RING-type domain-containing protein

Overview
NameRING-type domain-containing protein
Smed IDSMED30016599
Length (bp)1349
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RING-type domain-containing protein (SMED30016599) t-SNE clustered cells

Violin plots show distribution of expression levels for RING-type domain-containing protein (SMED30016599) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RING-type domain-containing protein (SMED30016599) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RING-type domain-containing protein (SMED30016599) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016599

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30016599SMESG000032693.1 SMESG000032694.1 dd_Smed_v4_1271_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30016599SMESG000032693.1 SMESG000032694.1 dd_Smed_v4_1271_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30016599SMESG000032693.1 SMESG000032694.1 dd_Smed_v4_1271_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: HADH (hydroxyacyl-CoA dehydrogenase [Source:HGNC Symbol;Acc:HGNC:4799])

HSP 1 Score: 63.1586 bits (152), Expect = 1.138e-10
Identity = 48/179 (26.82%), Postives = 82/179 (45.81%), Query Frame = 3
Query:  120 CAIIGCGLMGCKIAGDLALHGHRVKMYDSDIVILNSVCXXXXXXXXXXXXXXXXTQSVFSG---------SILCMSRLYECVDDADFIFECVTDDMAVKAQILADISKLATAERTIICTNTLRLDVNQLSEHLKYKERFLGIRFLYPVYFIPEVEVTLADSTSQRTLSQVRGLLEAMGK 629
              +IG GLMG  IA   A  GH V + D    IL +  ++  E+    + +    +++ +G         +I   +     V   D + E + +++ VK ++   + K A AE TI  +NT  L +  ++     ++RF G+ F  PV  +  VEV     TSQ+T   +    +A+GK
Sbjct:   30 VTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDIL-AKSKKGIEESLRKVAKKKFAENLKAGDEFVEKTLSTIATSTDAASVVHSTDLVVEAIVENLKVKNELFKRLDKFA-AEHTIFASNTSSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLVDFSKALGK 206          
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: HADH (hydroxyacyl-CoA dehydrogenase [Source:HGNC Symbol;Acc:HGNC:4799])

HSP 1 Score: 63.1586 bits (152), Expect = 2.606e-10
Identity = 48/179 (26.82%), Postives = 82/179 (45.81%), Query Frame = 3
Query:  120 CAIIGCGLMGCKIAGDLALHGHRVKMYDSDIVILNSVCXXXXXXXXXXXXXXXXTQSVFSG---------SILCMSRLYECVDDADFIFECVTDDMAVKAQILADISKLATAERTIICTNTLRLDVNQLSEHLKYKERFLGIRFLYPVYFIPEVEVTLADSTSQRTLSQVRGLLEAMGK 629
              +IG GLMG  IA   A  GH V + D    IL +  ++  E+    + +    +++ +G         +I   +     V   D + E + +++ VK ++   + K A AE TI  +NT  L +  ++     ++RF G+ F  PV  +  VEV     TSQ+T   +    +A+GK
Sbjct:   30 VTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDIL-AKSKKGIEESLRKVAKKKFAENLKAGDEFVEKTLSTIATSTDAASVVHSTDLVVEAIVENLKVKNELFKRLDKFA-AEHTIFASNTSSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLVDFSKALGK 206          
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: HADH (hydroxyacyl-CoA dehydrogenase [Source:HGNC Symbol;Acc:HGNC:4799])

HSP 1 Score: 63.1586 bits (152), Expect = 2.637e-10
Identity = 48/179 (26.82%), Postives = 82/179 (45.81%), Query Frame = 3
Query:  120 CAIIGCGLMGCKIAGDLALHGHRVKMYDSDIVILNSVCXXXXXXXXXXXXXXXXTQSVFSG---------SILCMSRLYECVDDADFIFECVTDDMAVKAQILADISKLATAERTIICTNTLRLDVNQLSEHLKYKERFLGIRFLYPVYFIPEVEVTLADSTSQRTLSQVRGLLEAMGK 629
              +IG GLMG  IA   A  GH V + D    IL +  ++  E+    + +    +++ +G         +I   +     V   D + E + +++ VK ++   + K A AE TI  +NT  L +  ++     ++RF G+ F  PV  +  VEV     TSQ+T   +    +A+GK
Sbjct:   30 VTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDIL-AKSKKGIEESLRKVAKKKFAENLKAGDEFVEKTLSTIATSTDAASVVHSTDLVVEAIVENLKVKNELFKRLDKFA-AEHTIFASNTSSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLVDFSKALGK 206          
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: HADH (hydroxyacyl-CoA dehydrogenase [Source:HGNC Symbol;Acc:HGNC:4799])

HSP 1 Score: 63.5438 bits (153), Expect = 2.757e-10
Identity = 48/177 (27.12%), Postives = 82/177 (46.33%), Query Frame = 3
Query:  126 IIGCGLMGCKIAGDLALHGHRVKMYDSDIVILNSVCXXXXXXXXXXXXXXXXTQSVFSG---------SILCMSRLYECVDDADFIFECVTDDMAVKAQILADISKLATAERTIICTNTLRLDVNQLSEHLKYKERFLGIRFLYPVYFIPEVEVTLADSTSQRTLSQVRGLLEAMGK 629
            +IG GLMG  IA   A  GH V + D    IL +  ++  E+    + +    +++ +G         +I   +     V   D + E + +++ VK ++   + K A AE TI  +NT  L +  ++     ++RF G+ F  PV  +  VEV     TSQ+T   +    +A+GK
Sbjct:   91 VIGGGLMGAGIAQVAAATGHTVVLVDQTEDIL-AKSKKGIEESLRKVAKKKFAENLKAGDEFVEKTLSTIATSTDAASVVHSTDLVVEAIVENLKVKNELFKRLDKFA-AEHTIFASNTSSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLVDFSKALGK 265          
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: HADH (hydroxyacyl-CoA dehydrogenase [Source:HGNC Symbol;Acc:HGNC:4799])

HSP 1 Score: 63.1586 bits (152), Expect = 2.996e-10
Identity = 48/179 (26.82%), Postives = 82/179 (45.81%), Query Frame = 3
Query:  120 CAIIGCGLMGCKIAGDLALHGHRVKMYDSDIVILNSVCXXXXXXXXXXXXXXXXTQSVFSG---------SILCMSRLYECVDDADFIFECVTDDMAVKAQILADISKLATAERTIICTNTLRLDVNQLSEHLKYKERFLGIRFLYPVYFIPEVEVTLADSTSQRTLSQVRGLLEAMGK 629
              +IG GLMG  IA   A  GH V + D    IL +  ++  E+    + +    +++ +G         +I   +     V   D + E + +++ VK ++   + K A AE TI  +NT  L +  ++     ++RF G+ F  PV  +  VEV     TSQ+T   +    +A+GK
Sbjct:   30 VTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDIL-AKSKKGIEESLRKVAKKKFAENLKAGDEFVEKTLSTIATSTDAASVVHSTDLVVEAIVENLKVKNELFKRLDKFA-AEHTIFASNTSSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLVDFSKALGK 206          
BLAST of RING-type domain-containing protein vs. Ensembl Celegans
Match: B0272.3 (Probable 3-hydroxyacyl-CoA dehydrogenase B0272.3 [Source:UniProtKB/Swiss-Prot;Acc:P41938])

HSP 1 Score: 63.929 bits (154), Expect = 4.531e-11
Identity = 51/179 (28.49%), Postives = 85/179 (47.49%), Query Frame = 3
Query:  120 CAIIGCGLMGCKIAGDLALHGHRVKMYDSDIVIL----NSVCXXXXXXXXXXXXXXXXTQSVFSGSIL----CMSRLYECVDDADFIFECVTDDMAVKAQILADISKLATAERTIICTNTLRLDVNQLSEHLKYKERFLGIRFLYPVYFIPEVEVTLADSTSQRTLSQVRGLLEAMGKT 632
              IIG GLMG  IA   A     V + DS+   L      +   +K   K+   +    Q+    S+L      + + + V DAD + E + +++ +K ++ A++ ++A    T+I TNT  L +  +  +LK K RF G+ F  PV  +  +EV     TS  T +Q+    + +GKT
Sbjct:   25 VTIIGAGLMGSGIAQVSANAKLNVTVVDSNQSALEKAQQGIANSLKRVAKKKHADDAAAQTALVSSVLDRIKMSTNVSDSVKDADLVIEAIVENIDIKRKLFAEV-EVAAKPTTLITTNTSSLRLADIGLNLKDKSRFGGLHFFNPVPMMKLLEVVRHTETSDATFNQLVDYGKTVGKT 202          
BLAST of RING-type domain-containing protein vs. Ensembl Celegans
Match: ech-1.2 (Enoyl-CoA Hydratase [Source:UniProtKB/TrEMBL;Acc:Q9GYT0])

HSP 1 Score: 53.5286 bits (127), Expect = 2.419e-7
Identity = 41/185 (22.16%), Postives = 83/185 (44.86%), Query Frame = 3
Query:   87 NELSIKFAMVKCAIIGCGLMGCKIAGDLALHGHRVKMYDSDIVIL----NSVCXXXXXXXXXXXXXXXXTQSVFSGSILCMSRLYECVDDADFIFECVTDDMAVKAQILADISKLATAERTIICTNTLRLDVNQLSEHLKYKERFLGIRFLYPVYFIPEVEVTLADSTSQRTLSQVRGLLEAMGK 629
            N+      + + A++G GLMG  IA      G R  + D++   +    N +   + +  K      L  + +++  +  +   Y  + +AD + E V +D+ +K +++  I  +     TII +NT  L +  ++      ++ +G+ +  PV  +  +E+   D TS+ TL+    L    GK
Sbjct:  370 NKYGKGLPVNEIAVVGAGLMGAGIANVTIDKGIRTVLLDANPAGVERGQNQIATHLNKQVKRRKINKLEKERIYNHLVPTID--YSAMKNADVVIEAVFEDLQLKHKVIKQIESV-VGPNTIIASNTSALPIKDIAAASSRPDKVIGMHYFSPVEKMQLLEIITHDGTSKETLATAAQLGLKQGK 551          
BLAST of RING-type domain-containing protein vs. Ensembl Celegans
Match: ech-1.2 (Enoyl-CoA Hydratase [Source:UniProtKB/TrEMBL;Acc:Q9GYT0])

HSP 1 Score: 53.5286 bits (127), Expect = 2.724e-7
Identity = 41/185 (22.16%), Postives = 83/185 (44.86%), Query Frame = 3
Query:   87 NELSIKFAMVKCAIIGCGLMGCKIAGDLALHGHRVKMYDSDIVIL----NSVCXXXXXXXXXXXXXXXXTQSVFSGSILCMSRLYECVDDADFIFECVTDDMAVKAQILADISKLATAERTIICTNTLRLDVNQLSEHLKYKERFLGIRFLYPVYFIPEVEVTLADSTSQRTLSQVRGLLEAMGK 629
            N+      + + A++G GLMG  IA      G R  + D++   +    N +   + +  K      L  + +++  +  +   Y  + +AD + E V +D+ +K +++  I  +     TII +NT  L +  ++      ++ +G+ +  PV  +  +E+   D TS+ TL+    L    GK
Sbjct:  370 NKYGKGLPVNEIAVVGAGLMGAGIANVTIDKGIRTVLLDANPAGVERGQNQIATHLNKQVKRRKINKLEKERIYNHLVPTID--YSAMKNADVVIEAVFEDLQLKHKVIKQIESV-VGPNTIIASNTSALPIKDIAAASSRPDKVIGMHYFSPVEKMQLLEIITHDGTSKETLATAAQLGLKQGK 551          
BLAST of RING-type domain-containing protein vs. Ensembl Celegans
Match: ech-1.2 (Enoyl-CoA Hydratase [Source:UniProtKB/TrEMBL;Acc:Q9GYT0])

HSP 1 Score: 53.1434 bits (126), Expect = 3.232e-7
Identity = 41/185 (22.16%), Postives = 83/185 (44.86%), Query Frame = 3
Query:   87 NELSIKFAMVKCAIIGCGLMGCKIAGDLALHGHRVKMYDSDIVIL----NSVCXXXXXXXXXXXXXXXXTQSVFSGSILCMSRLYECVDDADFIFECVTDDMAVKAQILADISKLATAERTIICTNTLRLDVNQLSEHLKYKERFLGIRFLYPVYFIPEVEVTLADSTSQRTLSQVRGLLEAMGK 629
            N+      + + A++G GLMG  IA      G R  + D++   +    N +   + +  K      L  + +++  +  +   Y  + +AD + E V +D+ +K +++  I  +     TII +NT  L +  ++      ++ +G+ +  PV  +  +E+   D TS+ TL+    L    GK
Sbjct:  344 NKYGKGLPVNEIAVVGAGLMGAGIANVTIDKGIRTVLLDANPAGVERGQNQIATHLNKQVKRRKINKLEKERIYNHLVPTID--YSAMKNADVVIEAVFEDLQLKHKVIKQIESV-VGPNTIIASNTSALPIKDIAAASSRPDKVIGMHYFSPVEKMQLLEIITHDGTSKETLATAAQLGLKQGK 525          
BLAST of RING-type domain-containing protein vs. Ensembl Celegans
Match: C11H1.3 (pep chromosome:WBcel235:X:14307863:14311683:-1 gene:WBGene00007529.1 transcript:C11H1.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C11H1.3)

HSP 1 Score: 52.7582 bits (125), Expect = 3.646e-7
Identity = 21/42 (50.00%), Postives = 29/42 (69.05%), Query Frame = 3
Query:  861 ECAICLDNPRDCLLEPCRHLILCQKCASMLLLRNDYCPMCRS 986
            EC ICL + RD ++ PCRHL +C  CA  L  +++ CP+CRS
Sbjct:  268 ECIICLSDIRDTVILPCRHLCVCSNCADSLRYKHNNCPICRS 309          
BLAST of RING-type domain-containing protein vs. Ensembl Fly
Match: Had2 (gene:FBgn0033949 transcript:FBtr0087499)

HSP 1 Score: 61.6178 bits (148), Expect = 3.237e-10
Identity = 52/180 (28.89%), Postives = 87/180 (48.33%), Query Frame = 3
Query:  117 KCAIIGCGLMGCKIAGDLALHGHRVKMYDSDIVILNSVCXXXXXXXXXXXXXXXXTQSVFSGSILC---------MSRLYECVDDADFIFECVTDDMAVKAQILADISKLATAERTIICTNTLRLDVNQLSEHLKYKERFLGIRFLYPVYFIPEVEVTLADSTSQRTLSQVRGLLEAMGK 629
            K  I+G GL+G   A   A  G+RV++YD    IL S      ++  + L      QS   G+I            +RL E   +A  I ECV + + +K  + + + +L   E+T++ ++T     +  SE L+ +++ L    L P YFIP VE+  A  TS   + + R L+ ++G+
Sbjct:    5 KIGIVGSGLIGRAWAMLFAAAGYRVQLYD----ILESQLATALQELDKDLHRLE-EQSALRGNIRASEQFALIGVTTRLEELTREAVHIQECVPEVLHLKKSLYSQLDEL-LEEQTVVASSTSTFMPSLYSEGLQKRQQMLVAHPLNPPYFIPLVEIVPAPWTSPSAVERTRDLMLSLGQ 178          
BLAST of RING-type domain-containing protein vs. Ensembl Fly
Match: CG9941 (gene:FBgn0030514 transcript:FBtr0073843)

HSP 1 Score: 52.373 bits (124), Expect = 7.908e-7
Identity = 21/46 (45.65%), Postives = 29/46 (63.04%), Query Frame = 3
Query:  861 ECAICLDNPRDCLLEPCRHLILCQKCASMLLLRNDYCPMCRSQIQS 998
            EC IC+   RD L+ PCRHL LC  CA  L  + + CP+CR+  ++
Sbjct:  318 ECVICMSETRDTLILPCRHLCLCNSCADSLRYQANNCPICRAPFRA 363          
BLAST of RING-type domain-containing protein vs. Ensembl Fly
Match: CG2617 (gene:FBgn0032877 transcript:FBtr0081391)

HSP 1 Score: 50.8322 bits (120), Expect = 8.118e-7
Identity = 27/79 (34.18%), Postives = 41/79 (51.90%), Query Frame = 3
Query:  789 WTSLGDARAMSNSMSALYNPPSSG--ECAICLDNPRDCLLEPCRHLILCQKCA-SMLLLRNDYCPMCRSQIQSTGGVYL 1016
            WT       + N      N  S+    C +C+   R+ ++ PCRHL LC++C+  ++LL  D CP+CR  I S   VY+
Sbjct:  196 WTHHKLQHFIHNVWYVSENAGSASPERCVVCMAQSRNVVVMPCRHLCLCKECSLQLVLLLEDRCPVCRHNITSFLSVYV 274          
BLAST of RING-type domain-containing protein vs. Ensembl Fly
Match: CG2617 (gene:FBgn0032877 transcript:FBtr0336825)

HSP 1 Score: 50.8322 bits (120), Expect = 8.118e-7
Identity = 27/79 (34.18%), Postives = 41/79 (51.90%), Query Frame = 3
Query:  789 WTSLGDARAMSNSMSALYNPPSSG--ECAICLDNPRDCLLEPCRHLILCQKCA-SMLLLRNDYCPMCRSQIQSTGGVYL 1016
            WT       + N      N  S+    C +C+   R+ ++ PCRHL LC++C+  ++LL  D CP+CR  I S   VY+
Sbjct:  196 WTHHKLQHFIHNVWYVSENAGSASPERCVVCMAQSRNVVVMPCRHLCLCKECSLQLVLLLEDRCPVCRHNITSFLSVYV 274          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: hadh (hydroxyacyl-CoA dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-040801-261])

HSP 1 Score: 59.6918 bits (143), Expect = 2.256e-9
Identity = 50/178 (28.09%), Postives = 80/178 (44.94%), Query Frame = 3
Query:  120 CAIIGCGLMGCKIAGDLALHGHRVKMYDSDIVILNSVCXXXXXXXXXXXXXXXXTQS----VFSGSIL----CMSRLYECVDDADFIFECVTDDMAVKAQILADISKLATAERTIICTNTLRLDVNQLSEHLKYKERFLGIRFLYPVYFIPEVEVTLADSTSQRTLSQVRGLLEAMGK 629
              +IG GLMG  IA   A  GH V + D+   ILN   + I+   K + K+    +      F   +L      +     V   D + E + +++ VK  +   + K+A  E TI  +NT  L +  ++      +RF G+ F  PV  +  VEV    +TSQ+T   +    +A+GK
Sbjct:   25 VTVIGGGLMGAGIAQVAASTGHSVVLVDTSADILNKSAKGIENSLKRVAKKKFAEKPEDGEAFVQKVLKNVSTSTDAASVVHGTDLVVEAIVENLKVKQDLFGALDKVA-PEHTIFASNTSSLPIADIASCTARLDRFGGLHFFNPVPMMKLVEVIKTPATSQQTFDALLEFSKALGK 201          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: ehhadh (enoyl-CoA, hydratase/3-hydroxyacyl CoA dehydrogenase [Source:NCBI gene;Acc:100000859])

HSP 1 Score: 58.5362 bits (140), Expect = 9.513e-9
Identity = 46/170 (27.06%), Postives = 84/170 (49.41%), Query Frame = 3
Query:  120 CAIIGCGLMGCKIAGDLALHGHRVKMYDSDIVILNSVCXXXXXXXXXXXXXXXXTQSVFSGSILCMSRLYECVDDADFIFECVTDDMAVKAQILADISKLATAERTIICTNTLRLDVNQLSEHLKYKERFLGIRFLYPVYFIPEVEVTLADSTSQRTLSQVRGLLEAMGK 629
             A+IG G MG  I   LA  G  V   +S+  +L +  + +    +   K   ++ S+   ++L  S   + + D D + E V +DMA+K QI  ++S++     T++C+NT  LDV+ L++     +   G+ F  P + +  +EV     +S+  ++    L + MGK
Sbjct:  298 AAVIGLGTMGRGIVVSLARVGISVIAVESEKKLLETGRQMVIGMLERDAKRRGVSASL---NLLKFSLSLQDLKDVDLVIEAVFEDMALKKQIFRELSRVCRPA-TLLCSNTSGLDVDALADVTDRPQLVAGMHFFSPAHVMKLLEVVCGPRSSKEAIATAMSLGKRMGK 463          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: mgrn1b (mahogunin, ring finger 1b [Source:ZFIN;Acc:ZDB-GENE-110401-3])

HSP 1 Score: 53.1434 bits (126), Expect = 4.201e-7
Identity = 23/47 (48.94%), Postives = 30/47 (63.83%), Query Frame = 3
Query:  843 NPPSSGECAICLDNPRDCLLEPCRHLILCQKCASMLLLRNDYCPMCR 983
            N  +S EC +CL + RD L+ PCRHL LC  CA  L  + + CP+CR
Sbjct:  269 NSDNSNECVVCLSDLRDTLILPCRHLCLCNSCADTLRYQANNCPICR 315          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: mgrn1b (mahogunin, ring finger 1b [Source:ZFIN;Acc:ZDB-GENE-110401-3])

HSP 1 Score: 53.1434 bits (126), Expect = 4.461e-7
Identity = 23/47 (48.94%), Postives = 30/47 (63.83%), Query Frame = 3
Query:  843 NPPSSGECAICLDNPRDCLLEPCRHLILCQKCASMLLLRNDYCPMCR 983
            N  +S EC +CL + RD L+ PCRHL LC  CA  L  + + CP+CR
Sbjct:  269 NSDNSNECVVCLSDLRDTLILPCRHLCLCNSCADTLRYQANNCPICR 315          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: mgrn1a (mahogunin, ring finger 1a [Source:NCBI gene;Acc:793939])

HSP 1 Score: 53.1434 bits (126), Expect = 4.853e-7
Identity = 23/47 (48.94%), Postives = 30/47 (63.83%), Query Frame = 3
Query:  843 NPPSSGECAICLDNPRDCLLEPCRHLILCQKCASMLLLRNDYCPMCR 983
            N  +S EC +CL + RD L+ PCRHL LC  CA  L  + + CP+CR
Sbjct:  269 NSDNSSECVVCLSDLRDTLILPCRHLCLCNACADTLRYQANNCPICR 315          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: vps41 (VPS41, HOPS complex subunit [Source:Xenbase;Acc:XB-GENE-999710])

HSP 1 Score: 65.0846 bits (157), Expect = 5.194e-11
Identity = 51/191 (26.70%), Postives = 79/191 (41.36%), Query Frame = 3
Query:  102 KFAMVKCAIIGCGLMGCKIAGDLALHGHRVKMYDSDIVILNSVCXXXXXXXXXXXXXXXXTQSVFSGSILCMSRLYE--------------CVDDADFIFECVTDDMAVKAQILADISKLATAERTIICTNTLRLDVNQLSEHLKYKERFLGIRFLYPVYFIPEVEVTLADSTSQRTLSQVRGLLEAMGKT 632
            K A+    +IG GLMG  IA   A  GH V + D    IL          K        +T+ +F+      S+  E               V   D + E + +++ VK ++   + K A  E TI  +NT  L +  ++     ++RF G+ F  PV  +  +EV     TSQ T   +    +A+GKT
Sbjct:   25 KLAIKHVTVIGGGLMGAGIAQVAASTGHTVVLVDQTDDILKK------SRKTIEDSLKRVTKKMFADKPEAASQFIEKILANFTTSTDPAAVVHSTDLVVEAIVENLDVKNELFKRLDKFA-PEHTIFASNTSSLPITDIANSTTRQDRFGGLHFFNPVPMMKLIEVIKTPMTSQTTFESLMDFSKALGKT 208          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: vps41 (VPS41, HOPS complex subunit [Source:Xenbase;Acc:XB-GENE-999710])

HSP 1 Score: 65.0846 bits (157), Expect = 5.306e-11
Identity = 51/191 (26.70%), Postives = 79/191 (41.36%), Query Frame = 3
Query:  102 KFAMVKCAIIGCGLMGCKIAGDLALHGHRVKMYDSDIVILNSVCXXXXXXXXXXXXXXXXTQSVFSGSILCMSRLYE--------------CVDDADFIFECVTDDMAVKAQILADISKLATAERTIICTNTLRLDVNQLSEHLKYKERFLGIRFLYPVYFIPEVEVTLADSTSQRTLSQVRGLLEAMGKT 632
            K A+    +IG GLMG  IA   A  GH V + D    IL          K        +T+ +F+      S+  E               V   D + E + +++ VK ++   + K A  E TI  +NT  L +  ++     ++RF G+ F  PV  +  +EV     TSQ T   +    +A+GKT
Sbjct:   23 KLAIKHVTVIGGGLMGAGIAQVAASTGHTVVLVDQTDDILKK------SRKTIEDSLKRVTKKMFADKPEAASQFIEKILANFTTSTDPAAVVHSTDLVVEAIVENLDVKNELFKRLDKFA-PEHTIFASNTSSLPITDIANSTTRQDRFGGLHFFNPVPMMKLIEVIKTPMTSQTTFESLMDFSKALGKT 206          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: pla2g7 (phospholipase A2 group VII [Source:Xenbase;Acc:XB-GENE-940049])

HSP 1 Score: 52.7582 bits (125), Expect = 1.053e-6
Identity = 22/44 (50.00%), Postives = 28/44 (63.64%), Query Frame = 3
Query:  852 SSGECAICLDNPRDCLLEPCRHLILCQKCASMLLLRNDYCPMCR 983
            +S EC +CL + RD L+ PCRHL LC  CA  L  +   CP+CR
Sbjct:  257 NSAECVVCLSDVRDTLILPCRHLCLCNACADTLRYQASNCPICR 300          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: pla2g7 (phospholipase A2 group VII [Source:Xenbase;Acc:XB-GENE-940049])

HSP 1 Score: 52.7582 bits (125), Expect = 1.068e-6
Identity = 22/44 (50.00%), Postives = 28/44 (63.64%), Query Frame = 3
Query:  852 SSGECAICLDNPRDCLLEPCRHLILCQKCASMLLLRNDYCPMCR 983
            +S EC +CL + RD L+ PCRHL LC  CA  L  +   CP+CR
Sbjct:  267 NSAECVVCLSDVRDTLILPCRHLCLCNACADTLRYQASNCPICR 310          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: pla2g7 (phospholipase A2 group VII [Source:Xenbase;Acc:XB-GENE-940049])

HSP 1 Score: 52.373 bits (124), Expect = 1.093e-6
Identity = 22/44 (50.00%), Postives = 28/44 (63.64%), Query Frame = 3
Query:  852 SSGECAICLDNPRDCLLEPCRHLILCQKCASMLLLRNDYCPMCR 983
            +S EC +CL + RD L+ PCRHL LC  CA  L  +   CP+CR
Sbjct:  273 NSAECVVCLSDVRDTLILPCRHLCLCNACADTLRYQASNCPICR 316          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Hadh (hydroxyacyl-Coenzyme A dehydrogenase [Source:MGI Symbol;Acc:MGI:96009])

HSP 1 Score: 61.6178 bits (148), Expect = 4.484e-10
Identity = 48/179 (26.82%), Postives = 85/179 (47.49%), Query Frame = 3
Query:  120 CAIIGCGLMGCKIAGDLALHGHRVKMYDSDIVILNSVCXXXXXXXXXXXXXXXXTQSVFSG------SILCMSRLYEC---VDDADFIFECVTDDMAVKAQILADISKLATAERTIICTNTLRLDVNQLSEHLKYKERFLGIRFLYPVYFIPEVEVTLADSTSQRTLSQVRGLLEAMGK 629
              +IG GLMG  IA   A  GH V + D    IL +  ++  E+  + + +   T++  +G      ++ C+S   +    V   D + E + +++ +K ++   + K A AE TI  +NT  L +  ++     ++RF G+ F  PV  +  VEV     TSQ+T   +    + +GK
Sbjct:   30 VTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDIL-AKSKKGIEESLKRMAKKKFTENPKAGDEFVEKTLSCLSTSTDAASVVHSTDLVVEAIVENLKLKNELFQRLDKFA-AEHTIFASNTSSLQITNIANATTRQDRFAGLHFFNPVPMMKLVEVIKTPMTSQKTFESLVDFCKTLGK 206          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Hadha (hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme A hydratase (trifunctional protein), alpha subunit [Source:MGI Symbol;Acc:MGI:2135593])

HSP 1 Score: 55.8398 bits (133), Expect = 8.723e-8
Identity = 40/144 (27.78%), Postives = 70/144 (48.61%), Query Frame = 3
Query:  117 KCAIIGCGLMGCKIAGDLALHGHRVKMYDSDIVILN----SVCXXXXXXXXXXXXXXXXTQSVFSGSILCMSRLYECVDDADFIFECVTDDMAVKAQILADISKLATAERTIICTNTLRLDVNQLSEHLKYKERFLGIRFLYPV 536
            + AI+G GLMG  IA      G +  + D+ +  L      V + + +  K+         S+FS  I  +   Y+  + AD + E V +D+ VK ++L ++  + T E  I  +NT  L +NQ++   K  E+ +G+ +  PV
Sbjct:  363 QLAILGAGLMGAGIAQVSVDKGLKTLLKDTTVTGLGRGQQQVFKGLNDKVKKKALTSFERDSIFSNLIGQLD--YKGFEKADMVIEAVFEDLGVKHKVLKEVESV-TPEHCIFASNTSALPINQIAAVSKRPEKVIGMHYFSPV 503          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Rnf26 (ring finger protein 26 [Source:MGI Symbol;Acc:MGI:2388131])

HSP 1 Score: 48.9062 bits (115), Expect = 1.842e-7
Identity = 26/56 (46.43%), Postives = 31/56 (55.36%), Query Frame = 3
Query:  858 GECAICLDNPRDCLLEPCRHLILCQKCASMLLLRNDY---CPMCRSQIQSTGGVYL 1016
             +C IC D  +  LL PCRHL LCQ C  +L+    Y   CP+CR  I  T  VYL
Sbjct:    9 KKCVICQDQSKTVLLLPCRHLCLCQACTEILMRHPVYHRNCPLCRRSILQTLNVYL 64          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Rnf26 (ring finger protein 26 [Source:MGI Symbol;Acc:MGI:2388131])

HSP 1 Score: 52.373 bits (124), Expect = 5.092e-7
Identity = 26/55 (47.27%), Postives = 31/55 (56.36%), Query Frame = 3
Query:  861 ECAICLDNPRDCLLEPCRHLILCQKCASMLLLRNDY---CPMCRSQIQSTGGVYL 1016
            +C IC D  +  LL PCRHL LCQ C  +L+    Y   CP+CR  I  T  VYL
Sbjct:  249 KCVICQDQSKTVLLLPCRHLCLCQACTEILMRHPVYHRNCPLCRRSILQTLNVYL 303          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Rnf157 (ring finger protein 157 [Source:MGI Symbol;Acc:MGI:2442484])

HSP 1 Score: 53.1434 bits (126), Expect = 5.416e-7
Identity = 22/44 (50.00%), Postives = 29/44 (65.91%), Query Frame = 3
Query:  852 SSGECAICLDNPRDCLLEPCRHLILCQKCASMLLLRNDYCPMCR 983
            +S EC +CL + RD L+ PCRHL LC  CA  L  + + CP+CR
Sbjct:  273 NSAECVVCLSDVRDTLILPCRHLCLCNTCADTLRYQANNCPICR 316          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9ZPI5|MFP2_ARATH (Peroxisomal fatty acid beta-oxidation multifunctional protein MFP2 OS=Arabidopsis thaliana OX=3702 GN=MFP2 PE=1 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 6.122e-13
Identity = 53/187 (28.34%), Postives = 99/187 (52.94%), Query Frame = 3
Query:   78 GIINELSIKFAMVKCAIIGCGLMGCKIAGDLALHGHRVKMYDSDIVILNSVCXXXXXXXXXXXXXXXXTQSVFSG--SILCMSRLYECVDDADFIFECVTDDMAVKAQILADISKLATAERTIICTNTLRLDVNQLSEHLKYKERFLGIRFLYPVYFIPEVEVTLADSTSQRTLSQVRGLLEAMGKT 632
            G+ +   +   + K AIIG GLMG  IA  L L  + V + + +   L +   R+K + +  +++G ++Q  F    S+L  S  YE   D D + E V +++++K QI AD+ K    +  I+ +NT  +D+N++ E  K ++R +G  F  P + +P +E+   + TS + +  +  + + + KT
Sbjct:  301 GVTDRGLVPRKIKKVAIIGGGLMGSGIATALILSNYPVILKEVNEKFLEAGIGRVKANLQSRVRKGSMSQEKFEKTMSLLKGSLDYESFRDVDMVIEAVIENISLKQQIFADLEKYCP-QHCILASNTSTIDLNKIGERTKSQDRIVGAHFFSPAHIMPLLEIVRTNHTSAQVIVDLLDVGKKIKKT 486          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|O49809|MFPA_BRANA (Glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a OS=Brassica napus OX=3708 PE=2 SV=2)

HSP 1 Score: 74.3294 bits (181), Expect = 7.177e-13
Identity = 57/188 (30.32%), Postives = 102/188 (54.26%), Query Frame = 3
Query:  117 KCAIIGCGLMGCKIAGDLALHGHRVKMYDSDIVILNSVCXXXXXXXXXXXXXXXXTQSVFSG--SILCMSRLYECVDDADFIFECVTDDMAVKAQILADISKLATAERTIICTNTLRLDVNQLSEHLKYKERFLGIRFLYPVYFIPEVEVTLADSTSQRTLSQVRGLLEAMGKTLFFRSRKEPLILTD 674
            K AIIG GLMG  IA  L L  + V + + +   L +   R+K + +  +K+G +++  F    S+L  S  YE   D D + E V +++++K QI AD+ K    +  I+ +NT  +D+N++ E  K ++R +G  F  P + +P +E+   + TS + +     LL+ +GK +    RK P+++ +
Sbjct:  314 KVAIIGGGLMGSGIATALILSNYSVILKEVNEKFLEAGIGRVKANLQSRVKKGKMSKEKFEKTMSLLKGSLDYESFRDVDMVIEAVIENISLKQQIFADLEKYC-PQHCILASNTSTIDLNKIGERTKSQDRIIGAHFFSPAHVMPLLEIVRTNHTSAQVIVD---LLD-VGKKI----RKTPVVVGN 492          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6LW06|FADB_PHOPR (Fatty acid oxidation complex subunit alpha OS=Photobacterium profundum (strain SS9) OX=298386 GN=fadB PE=3 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 3.233e-12
Identity = 41/128 (32.03%), Postives = 70/128 (54.69%), Query Frame = 3
Query:  291 VFSGSILCMSRLYECVDDADFIFECVTDDMAVKAQILADISKLATAERTIICTNTLRLDVNQLSEHLKYKERFLGIRFLYPVYFIPEVEVTLADSTSQRTLSQVRGLLEAMGKTLFFRSRKEPLILTD 674
            V SG  +  S  Y   +DAD + E V ++  +KA +LA++     ++ T+I +NT  + +N L++ LK  E F G+ F  PV+ +P VE+   + TS+ T+S+V      MGK+        P+++ D
Sbjct:  377 VLSG--ITPSLHYAGAEDADIVVEAVVENPKIKAAVLAEVES-NVSDTTVIASNTSTIPINLLAQSLKRPENFCGMHFFNPVHRMPLVEIIRGEHTSEETISRVVAYAAKMGKS--------PIVVND 493          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|A5F465|FADB_VIBC3 (Fatty acid oxidation complex subunit alpha OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) OX=345073 GN=fadB PE=3 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 3.298e-12
Identity = 39/116 (33.62%), Postives = 66/116 (56.90%), Query Frame = 3
Query:  327 YECVDDADFIFECVTDDMAVKAQILADISKLATAERTIICTNTLRLDVNQLSEHLKYKERFLGIRFLYPVYFIPEVEVTLADSTSQRTLSQVRGLLEAMGKTLFFRSRKEPLILTD 674
            Y  +D AD I E V ++  VKA +L+++  L  AE TI+ +NT  + +N L++ LK  + F G+ F  PV+ +P VE+   + TS+ T+++V      MGK+        P+++ D
Sbjct:  388 YAGIDQADVIVEAVVENPKVKAAVLSEVEGLVDAE-TILTSNTSTIPINLLAKSLKRPQNFCGMHFFNPVHRMPLVEIIRGEHTSEDTINRVVAYAAKMGKS--------PIVVND 494          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|A9KU91|FADB_SHEB9 (Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS195) OX=399599 GN=fadB PE=3 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 7.379e-12
Identity = 37/116 (31.90%), Postives = 63/116 (54.31%), Query Frame = 3
Query:  327 YECVDDADFIFECVTDDMAVKAQILADISKLATAERTIICTNTLRLDVNQLSEHLKYKERFLGIRFLYPVYFIPEVEVTLADSTSQRTLSQVRGLLEAMGKTLFFRSRKEPLILTD 674
            Y  +  +D + E V +   +KAQ+LA++    + E  II +NT  + +N L++ +K  ERF G+ F  PV+ +P VEV   + +S+ T++ V      MGKT        P+++ D
Sbjct:  387 YAAIKHSDVVVEAVVEHPKIKAQVLAEVEGYVS-EDAIIASNTSTISINLLAKSMKKPERFCGMHFFNPVHKMPLVEVIRGEHSSEETIASVVAYASKMGKT--------PIVVND 493          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: A0A1S3IJX5 (peroxisomal fatty acid beta-oxidation multifunctional protein AIM1 OS=Lingula unguis OX=7574 GN=LOC106165016 PE=4 SV=1)

HSP 1 Score: 266.159 bits (679), Expect = 1.239e-82
Identity = 154/304 (50.66%), Postives = 196/304 (64.47%), Query Frame = 3
Query:  111 MVKCAIIGCGLMGCKIAGDLALHGHRVKMYDSDIVILNSVCXXXXXXXXXXXXXXXXTQSVFSGSILCMSRLYECVDDADFIFECVTDDMAVKAQILADISKLATAERTIICTNTLRLDVNQLSEHLKYKERFLGIRFLYPVYFIPEVEVTLADSTSQRTLSQVRGLLEAMGKTLFFRSRKEPLILTDEQRECRRELARQEMWRSGGIATSV-CQVPELAASYSEGQWTSLGDARAMSNSMSALYNPPSSGECAICLDNPRDCLLEPCRHLILCQKCASMLLLRNDYCPMCRSQIQSTGGVYLS 1019
            MVK A++GCGLMG KIAG++A HGHRVKMYDS+I  LNSV ERI+EDK+ L +EGL++   F G +LCMS L E V+DADFIFE V DD+ VK  I   +S   T+   II +NTL LD++Q+ E   YKER LG+RFL+PVY+IPEVE+T    TS   + +VR LLE MGKTLFFRS  EPLIL++EQRE R+    Q++    G+       +P L      G +    D    S  M       +  +CAIC+D+ RDCLL PC H++ CQ CA +LL R D CP+CR +I     VY S
Sbjct:    1 MVKIAVLGCGLMGVKIAGEMAYHGHRVKMYDSNINQLNSVYERIEEDKRHLRREGLMSHRNFIGQVLCMSLLEETVNDADFIFEAVVDDLKVKQDIFERVSHCCTSN-AIIASNTLNLDMSQIVERTAYKERTLGLRFLFPVYYIPEVEITPGKHTSAEVIEKVRILLEKMGKTLFFRSGGEPLILSEEQREARKLARIQQIKNQSGLGYFFESAIPALG---HRGNFAPPQDDDTASYVMEG-----TDRDCAICMDHTRDCLLCPCHHMVTCQDCARLLLNRRDSCPICRKEITEVIKVYHS 295          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: A0A1S3ICF4 (peroxisomal fatty acid beta-oxidation multifunctional protein AIM1-like OS=Lingula unguis OX=7574 GN=LOC106163004 PE=4 SV=1)

HSP 1 Score: 263.848 bits (673), Expect = 8.560e-82
Identity = 153/304 (50.33%), Postives = 194/304 (63.82%), Query Frame = 3
Query:  111 MVKCAIIGCGLMGCKIAGDLALHGHRVKMYDSDIVILNSVCXXXXXXXXXXXXXXXXTQSVFSGSILCMSRLYECVDDADFIFECVTDDMAVKAQILADISKLATAERTIICTNTLRLDVNQLSEHLKYKERFLGIRFLYPVYFIPEVEVTLADSTSQRTLSQVRGLLEAMGKTLFFRSRKEPLILTDEQRECRRELARQEMWRSGGIATSV-CQVPELAASYSEGQWTSLGDARAMSNSMSALYNPPSSGECAICLDNPRDCLLEPCRHLILCQKCASMLLLRNDYCPMCRSQIQSTGGVYLS 1019
            MVK A++GCGLMG KIAG++A HGHRVKMYDS+   LNSV ERI+EDK+ L +EGL++   F G +LCMS L E V+DADFIFE V DD+ VK  I   +S   T+   II +NTL LD+ Q+ E   YKER LG+RFL+PVY+IPEVE+T    TS   + +VR LLE MGKTLFFRS  EPLIL++EQRE R+    Q++    G+       +P L      G +    D    S  M       +  +CAIC+D+ RDCLL PC H++ CQ CA +LL R D CP+CR +I     VY S
Sbjct:    1 MVKIAVLGCGLMGVKIAGEMAYHGHRVKMYDSNTNQLNSVYERIEEDKRHLRREGLMSHRNFIGQVLCMSLLEETVNDADFIFEAVVDDLKVKQDIFERVSHCCTSN-AIIASNTLNLDMGQIVERTAYKERTLGLRFLFPVYYIPEVEITPGKHTSAEVIEKVRILLEKMGKTLFFRSGGEPLILSEEQREARKLARIQQIKNQSGLGYFFESAIPALG---HRGNFAPPQDDDTASYVMEG-----TDRDCAICMDHTRDCLLCPCHHMVTCQDCARLLLNRRDSCPICRKEITEVIKVYHS 295          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: R7VL39 (RING-type domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_222534 PE=4 SV=1)

HSP 1 Score: 251.136 bits (640), Expect = 6.669e-77
Identity = 148/303 (48.84%), Postives = 192/303 (63.37%), Query Frame = 3
Query:  111 MVKCAIIGCGLMGCKIAGDLALHGHRVKMYDSDIVILNSVCXXXXXXXXXXXXXXXXTQSVFSGSILCMSRLYECVDDADFIFECVTDDMAVKAQILADISKLATAERTIICTNTLRLDVNQLSEHLKYKERFLGIRFLYPVYFIPEVEVTLADSTSQRTLSQVRGLLEAMGKTLFFRSRKEPLILTDEQRECRRELARQEMWRSGGIATSVCQVPELAASYSEGQWTSLGDARAMSNSMSALYNPPSSGECAICLDNPRDCLLEPCRHLILCQKCASMLLLRNDYCPMCRSQIQSTGGVYLS 1019
            MVK A+IGCGLMG KIAG++A HGHRV+++DS++  LNSV +R++EDK+ L  EGLL    F G ILC+SRL E V DADFIFE V DD+ VK  +   IS L +    I+ +N+LRLD + + +   YKER +G+RFLYPVY+IPEVE++    TS  T+  VR +LE MGKTLFFRS  EPLIL ++QRE RR    ++M  S GI   +         +S    +  G+A   S     LY+     +CAIC+D  RDCLL PC H++ C +CA  LL R D CP+CR  I     VY S
Sbjct:    1 MVKVAVIGCGLMGVKIAGEMAYHGHRVRIFDSNLNALNSVYQRLEEDKQTLRNEGLLPHKNFIGQILCLSRLEETVRDADFIFESVVDDLQVKQDLFERISHLCSPT-CIMASNSLRLDPSTIVDRAAYKERTVGLRFLYPVYYIPEVEISPNKYTSSPTIENVRTMLERMGKTLFFRSGDEPLILNEDQREARRLARIEQMRSSSGIGAYL--------EHSLPALSHKGNAPPPSED-DNLYS-DGDRDCAICMDRSRDCLLCPCHHMVTCNECAKSLLNRRDGCPICRKDITEIIRVYHS 292          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: A0A0B7APH7 (RING-type domain-containing protein OS=Arion vulgaris OX=1028688 GN=ORF131763 PE=4 SV=1)

HSP 1 Score: 247.669 bits (631), Expect = 1.898e-75
Identity = 134/302 (44.37%), Postives = 187/302 (61.92%), Query Frame = 3
Query:  111 MVKCAIIGCGLMGCKIAGDLALHGHRVKMYDSDIVILNSVCXXXXXXXXXXXXXXXXTQSVFSGSILCMSRLYECVDDADFIFECVTDDMAVKAQILADISKLATAERTIICTNTLRLDVNQLSEHLKYKERFLGIRFLYPVYFIPEVEVTLADSTSQRTLSQVRGLLEAMGKTLFFRSRKEPLILTDEQRECRRELARQEMWRSGGIATSVCQ-VPELAASYSEGQWTSLGDARAMSNSMSALYNPPSSGECAICLDNPRDCLLEPCRHLILCQKCASMLLLRNDYCPMCRSQIQSTGGVY 1013
            MV  A++G G MG KIAG+ A HGHRVK+YDS+   LN V   +++D+K L  +GLL Q  F G + CMSRL E V DADFIFE +T+++ +K  I   IS     +  +I +NTLRLD+N ++E   +K+R LG+RFL+PVY+IPE+E+  A  T    + +VR L+E MGKTLFFRS + PL+LT++QRE R+   +QE+  S  + T + + VP L  + +E   T   DA    + M          +CAIC+D  RDCL  PC H++ C +C  +L  R+D CP+CR  I     VY
Sbjct:    1 MVHIAVVGAGQMGVKIAGEFAYHGHRVKIYDSNTATLNKVHVILEDDRKSLCADGLLPQQYFLGQVFCMSRLEETVKDADFIFEVITENLEIKKDIFERISH-CCKQNAVIASNTLRLDINLINERAMHKQRTLGLRFLFPVYYIPEIEIVPATLTDSTFIEKVRKLIEGMGKTLFFRSGQHPLVLTEKQREERKAARQQEIHLSSEVGTLMQRLVPALHHTGNESVHTLQRDAAVTPSYMDR--------DCAICMDRLRDCLFTPCHHMVTCYECGEILQRRHDACPICRKDIDKAVKVY 293          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: A0A433TND5 (RING-type domain-containing protein OS=Elysia chlorotica OX=188477 GN=EGW08_009199 PE=4 SV=1)

HSP 1 Score: 242.662 bits (618), Expect = 1.333e-73
Identity = 132/304 (43.42%), Postives = 194/304 (63.82%), Query Frame = 3
Query:  111 MVKCAIIGCGLMGCKIAGDLALHGHRVKMYDSDIVILNSVCXXXXXXXXXXXXXXXXTQSVFSGSILCMSRLYECVDDADFIFECVTDDMAVKAQILADISKLATAERTIICTNTLRLDVNQLSEHLKYKERFLGIRFLYPVYFIPEVEVTLADSTSQRTLSQVRGLLEAMGKTLFFRSRKEPLILTDEQRECRRELARQEMWRSGGIATSVC-QVPELAASYSEGQWTSLGDARAMSNSMSALYNPPSS--GECAICLDNPRDCLLEPCRHLILCQKCASMLLLRNDYCPMCRSQIQSTGGVY 1013
            MV  A+IG G+MG +IAG+LA HGHRVK+YD +   LN V + +  D K+L ++GL+TQ+ F G + CMS L E V DA+FI E V +D+ +K ++  DIS+   ++  +I +NT+ LD+N ++    +KER LG+RFL+PVY++PEVE+  A  TS   + +VR +LE MGKT+FFRS  +PL+L++E RE R++  ++EM +S G+   V  ++P L   Y+        D   M    S++   PS+   ECAIC++  RDCLL+PC H++ C  C  ML  R D CP+CR  I  T  V+
Sbjct:    1 MVVVAVIGAGMMGARIAGELAYHGHRVKIYDKNPACLNKVHDILNTDTKQLREDGLITQAQFLGQVFCMSILEEVVRDAEFIVEAVVEDLEIKRELFHDISQSCKSD-ALIASNTMCLDINDINSKTSHKERTLGLRFLFPVYYVPEVEICPAKVTSSEVIERVRKMLEKMGKTMFFRSGLQPLVLSEEAREARKKARQEEMLQSCGVGAFVNRRIPSLKLEYN-------NDKEKMQKEDSSI---PSNFDHECAICMERVRDCLLQPCHHMVTCFPCGKMLQDRRDACPICRKDIDHTIRVF 293          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: hadh (hydroxyacyl-CoA dehydrogenase [Source:NCBI gene;Acc:103033308])

HSP 1 Score: 61.6178 bits (148), Expect = 3.591e-10
Identity = 52/182 (28.57%), Postives = 82/182 (45.05%), Query Frame = 3
Query:  108 AMVKCAIIGCGLMGCKIAGDLALHGHRVKMYDSDIVILNSVCXXXXXXXXXXXXXXXXTQSVFSGSIL--CMSRLYECVDDA------DFIFECVTDDMAVKAQILADISKLATAERTIICTNTLRLDVNQLSEHLKYKERFLGIRFLYPVYFIPEVEVTLADSTSQRTLSQVRGLLEAMGK 629
            A+    +IG GLMG  IA   A  GH V + D    IL    + I+   K ++K+    +       L   M  +    D A      D + E + +++ VK  + + + K+A  E TI  +NT  L +  ++      +RF G+ F  PV  +  VEV  A  TSQ+T   +    +A+GK
Sbjct:   21 AIKHITVIGGGLMGAGIAQVAATTGHSVVLVDMSEDILKKSAKSIEGSLKRVVKKKFADKPEAGEEFLQKAMKNISTSTDAAAVVQKTDLVVEAIVENLKVKQDLFSTLDKVA-PEHTIFASNTSSLPIADIASSTARLDRFGGLHFFNPVPMMKLVEVIKAPGTSQQTFDALIDFSKALGK 201          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: ehhadh (enoyl-CoA hydratase and 3-hydroxyacyl CoA dehydrogenase [Source:NCBI gene;Acc:103032907])

HSP 1 Score: 54.299 bits (129), Expect = 1.805e-7
Identity = 28/94 (29.79%), Postives = 51/94 (54.26%), Query Frame = 3
Query:  348 DFIFECVTDDMAVKAQILADISKLATAERTIICTNTLRLDVNQLSEHLKYKERFLGIRFLYPVYFIPEVEVTLADSTSQRTLSQVRGLLEAMGK 629
            D + E V +DM +K ++ AD+S++   + T++CTNT  LDV+Q++         +G+ F  P + +  +EV     +S   ++    L + MGK
Sbjct:  372 DLVIEAVFEDMELKKRVFADLSRVCN-QNTMLCTNTSGLDVDQIASVTDRPPLVVGMHFFAPAHVMKLLEVVCGPRSSAEAVATAMSLGKRMGK 464          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: mgrn1b (mahogunin, ring finger 1b [Source:ZFIN;Acc:ZDB-GENE-110401-3])

HSP 1 Score: 53.1434 bits (126), Expect = 3.822e-7
Identity = 23/47 (48.94%), Postives = 30/47 (63.83%), Query Frame = 3
Query:  843 NPPSSGECAICLDNPRDCLLEPCRHLILCQKCASMLLLRNDYCPMCR 983
            N  +S EC +CL + RD L+ PCRHL LC  CA  L  + + CP+CR
Sbjct:  265 NSDNSNECVVCLSDLRDTLILPCRHLCLCNSCADTLRYQANNCPICR 311          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: si:dkey-49c17.3 (ring finger protein 157 [Source:NCBI gene;Acc:103028420])

HSP 1 Score: 51.9878 bits (123), Expect = 9.494e-7
Identity = 22/44 (50.00%), Postives = 29/44 (65.91%), Query Frame = 3
Query:  852 SSGECAICLDNPRDCLLEPCRHLILCQKCASMLLLRNDYCPMCR 983
            +S EC +CL + RD L+ PCRHL LC  CA  L  + + CP+CR
Sbjct:  273 NSAECVVCLSDVRDTLILPCRHLCLCNACADTLRYQANCCPICR 316          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: si:dkey-49c17.3 (ring finger protein 157 [Source:NCBI gene;Acc:103028420])

HSP 1 Score: 51.9878 bits (123), Expect = 1.000e-6
Identity = 22/44 (50.00%), Postives = 29/44 (65.91%), Query Frame = 3
Query:  852 SSGECAICLDNPRDCLLEPCRHLILCQKCASMLLLRNDYCPMCR 983
            +S EC +CL + RD L+ PCRHL LC  CA  L  + + CP+CR
Sbjct:  273 NSAECVVCLSDVRDTLILPCRHLCLCNACADTLRYQANCCPICR 316          
BLAST of RING-type domain-containing protein vs. Ensembl Sea Lamprey
Match: hadh (hydroxyacyl-CoA dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-040801-261])

HSP 1 Score: 59.3066 bits (142), Expect = 4.399e-10
Identity = 47/176 (26.70%), Postives = 78/176 (44.32%), Query Frame = 3
Query:  126 IIGCGLMGCKIAGDLALHGHRVKMYDSDIVILNSVCXXXXXXXXXXXXXXXXTQSVFSGSILC--MSRLYECVDDA------DFIFECVTDDMAVKAQILADISKLATAERTIICTNTLRLDVNQLSEHLKYKERFLGIRFLYPVYFIPEVEVTLADSTSQRTLSQVRGLLEAMGK 629
            ++G G MG  IA   A  GH+V + D    IL    + I+   K ++K+     +      +   MS +    D A      D + E + +++ VK  + + + K A  E TI  +NT  L +  ++     ++RF G+ F  PV  +  VEV     TS+ T   +     A+GK
Sbjct:   34 VVGSGQMGAGIAQVAATTGHKVVIVDQTDDILQKAMKGIESSLKRVVKKTFGDNTEAGAKFMADTMSNISTSTDAAAVVHSCDLVLEAIVENLPVKQSLFSQLDKFA-PEETIFASNTSSLPITDIANSTSRQDRFGGLHFFNPVPVMKLVEVVETPMTSKATFEALTDFTIALGK 208          
BLAST of RING-type domain-containing protein vs. Ensembl Sea Lamprey
Match: si:dkey-49c17.3 (ring finger protein 157 [Source:HGNC Symbol;Acc:HGNC:29402])

HSP 1 Score: 52.373 bits (124), Expect = 1.229e-7
Identity = 22/44 (50.00%), Postives = 29/44 (65.91%), Query Frame = 3
Query:  852 SSGECAICLDNPRDCLLEPCRHLILCQKCASMLLLRNDYCPMCR 983
            +S EC +CL + RD L+ PCRHL LC  CA  L  + + CP+CR
Sbjct:  273 NSTECVVCLSDIRDTLILPCRHLCLCSACADTLRYQANNCPICR 316          
BLAST of RING-type domain-containing protein vs. Ensembl Sea Lamprey
Match: rffl (ring finger and FYVE-like domain containing E3 ubiquitin protein ligase [Source:ZFIN;Acc:ZDB-GENE-040426-2274])

HSP 1 Score: 47.7506 bits (112), Expect = 3.461e-6
Identity = 23/73 (31.51%), Postives = 33/73 (45.21%), Query Frame = 3
Query:  774 YSEGQWTSLGDARAMSNSMSALYNPPSSGECAICLDNPRDCLLEPCRHLILCQKCASMLLLRNDYCPMCRSQI 992
            Y + +     + R   N +     PP    C IC+D P DC+L  C H++ C KC      R   CP+CR  +
Sbjct:  310 YRDTRQLDKTEMRHQRNGIRLTGGPPDENTCKICMDAPIDCVLLECGHMVTCTKCGK----RMSECPICRQYV 378          
BLAST of RING-type domain-containing protein vs. Ensembl Sea Lamprey
Match: cryl1 (crystallin, lambda 1 [Source:ZFIN;Acc:ZDB-GENE-060810-7])

HSP 1 Score: 46.2098 bits (108), Expect = 7.314e-6
Identity = 49/188 (26.06%), Postives = 85/188 (45.21%), Query Frame = 3
Query:  108 AMVKCAIIGCGLMGCKIAGDLALHGHRVKMYDSDIVILNSVCXXXXXXXXXXXXXXXXTQSVFSGS----ILCMSRLYECVDDADFIFECVTDDMAVKAQILADISKLATAERTIICTNTLRLDVNQLSEHLKYKERFLGIRFLYPVYFIPEVEVTLADSTSQRTLSQVRGLLEAMGKTLFFRSRKEP 659
            A  +C +   GL+G   A   A  G  V++YDS   +     + I+E+ K L   G L  S+   S    I  ++ L E V   D++ EC+ +D+++K ++   +  L    RT++ ++T  L  + L    +Y    L    + P YF+  VE+     T    LS+   L+  +G+      R+ P
Sbjct:    4 AACRCCVSYSGLIGRSWAMLFAAAGFPVRLYDSLPGVAEKALQDIRENLKSLAASGSLRGSLPVDSQLSLIQAVADLSEAVSGVDYVQECIPEDLSMKEELYRQLDPL-LGPRTVLASSTSCLLPSALFAQRRYPANCLVCHPVNPPYFVRLVELVPHAGTGGAALSRAHRLMRRLGQAPVTLRREIP 190          
BLAST of RING-type domain-containing protein vs. Ensembl Nematostella
Match: EDO41282 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4Z9])

HSP 1 Score: 191.815 bits (486), Expect = 1.506e-57
Identity = 119/303 (39.27%), Postives = 171/303 (56.44%), Query Frame = 3
Query:  123 AIIGCGLMGCKIAGDLALHGHRVKMYDSDIVILNSVCXXXXXXXXXXXXXXXXTQSVFSGSILCMSRLYECVDDADFIFECVTDDMAVKAQILADISKLATAERTIICTNTLRLDVNQLSEHLKYKERFLGIRFLYPVYFIPEVEVTLADSTSQRTLSQVRGLLEAMGKTLFFRSRKEPLILTDEQRECRRELARQEM--WRSGGIATSVCQVPEL----AASYSEGQWTSLGDARAMSNSMSALYNPPSSGECAICLDNPRDCLLEPCRHLILCQKCASMLLLRNDYCPMCRSQIQSTGGVY 1013
            A+IG GLMG  IAG+LA HG RV +YD     +    E + + K++L +E ++  S F G++     L E V ++  IFE   +++ VK  +   IS+       +I TNTL LD + ++EH+   ER LGIRFLYPVY IPEVE+TL   TS  T+ +V+  LE   KTLFFRS K+PL+L+  Q E R++  RQ+   W   G +T    VP L    A+ +++    ++   +  S S  A        EC +C+DN RD +L PC HL +C +CA+ L L  + CP+CR  + S   VY
Sbjct:    9 AVIGAGLMGTCIAGELAYHGARVNLYDRSAQAMEKSKEMLIQQKEQLKREEVMATSDFIGTVAFCESLEEAVVNSGLIFEATIENLEVKKSVFKSISQFCRT-NAVIATNTLALDTSVVAEHVTNPERCLGIRFLYPVYSIPEVEITLGSQTSPETIQKVQQFLEGKQKTLFFRSGKKPLVLSHSQVEDRKKAQRQQTRNWIQEGRSTHDV-VPNLGHGVASRHAQASPIAMSSGKT-SQSTDAEEECSKESECVVCMDNRRDTVLCPCHHLCVCGQCAAALQLNEEPCPICRQAVASVIHVY 308          
BLAST of RING-type domain-containing protein vs. Ensembl Nematostella
Match: EDO29655 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T309])

HSP 1 Score: 60.8474 bits (146), Expect = 2.315e-10
Identity = 50/193 (25.91%), Postives = 92/193 (47.67%), Query Frame = 3
Query:  117 KCAIIGCGLMGCKIAGDLALHGHRVKMYDSDIVILNSVCXXXXXXXXXXXXXXXXTQSVFSGSILCMSRLYECVDDADF-----IFECVTDDMAVKAQILADISKLATAERTIICTNTLRLDVNQLSEHLKYKERFLGIRFLYPVYFIPEVEVTLADSTSQRTLSQVRGLLEAMGKTLFFRSRKEPLILTDEQ 680
            K  ++G G+MG  IA   A+ G  V + D  I       +   +  ++ +    ++     G    ++R+   V DADF     I E V +D  +KA + A   + A ++  +I +NT  L +  L+  ++ +++F+G+ F  PV  +P VE+   + TS  TL+  RG    M      + +K P+++ D +
Sbjct:    2 KVGVLGAGMMGAGIAYVSAVAGIEVVLKDISIEAAEKGKDYSAKLLEKKVGRSQMSADKRDG---ILARIKPTVRDADFEGCDLIIEAVFEDRDLKANVTAAAERSALSD-AVIASNTSTLPITGLATAVQRQDKFIGLHFFSPVDKMPLVEIIKGEQTSDETLA--RGFDYVM------QIKKTPIVVNDSR 182          
BLAST of RING-type domain-containing protein vs. Ensembl Nematostella
Match: EDO29372 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T3U0])

HSP 1 Score: 58.151 bits (139), Expect = 2.256e-9
Identity = 43/182 (23.63%), Postives = 84/182 (46.15%), Query Frame = 3
Query:   93 LSIKFAMVKCAIIGCGLMGCKIAGDLALHGHRVKMYDSDIVILNSVCXXXXXXXXXXXXXXXXTQSVFSGSILCMSRL--YECVDDADFIFECVTDDMAVKAQILADISKLATAERTIICTNTLRLDVNQLSEHLKYKERFLGIRFLYPVYFIPEVEVTLADSTSQRTLSQVRGLLEAMGKT 632
            +S  F + + A+IG G MG  I   LA  G +V   D++  +L+     + +     +K   ++    +  + C++ +  Y  + DAD + E V +++ +K QI   +         I+ +NT  LD++ ++   K  E+ LG+ F  P + +  +E+     T+   L     L + +GK 
Sbjct:    1 MSKAFEVQQAAVIGAGTMGRGIVMSLANAGIQVLWLDNNPQMLDQAMAVVAQTNAHNVKLERISAEQSAARLACVTPVGDYVALADADLVIEAVYENLELKQQIFRTLDA-TLKPGAILASNTSALDIDAIAAVTKRPEQVLGLHFFSPAHIMKLLEIVRGGQTAPAVLDAAVTLGQRIGKV 181          
BLAST of RING-type domain-containing protein vs. Ensembl Nematostella
Match: EDO38028 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE55])

HSP 1 Score: 52.7582 bits (125), Expect = 1.447e-7
Identity = 22/46 (47.83%), Postives = 30/46 (65.22%), Query Frame = 3
Query:  861 ECAICLDNPRDCLLEPCRHLILCQKCASMLLLRNDYCPMCRSQIQS 998
            EC IC+ + RD L+ PCRHL LC+ CA  L  ++  CP+CRS   +
Sbjct:  266 ECVICMSDFRDTLILPCRHLCLCKACADSLRYQSSTCPICRSPFHA 311          
BLAST of RING-type domain-containing protein vs. Ensembl Nematostella
Match: EDO46266 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQC1])

HSP 1 Score: 51.9878 bits (123), Expect = 2.163e-7
Identity = 49/184 (26.63%), Postives = 78/184 (42.39%), Query Frame = 3
Query:  108 AMVKCAIIGCGLMGCKIAGDLALHGHRVKMYDSD----IVILNSVCXXXXXXXXXXXXXXXXTQSVFSGSILCMSRLYECVD------DADFIFECVTDDMAVKAQILADISKLATAERTIICTNTLRLDVNQLSEHLKYKERFLGIRFLYPVYFIPEVEVTLADSTSQRTLSQVRGLLEAMGK 629
            A+    + G GLMG  IA   A   H V + D      I  L S+   ++   K+  K+ +     F      MSRL   +D      DAD + E + +++  K ++   + + A   + I  TNT  + V  +S      +RF G+ F  PV  +  VEV     TS  T + +    + +GK
Sbjct:   42 AIKNVTVFGGGLMGAGIAQVAAATDHNVTIVDQTNAILIKTLQSIERSMQRIAKKQFKDDVEAGKTFVAG--TMSRLKISLDVPGSVADADLVIEAIVENLRTKHKLFTALDE-AAPPQCIFATNTSSIPVADISSVTNRHDRFGGLHFFNPVPVMKLVEVVRTQQTSDDTFNTLLTFGKKLGK 222          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: hadh (hydroxyacyl-CoA dehydrogenase [Source:NCBI gene;Acc:101166688])

HSP 1 Score: 62.003 bits (149), Expect = 2.868e-10
Identity = 54/187 (28.88%), Postives = 83/187 (44.39%), Query Frame = 3
Query:   99 IKFAMVK-CAIIGCGLMGCKIAGDLALHGHRVKMYDSDIVILN----SVCXXXXXXXXXXXXXXXXTQSVFSGSIL----CMSRLYECVDDADFIFECVTDDMAVKAQILADISKLATAERTIICTNTLRLDVNQLSEHLKYKERFLGIRFLYPVYFIPEVEVTLADSTSQRTLSQVRGLLEAMGKT 632
            IK  ++K   IIG G MG  IA   A  GH V + D+   IL      +   +K   K+   +       F  ++L      +     V  AD + E + +++ VK  +   + KLA A  TI  +NT  L +  ++      +RF G+ F  PV  +  VEV    +TSQ T   +    +A+GKT
Sbjct:   17 IKNGVIKNVTIIGGGQMGAGIAQVAASTGHTVTLVDTSEDILKKSRKGIEGSLKRVVKKKFADKPEAGEEFIQNVLQNVSISTDAGASVQAADLLLEAIVENLKVKQDLFGHLDKLAPA-NTIFASNTSSLPITDIASSTSRLDRFGGLHFFNPVPMMKLVEVVGTSTTSQETFDSLLNFSKALGKT 202          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: ehhadh (enoyl-CoA hydratase and 3-hydroxyacyl CoA dehydrogenase [Source:NCBI gene;Acc:101170799])

HSP 1 Score: 59.6918 bits (143), Expect = 3.377e-9
Identity = 30/100 (30.00%), Postives = 53/100 (53.00%), Query Frame = 3
Query:  330 ECVDDADFIFECVTDDMAVKAQILADISKLATAERTIICTNTLRLDVNQLSEHLKYKERFLGIRFLYPVYFIPEVEVTLADSTSQRTLSQVRGLLEAMGK 629
            E   D D + E V +DMA+K ++   +S L     T +C+NT  LD++QL+   ++ E  +G+ F  P + +  +EV     +S + ++    L + MGK
Sbjct:  366 EPAADVDLVIEAVFEDMALKKKVFQQLSALCKPG-TFLCSNTSGLDIDQLASETRHPELVVGMHFFAPAHVMKLLEVVYGSRSSPQAVATAMELGKQMGK 464          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: mgrn1b (mahogunin ring finger 1 [Source:NCBI gene;Acc:101157778])

HSP 1 Score: 53.1434 bits (126), Expect = 3.721e-7
Identity = 23/47 (48.94%), Postives = 30/47 (63.83%), Query Frame = 3
Query:  843 NPPSSGECAICLDNPRDCLLEPCRHLILCQKCASMLLLRNDYCPMCR 983
            N  +S EC +CL + RD L+ PCRHL LC  CA  L  + + CP+CR
Sbjct:  269 NSDNSNECVVCLSDLRDTLILPCRHLCLCNSCADTLRYQANNCPICR 315          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: mgrn1b (mahogunin ring finger 1 [Source:NCBI gene;Acc:101157778])

HSP 1 Score: 53.1434 bits (126), Expect = 3.721e-7
Identity = 23/47 (48.94%), Postives = 30/47 (63.83%), Query Frame = 3
Query:  843 NPPSSGECAICLDNPRDCLLEPCRHLILCQKCASMLLLRNDYCPMCR 983
            N  +S EC +CL + RD L+ PCRHL LC  CA  L  + + CP+CR
Sbjct:  269 NSDNSNECVVCLSDLRDTLILPCRHLCLCNSCADTLRYQANNCPICR 315          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: mgrn1b (mahogunin ring finger 1 [Source:NCBI gene;Acc:101157778])

HSP 1 Score: 52.7582 bits (125), Expect = 4.721e-7
Identity = 23/47 (48.94%), Postives = 30/47 (63.83%), Query Frame = 3
Query:  843 NPPSSGECAICLDNPRDCLLEPCRHLILCQKCASMLLLRNDYCPMCR 983
            N  +S EC +CL + RD L+ PCRHL LC  CA  L  + + CP+CR
Sbjct:  269 NSDNSNECVVCLSDLRDTLILPCRHLCLCNSCADTLRYQANNCPICR 315          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000032694.1 (SMESG000032694.1)

HSP 1 Score: 582.793 bits (1501), Expect = 0.000e+0
Identity = 301/303 (99.34%), Postives = 301/303 (99.34%), Query Frame = 3
Query:  111 MVKCAIIGCGLMGCKIAGDLALHGHRVKMYDSDIVILNSVCXXXXXXXXXXXXXXXXTQSVFSGSILCMSRLYECVDDADFIFECVTDDMAVKAQILADISKLATAERTIICTNTLRLDVNQLSEHLKYKERFLGIRFLYPVYFIPEVEVTLADSTSQRTLSQVRGLLEAMGKTLFFRSRKEPLILTDEQRECRRELARQEMWRSGGIATSVCQVPELAASYSEGQWTSLGDARAMSNSMSALYNPPSSGECAICLDNPRDCLLEPCRHLILCQKCASMLLLRNDYCPMCRSQIQSTGGVYLS 1019
            MVKCAIIGCGLMGCKIAGDLALHGHRVKMYDSDIVILNSVCERIKEDKKELLKEGLLTQSVFSGSILCMSRL ECVDDADFIFECVTDDM VKAQILADISKLATAERTIICTNTLRLDVNQLSEHLKYKERFLGIRFLYPVYFIPEVEVTLADSTSQRTLSQVRGLLEAMGKTLFFRSRKEPLILTDEQRECRRELARQEMWRSGGIATSVCQVPELAASYSEGQWTSLGDARAMSNSMSALYNPPSSGECAICLDNPRDCLLEPCRHLILCQKCASMLLLRNDYCPMCRSQIQSTGGVYLS
Sbjct:    1 MVKCAIIGCGLMGCKIAGDLALHGHRVKMYDSDIVILNSVCERIKEDKKELLKEGLLTQSVFSGSILCMSRLDECVDDADFIFECVTDDMVVKAQILADISKLATAERTIICTNTLRLDVNQLSEHLKYKERFLGIRFLYPVYFIPEVEVTLADSTSQRTLSQVRGLLEAMGKTLFFRSRKEPLILTDEQRECRRELARQEMWRSGGIATSVCQVPELAASYSEGQWTSLGDARAMSNSMSALYNPPSSGECAICLDNPRDCLLEPCRHLILCQKCASMLLLRNDYCPMCRSQIQSTGGVYLS 303          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000002432.1 (SMESG000002432.1)

HSP 1 Score: 50.0618 bits (118), Expect = 1.724e-6
Identity = 21/46 (45.65%), Postives = 30/46 (65.22%), Query Frame = 3
Query:  861 ECAICLDNPRDCLLEPCRHLILCQKCASMLLLRNDYCPMCRSQIQS 998
            +C IC+ + RD L+ PCRHL LC  C   LL ++  CP+CRS  ++
Sbjct:  291 DCVICMASVRDTLVLPCRHLCLCSSCGEKLLHQSPSCPICRSTFRA 336          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000002432.1 (SMESG000002432.1)

HSP 1 Score: 50.0618 bits (118), Expect = 1.839e-6
Identity = 21/46 (45.65%), Postives = 30/46 (65.22%), Query Frame = 3
Query:  861 ECAICLDNPRDCLLEPCRHLILCQKCASMLLLRNDYCPMCRSQIQS 998
            +C IC+ + RD L+ PCRHL LC  C   LL ++  CP+CRS  ++
Sbjct:  295 DCVICMASVRDTLVLPCRHLCLCSSCGEKLLHQSPSCPICRSTFRA 340          
The following BLAST results are available for this feature:
BLAST of RING-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HADH1.138e-1026.82hydroxyacyl-CoA dehydrogenase [Source:HGNC Symbol;... [more]
HADH2.606e-1026.82hydroxyacyl-CoA dehydrogenase [Source:HGNC Symbol;... [more]
HADH2.637e-1026.82hydroxyacyl-CoA dehydrogenase [Source:HGNC Symbol;... [more]
HADH2.757e-1027.12hydroxyacyl-CoA dehydrogenase [Source:HGNC Symbol;... [more]
HADH2.996e-1026.82hydroxyacyl-CoA dehydrogenase [Source:HGNC Symbol;... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
B0272.34.531e-1128.49Probable 3-hydroxyacyl-CoA dehydrogenase B0272.3 ... [more]
ech-1.22.419e-722.16Enoyl-CoA Hydratase [Source:UniProtKB/TrEMBL;Acc:... [more]
ech-1.22.724e-722.16Enoyl-CoA Hydratase [Source:UniProtKB/TrEMBL;Acc:... [more]
ech-1.23.232e-722.16Enoyl-CoA Hydratase [Source:UniProtKB/TrEMBL;Acc:... [more]
C11H1.33.646e-750.00pep chromosome:WBcel235:X:14307863:14311683:-1 gen... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Had23.237e-1028.89gene:FBgn0033949 transcript:FBtr0087499[more]
CG99417.908e-745.65gene:FBgn0030514 transcript:FBtr0073843[more]
CG26178.118e-734.18gene:FBgn0032877 transcript:FBtr0081391[more]
CG26178.118e-734.18gene:FBgn0032877 transcript:FBtr0336825[more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hadh2.256e-928.09hydroxyacyl-CoA dehydrogenase [Source:ZFIN;Acc:ZDB... [more]
ehhadh9.513e-927.06enoyl-CoA, hydratase/3-hydroxyacyl CoA dehydrogena... [more]
mgrn1b4.201e-748.94mahogunin, ring finger 1b [Source:ZFIN;Acc:ZDB-GEN... [more]
mgrn1b4.461e-748.94mahogunin, ring finger 1b [Source:ZFIN;Acc:ZDB-GEN... [more]
mgrn1a4.853e-748.94mahogunin, ring finger 1a [Source:NCBI gene;Acc:79... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vps415.194e-1126.70VPS41, HOPS complex subunit [Source:Xenbase;Acc:XB... [more]
vps415.306e-1126.70VPS41, HOPS complex subunit [Source:Xenbase;Acc:XB... [more]
pla2g71.053e-650.00phospholipase A2 group VII [Source:Xenbase;Acc:XB-... [more]
pla2g71.068e-650.00phospholipase A2 group VII [Source:Xenbase;Acc:XB-... [more]
pla2g71.093e-650.00phospholipase A2 group VII [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hadh4.484e-1026.82hydroxyacyl-Coenzyme A dehydrogenase [Source:MGI S... [more]
Hadha8.723e-827.78hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Co... [more]
Rnf261.842e-746.43ring finger protein 26 [Source:MGI Symbol;Acc:MGI:... [more]
Rnf265.092e-747.27ring finger protein 26 [Source:MGI Symbol;Acc:MGI:... [more]
Rnf1575.416e-750.00ring finger protein 157 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9ZPI5|MFP2_ARATH6.122e-1328.34Peroxisomal fatty acid beta-oxidation multifunctio... [more]
sp|O49809|MFPA_BRANA7.177e-1330.32Glyoxysomal fatty acid beta-oxidation multifunctio... [more]
sp|Q6LW06|FADB_PHOPR3.233e-1232.03Fatty acid oxidation complex subunit alpha OS=Phot... [more]
sp|A5F465|FADB_VIBC33.298e-1233.62Fatty acid oxidation complex subunit alpha OS=Vibr... [more]
sp|A9KU91|FADB_SHEB97.379e-1231.90Fatty acid oxidation complex subunit alpha OS=Shew... [more]
back to top
BLAST of RING-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3IJX51.239e-8250.66peroxisomal fatty acid beta-oxidation multifunctio... [more]
A0A1S3ICF48.560e-8250.33peroxisomal fatty acid beta-oxidation multifunctio... [more]
R7VL396.669e-7748.84RING-type domain-containing protein OS=Capitella t... [more]
A0A0B7APH71.898e-7544.37RING-type domain-containing protein OS=Arion vulga... [more]
A0A433TND51.333e-7343.42RING-type domain-containing protein OS=Elysia chlo... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hadh3.591e-1028.57hydroxyacyl-CoA dehydrogenase [Source:NCBI gene;Ac... [more]
ehhadh1.805e-729.79enoyl-CoA hydratase and 3-hydroxyacyl CoA dehydrog... [more]
mgrn1b3.822e-748.94mahogunin, ring finger 1b [Source:ZFIN;Acc:ZDB-GEN... [more]
si:dkey-49c17.39.494e-750.00ring finger protein 157 [Source:NCBI gene;Acc:1030... [more]
si:dkey-49c17.31.000e-650.00ring finger protein 157 [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
hadh4.399e-1026.70hydroxyacyl-CoA dehydrogenase [Source:ZFIN;Acc:ZDB... [more]
si:dkey-49c17.31.229e-750.00ring finger protein 157 [Source:HGNC Symbol;Acc:HG... [more]
rffl3.461e-631.51ring finger and FYVE-like domain containing E3 ubi... [more]
cryl17.314e-626.06crystallin, lambda 1 [Source:ZFIN;Acc:ZDB-GENE-060... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO412821.506e-5739.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO296552.315e-1025.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO293722.256e-923.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380281.447e-747.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO462662.163e-726.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hadh2.868e-1028.88hydroxyacyl-CoA dehydrogenase [Source:NCBI gene;Ac... [more]
ehhadh3.377e-930.00enoyl-CoA hydratase and 3-hydroxyacyl CoA dehydrog... [more]
mgrn1b3.721e-748.94mahogunin ring finger 1 [Source:NCBI gene;Acc:1011... [more]
mgrn1b3.721e-748.94mahogunin ring finger 1 [Source:NCBI gene;Acc:1011... [more]
mgrn1b4.721e-748.94mahogunin ring finger 1 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000032694.10.000e+099.34SMESG000032694.1[more]
SMESG000002432.11.724e-645.65SMESG000002432.1[more]
SMESG000002432.11.839e-645.65SMESG000002432.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016599 ID=SMED30016599|Name=RING-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1349bp
ATATTATTCAAATGTTTATTTTTAATTTTTTATTTAAATTGTGATATTTA
GCTAAATTTTAACTTAAACATTTGATTGGAATAATAAATGAATTATCAAT
AAAATTTGCAATGGTGAAATGCGCAATCATTGGCTGTGGACTGATGGGCT
GTAAGATTGCAGGAGATTTAGCTTTGCATGGCCATCGCGTGAAAATGTAT
GATTCGGATATTGTTATTTTGAATAGTGTTTGTGAACGAATTAAGGAAGA
TAAAAAAGAATTATTGAAGGAAGGCCTTCTAACACAGAGTGTTTTTTCTG
GCTCCATTCTTTGCATGAGCCGGCTGTACGAGTGCGTTGACGACGCCGAT
TTCATATTCGAGTGTGTCACGGATGACATGGCGGTAAAGGCGCAAATCCT
TGCAGACATCAGCAAGCTGGCCACCGCTGAGCGGACAATTATCTGCACCA
ATACGCTCAGGCTCGATGTCAACCAGCTCAGTGAGCATCTCAAATATAAA
GAGCGGTTCCTGGGAATCAGGTTTCTCTACCCGGTCTATTTTATTCCCGA
GGTTGAGGTGACTCTGGCCGACAGCACTTCGCAACGGACACTCAGTCAAG
TCAGGGGCCTCCTGGAAGCCATGGGGAAAACTTTATTCTTCAGGAGCAGG
AAGGAGCCATTGATTCTCACGGATGAGCAACGGGAGTGCCGGAGGGAATT
GGCCCGCCAGGAGATGTGGAGATCAGGCGGGATCGCGACGAGTGTGTGCC
AAGTGCCGGAATTGGCTGCATCGTATTCAGAAGGCCAATGGACATCACTG
GGAGATGCAAGGGCAATGAGCAACTCTATGTCTGCTCTCTACAACCCTCC
CAGCAGCGGTGAATGCGCCATTTGCCTCGACAATCCTCGAGATTGCTTAT
TGGAGCCTTGCAGACACTTGATTCTGTGCCAGAAATGTGCCTCCATGCTT
TTATTGCGGAATGATTACTGTCCAATGTGCCGCTCTCAAATCCAGAGCAC
TGGAGGCGTCTATTTGTCCTAGACTTGTTGCTCTGTGTGTGTCTATATGG
ATTGGGGGAATTGTCGGCGTGATTATATCATCCCTCCTCCTCCCAACTGA
ATGAGGTCATATCATGTCATTGATTTTTACAGATTGCATTTGATTGGTGG
CCTGCCGGAATCCACGGCAACGCAGATTGGATAACAGATTAATCACTTCA
TAACTATTCCAGACTGAAGAAAATTTATTTATCGTAGTTTTGCACGTTCC
CATAGTTCTTATTCCTTTTATTTCTATTGTGAATGTGATCAATATCTATT
TCAATTGTCAGTTATTTGTACAATATTTATTAATAAATATGGTTGTTCA
back to top

protein sequence of SMED30016599-orf-1

>SMED30016599-orf-1 ID=SMED30016599-orf-1|Name=SMED30016599-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=304bp
MVKCAIIGCGLMGCKIAGDLALHGHRVKMYDSDIVILNSVCERIKEDKKE
LLKEGLLTQSVFSGSILCMSRLYECVDDADFIFECVTDDMAVKAQILADI
SKLATAERTIICTNTLRLDVNQLSEHLKYKERFLGIRFLYPVYFIPEVEV
TLADSTSQRTLSQVRGLLEAMGKTLFFRSRKEPLILTDEQRECRRELARQ
EMWRSGGIATSVCQVPELAASYSEGQWTSLGDARAMSNSMSALYNPPSSG
ECAICLDNPRDCLLEPCRHLILCQKCASMLLLRNDYCPMCRSQIQSTGGV
YLS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036291NAD(P)-bd_dom_sf
IPR001841Znf_RING
IPR0061763-OHacyl-CoA_DH_NAD-bd
IPR013083Znf_RING/FYVE/PHD
IPR016040NAD(P)-bd_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008270zinc ion binding
GO:00038573-hydroxyacyl-CoA dehydrogenase activity
GO:0016491oxidoreductase activity
GO:0003824catalytic activity
GO:0004165dodecenoyl-CoA delta-isomerase activity
GO:0004300enoyl-CoA hydratase activity
GO:00086923-hydroxybutyryl-CoA epimerase activity
GO:0016829lyase activity
GO:0016853isomerase activity
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0006631fatty acid metabolic process
GO:0006629lipid metabolic process
GO:0006635fatty acid beta-oxidation
GO:0008152metabolic process
GO:0009062fatty acid catabolic process
GO:0016042lipid catabolic process
Vocabulary: cellular component
TermDefinition
GO:0036125fatty acid beta-oxidation multienzyme complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 34..54
NoneNo IPR availablePFAMPF13920zf-C3HC4_3coord: 250..296
e-value: 3.8E-14
score: 52.3
NoneNo IPR availableGENE3DG3DSA:3.40.50.720coord: 2..183
e-value: 4.8E-39
score: 135.9
NoneNo IPR availablePANTHERPTHR23309:SF27coord: 248..296
coord: 2..187
NoneNo IPR availablePANTHERPTHR233093-HYDROXYACYL-COA DEHYROGENASEcoord: 248..296
coord: 2..187
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 251..296
IPR001841Zinc finger, RING-typeSMARTSM00184ring_2coord: 252..290
e-value: 8.0E-4
score: 28.7
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 252..291
score: 10.911
IPR0061763-hydroxyacyl-CoA dehydrogenase, NAD bindingPFAMPF027373HCDH_Ncoord: 4..174
e-value: 7.7E-34
score: 117.1
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 232..303
e-value: 1.0E-15
score: 59.0
IPR036291NAD(P)-binding domain superfamilySUPERFAMILYSSF51735NAD(P)-binding Rossmann-fold domainscoord: 3..176