSLFVYDPTQRATA 309          
The following BLAST results are available for this feature:
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CDK202.230e-3353.69cyclin dependent kinase 20 [Source:HGNC Symbol;Acc... [more]
CDK203.485e-3353.69cyclin dependent kinase 20 [Source:HGNC Symbol;Acc... [more]
OTUD6B5.084e-3334.29OTU deubiquitinase 6B [Source:HGNC Symbol;Acc:HGNC... [more]
CDK208.563e-3352.98cyclin dependent kinase 20 [Source:HGNC Symbol;Acc... [more]
OTUD6B1.125e-3234.29OTU deubiquitinase 6B [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
otub-31.440e-1431.36OTUBain deubiquitylating protease homolog [Source... [more]
otub-31.978e-1431.36OTUBain deubiquitylating protease homolog [Source... [more]
otub-31.978e-1431.36OTUBain deubiquitylating protease homolog [Source... [more]
otub-32.944e-1431.36OTUBain deubiquitylating protease homolog [Source... [more]
dyf-56.218e-1234.38Serine/threonine-protein kinase dyf-5 [Source:Uni... [more]
back to top
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG78573.221e-2230.98gene:FBgn0026738 transcript:FBtr0075605[more]
CG68003.188e-1639.18gene:FBgn0038902 transcript:FBtr0084132[more]
Cdk11.918e-1336.63gene:FBgn0004106 transcript:FBtr0080051[more]
Cdk73.937e-1133.33gene:FBgn0263237 transcript:FBtr0070756[more]
Cdk26.383e-1135.29gene:FBgn0004107 transcript:FBtr0083922[more]
back to top
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdk203.485e-3956.29cyclin-dependent kinase 20 [Source:NCBI gene;Acc:4... [more]
cdk202.443e-3855.84cyclin-dependent kinase 20 [Source:NCBI gene;Acc:4... [more]
otud6b2.609e-3230.45OTU deubiquitinase 6B [Source:NCBI gene;Acc:393194... [more]
cdk21.999e-1437.25cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
cdk72.075e-1438.84cyclin-dependent kinase 7 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
otud6b2.432e-3231.82OTU deubiquitinase 6B [Source:NCBI gene;Acc:496720... [more]
cdk21.356e-1539.00cyclin-dependent kinase 2 [Source:NCBI gene;Acc:49... [more]
eps152.853e-1238.30epidermal growth factor receptor pathway substrate... [more]
dnajc35.150e-1234.38DnaJ heat shock protein family (Hsp40) member C3 [... [more]
dnajc35.193e-1234.38DnaJ heat shock protein family (Hsp40) member C3 [... [more]
back to top
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cdk201.722e-3654.55cyclin-dependent kinase 20 [Source:MGI Symbol;Acc:... [more]
Cdk203.670e-3655.63cyclin-dependent kinase 20 [Source:MGI Symbol;Acc:... [more]
Otud6b1.712e-3131.25OTU domain containing 6B [Source:MGI Symbol;Acc:MG... [more]
Otud6b3.106e-3131.25OTU domain containing 6B [Source:MGI Symbol;Acc:MG... [more]
Otud6a1.536e-2929.31OTU domain containing 6A [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of cyclin-dependent kinase 20-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A8WIP6|CDK20_DANRE1.844e-3755.84Cyclin-dependent kinase 20 OS=Danio rerio OX=7955 ... [more]
sp|Q4KM34|CDK20_RAT1.146e-3555.63Cyclin-dependent kinase 20 OS=Rattus norvegicus OX... [more]
sp|Q9JHU3|CDK20_MOUSE2.567e-3555.63Cyclin-dependent kinase 20 OS=Mus musculus OX=1009... [more]
sp|Q5R7I7|CDK20_PONAB1.045e-3454.97Cyclin-dependent kinase 20 OS=Pongo abelii OX=9601... [more]
sp|Q8N6M0|OTU6B_HUMAN2.442e-3234.29Deubiquitinase OTUD6B OS=Homo sapiens OX=9606 GN=O... [more]
back to top
BLAST of cyclin-dependent kinase 20-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1W2W4A67.495e-4059.60cyclin-dependent kinase 20-like OS=Ciona intestina... [more]
F6Z8X98.056e-4059.60Protein kinase domain-containing protein OS=Ciona ... [more]
A0A210R3R53.134e-3960.26Cyclin-dependent kinase 20 OS=Mizuhopecten yessoen... [more]
A0A4S2LBE33.543e-3953.99Protein kinase domain-containing protein OS=Opisth... [more]
H2YSW53.581e-3958.94Protein kinase domain-containing protein OS=Ciona ... [more]
back to top
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdk203.484e-3957.24cyclin dependent kinase 20 [Source:NCBI gene;Acc:1... [more]
cdk203.086e-3855.84cyclin dependent kinase 20 [Source:NCBI gene;Acc:1... [more]
otud6b3.953e-2730.53OTU deubiquitinase 6B [Source:NCBI gene;Acc:103036... [more]
cdk25.960e-1437.25cyclin dependent kinase 2 [Source:NCBI gene;Acc:10... [more]
cdk19.928e-1436.46cyclin dependent kinase 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdk207.000e-3866.94cyclin-dependent kinase 20 [Source:NCBI gene;Acc:4... [more]
ENSPMAT00000001709.19.485e-3230.51pep scaffold:Pmarinus_7.0:GL480466:152796:160657:1... [more]
cdk71.059e-1838.35cyclin-dependent kinase 7 [Source:ZFIN;Acc:ZDB-GEN... [more]
cdk11.602e-1539.36cyclin-dependent kinase 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
cdk21.374e-1438.14cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CDC289.390e-1741.76Cyclin-dependent kinase (CDK) catalytic subunit; m... [more]
OTU22.271e-1532.14Protein of unknown function; may interact with rib... [more]
PHO853.314e-1236.63Cyclin-dependent kinase; has ten cyclin partners; ... [more]
KDX11.889e-1135.05Protein kinase; implicated in Slt2p mitogen-activa... [more]
KIN287.361e-1133.98Serine/threonine protein kinase, subunit of transc... [more]
back to top
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO498657.792e-3757.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO459741.985e-3436.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO259061.090e-3069.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414031.426e-1540.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375673.659e-1235.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of cyclin-dependent kinase 20-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdk201.146e-3553.80cyclin dependent kinase 20 [Source:NCBI gene;Acc:1... [more]
cdk207.800e-3556.58cyclin dependent kinase 20 [Source:NCBI gene;Acc:1... [more]
otud6b5.961e-3029.45OTU deubiquitinase 6B [Source:NCBI gene;Acc:101159... [more]
cdk22.472e-1438.14cyclin dependent kinase 2 [Source:NCBI gene;Acc:10... [more]
cdk23.626e-1438.24cyclin dependent kinase 2 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of cyclin-dependent kinase 20-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000021734.14.720e-171100.00SMESG000021734.1[more]
SMESG000035458.12.184e-9198.77SMESG000035458.1[more]
SMESG000035458.15.224e-91100.00SMESG000035458.1[more]
SMESG000079369.16.206e-1234.38SMESG000079369.1[more]
SMESG000057110.17.924e-1233.64SMESG000057110.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016627 ID=SMED30016627|Name=cyclin-dependent kinase 20-like|organism=Schmidtea mediterranea sexual|type=transcript|length=3094bp
ATTCTTCAATAAAATAATTTATAACCATACTACGTTGTTTAAATAATATT
TCAACTATTTCAAATATAGAATTATGGATGATCTTTTACAGAATCATAAA
AAGGAATTGAAGTCTTTACAAATTGAAATTCAAAAATTGAAGAAGTCAGT
AGCTAAAGGGGATAAAAAACGGCTTAAAGAAGTTCAACTTACAATTTCAA
ATTTAGAAAAAGAAACTTTAGAAAGGCAGAAAAAAGAAATTGATGATTTT
GAACTGTCTAATTTTATTCAAGAAGTGATTTTGCCAGAAACTGAAAATGA
AATTAAAATTGAAAAACCAAAACGAAGGAAAAAGAAAAATAATGTAAAGT
TGTATGAAGAAATAATTAAGAATCATGAAGCAAATGAACTTAATTCTGAT
AGTCATAAAGAACTTGAGATAATCAAGAAAAAGTTAACTGATAGAGATTT
ATTGTTTATCGATATTCCTGCAGATGGAAATTGCTTGTTTAATGCAATTG
GATACCAATGCATTAGGCATAAAATTTTAGATTTTTCTACTGAATTTTCG
AAAAGTGAAGATGCTTCGTTATATTTGCGAGAATTGGTTTATAAAGAATT
AATGAAAAAACAAGAATTTTATTCTGCGTTTATTTCCGATGAAGATTCAA
GTGAATTTAGTACTTATTGTGAACAGATTCGTTCAACCAGAGCTTGGGGC
GGACAACTTGAAATAAACGCACTTTCTGAGGTTCTTGAATGTTCTATCGA
AGTTATTCAAGCATATGCACCATCTATTATTATTGGTGCTTTCAATAATA
AACCTCAACTCATTATTACATATCATAAATTTGCGTATGGTCTTGGTGAA
CATTACAATACCTGTAATTTAATTAATAATGAAAAATAACTTTCAACGTT
TCAAGTCTGTTTTGCAATAAAATGTAACTTTATGATCGCATTGGTATTTT
TTCAATTAGGGTTTGTTATTGTTATCATAAATTTGTGAAAGCTTTCAAAC
TCGTGCTAGACATAAAAGAGTCACTGTTGTTGATAGGCATCGCTTGGTGC
CGAATTACCAACCGGATGAGTTTGAAACTATCCTGGGATTATTTCTTAAC
CACAATGGCAACAGTTGTGCAATGACAACGGTAACTTGCTAGCATGAAAA
CAAGGCACCAATGTGAATGGCTTAGATATCAAATATTGTATTAGTTTAAC
ATTTCGCAATGCCGATAGCATTTCAATAGGATTTTGAAACTTTTAAAGAA
GTTCTGCTTATGCATTTGCTAAATGGTGGATAGCTTGATGTTACTGACAA
CTCGATAATTGAAATCTACATATTAACGACGATTTGGAGCTCCTTATGTG
GAGGAGCAGGTCAATGTGAGGGTTTAAAATTAAAAACAATTAAAAATCGT
TTCATATTGTCACTGCAACGATTAAATAGACAATTTGCCTTTATTTAACC
CTATAATTCCCAGAAGATGTTTACAGAAACCCAGAGGAAATTCTGCGCTA
TTAATTCGGCCTGCGTTGCGTCCTACAGTAAGAAAATCAAAAAATAATTA
TTTTTTAGTTCTTTATCCATTTACGGGCACCAAAAAATTAAGTTATTTTA
ACTGAAGAAACAAATTGGAACTGAAAGGGTTAATCATTTTGATGCATTTC
GATTAATATGAGACAAAAATTTATTTGATAGACATGTTGTATTCAGCTTG
TGTTCCGCGGAACGTTATTATTTATTTTTTTATTAATTATTATTTTTTGG
GTGCAAAAAAATGCAAAGTGCATTTTTGACTATAATCAGAGGTATATCTT
GATTGTTCTTATTATTTTGTCGAGACATTATATATAAAAAAGATGTATTC
GATGACGTTACACAAGATTATCCAATAAAATCAGGGAAAAGATTTCTTTT
TCTTACTAATTTCAGGTTTTAAAGGAACCGTTTTGGGAACATTAAGAACG
AGACAATTGTCGAGACATATTGCATTTTAAAGTTGCGCCTTTGTTTCACT
ATGAAGAATCGGGAATAATATAATCGAAAAGTTTCTTGGTTCTCCCAGGA
ATTAAGTAAAGGTAATATGTGAAAAATAATCAATAATGAATGTGTAACTT
TAACAAAAATAGAAATTAAATAAGAAATTAAATATAGAATGATAGAAAAC
ATTAATGCGAGAAGAAAATAAGCACCATTCACAAAATATCTTAAAAAATT
ACACAGTTGCAAAGTAAATAAGGCTTTAATGACAATTAATAAAACCTCAA
TAATATTAAAAACTAACCAATAATAAATGCGTGTGTCATTAACAAAATCG
ACAATAGGTAGAAGTTCCGAATAATCGTTTATTGTACTTAAATTTCATCC
TAACTGTGACCACTGCTAGTGCAGAATTTCGTTGTCCAATCCATCTGTAG
TTTTAGTCATAATTTGTACATGATCCGTTAAAATATTTTTTCTCTTTAAC
ATCTGATACTTGTGAATCTTTCTGGAATGGAATTCCTTCTTTTCATTATT
GCAATTATTTAAATATTTTTTATTTTCATGTTCAAATTTAAGGGCTGTTG
GATGCATTTTTGGTGAACTATTGAATCGGTCGCCTTTATTTCCGGGTGAA
AATGATATTGAACAATTGTGCTGCGTTTTAAGAGTTCTTGGAACTCCAAA
CGAAGTTCTCTGGCCGGAAATGGTAGATCTTCCAGATTATAATAAAATCA
GTTTTTCCGTTTGTCAACCTGTTCCATTTGAAACAGTTCTTCCAGATGCG
CCTAAAGAAGCAATCAAGTTGATAGAAGGAATTCTAGTCTATTCGTCTAA
AAAACGACTGTCAGCAACTGAAGCTCTTCTACATCCATACTTTTTTCTTC
CGCCGTTACCAGCACCTAAATCTGAATTACCTCGGCCAGAACGGAGCAAA
ATATTCAATACTCATGCTCATCAACTCTATGACACTAGTCCTAATATTCC
AATAGAGGACTCGTGTATTGATCCAATGTTTTTGGCTAATGGATCACAAT
TATCCATGTTTTATAATCACTGAGTCTGCGAAATATATCATATGCATTTT
GTATAGATGATTTCTAGTAATCAACTAACACCCAACTGCTGTTT
back to top

protein sequence of SMED30016627-orf-1

>SMED30016627-orf-1 ID=SMED30016627-orf-1|Name=SMED30016627-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=118bp
MVDLPDYNKISFSVCQPVPFETVLPDAPKEAIKLIEGILVYSSKKRLSAT
EALLHPYFFLPPLPAPKSELPRPERSKIFNTHAHQLYDTSPNIPIEDSCI
DPMFLANGSQLSMFYNH*
back to top

protein sequence of SMED30016627-orf-2

>SMED30016627-orf-2 ID=SMED30016627-orf-2|Name=SMED30016627-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=272bp
MDDLLQNHKKELKSLQIEIQKLKKSVAKGDKKRLKEVQLTISNLEKETLE
RQKKEIDDFELSNFIQEVILPETENEIKIEKPKRRKKKNNVKLYEEIIKN
HEANELNSDSHKELEIIKKKLTDRDLLFIDIPADGNCLFNAIGYQCIRHK
ILDFSTEFSKSEDASLYLRELVYKELMKKQEFYSAFISDEDSSEFSTYCE
QIRSTRAWGGQLEINALSEVLECSIEVIQAYAPSIIIGAFNNKPQLIITY
HKFAYGLGEHYNTCNLINNEK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR038765Papain-like_cys_pep_sf
IPR000719Prot_kinase_dom
IPR011009Kinase-like_dom_sf
IPR003323OTU_dom
IPR001024PLAT/LH2_dom
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0007049cell cycle
GO:0007275multicellular organism development
GO:0016310phosphorylation
GO:0051301cell division
GO:0060271cilium morphogenesis
GO:1904031positive regulation of cyclin-dependent protein kinase activity
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0005515protein binding
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0004693cyclin-dependent protein serine/threonine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
GO:0019912cyclin-dependent protein kinase activating kinase activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005929cilium
GO:0042995cell projection
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 5..47
NoneNo IPR availableCOILSCoilCoilcoord: 84..104
NoneNo IPR availableGENE3DG3DSA:3.90.70.80coord: 112..268
e-value: 4.7E-29
score: 103.2
NoneNo IPR availablePANTHERPTHR12419:SF13OTU DOMAIN-CONTAINING PROTEIN 6Acoord: 4..265
NoneNo IPR availablePANTHERPTHR12419OTU DOMAIN CONTAINING PROTEINcoord: 4..265
IPR003323OTU domainPFAMPF02338OTUcoord: 132..261
e-value: 7.6E-22
score: 78.1
IPR003323OTU domainPROSITEPS50802OTUcoord: 126..267
score: 17.47
IPR038765Papain-like cysteine peptidase superfamilySUPERFAMILYSSF54001Cysteine proteinasescoord: 107..264