Protein big brother

Overview
NameProtein big brother
Smed IDSMED30016591
Length (bp)870
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein big brother (SMED30016591) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein big brother (SMED30016591) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein big brother (SMED30016591) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein big brother (SMED30016591) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016591

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30016591SMESG000068819.1 SmedASXL_018544SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
X1 cellSMED30016591SMESG000068819.1 SmedASXL_018544SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30016591SMESG000068819.1 SmedASXL_018544SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30016591SMESG000068819.1 dd_Smed_v4_2875_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30016591SMESG000068819.1 dd_Smed_v4_2875_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30016591SMESG000068819.1 dd_Smed_v4_2875_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30016591SMESG000068819.1 dd_Smed_v4_2875_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30016591SMESG000068819.1 dd_Smed_v4_2875_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30016591SMESG000068819.1 dd_Smed_v4_2875_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30016591SMESG000068819.1 SMED_19615_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30016591SMESG000068819.1 SMED_19615_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein big brother vs. Ensembl Human
Match: CBFB (core-binding factor subunit beta [Source:HGNC Symbol;Acc:HGNC:1539])

HSP 1 Score: 87.0409 bits (214), Expect = 8.159e-20
Identity = 51/135 (37.78%), Postives = 75/135 (55.56%), Query Frame = 1
Query:  217 MPKTVLDQEGKFKQDEIFKRLSEDNRIRYTGCK--SGENAKNNFMQDLQSGKLNIAFVDSGINLRLDITGLS------DNENIRFDDEER----VFLQSHLILNGVCVKWLGHINLKDLEGSARIEFDRKMAQEE 585
            MP+ V DQ  KF+ +E F++LS +  I+YTG +    E  +  F    + G+  IAFV +G NL L     S         +  + D ER    V+L++ +ILNGVCV W G I+L+ L+G   +EFD + AQ+E
Sbjct:    1 MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLDGMGCLEFDEERAQQE 135          
BLAST of Protein big brother vs. Ensembl Human
Match: CBFB (core-binding factor subunit beta [Source:HGNC Symbol;Acc:HGNC:1539])

HSP 1 Score: 85.8853 bits (211), Expect = 1.002e-19
Identity = 51/135 (37.78%), Postives = 75/135 (55.56%), Query Frame = 1
Query:  217 MPKTVLDQEGKFKQDEIFKRLSEDNRIRYTGCK--SGENAKNNFMQDLQSGKLNIAFVDSGINLRLDITGLS------DNENIRFDDEER----VFLQSHLILNGVCVKWLGHINLKDLEGSARIEFDRKMAQEE 585
            MP+ V DQ  KF+ +E F++LS +  I+YTG +    E  +  F    + G+  IAFV +G NL L     S         +  + D ER    V+L++ +ILNGVCV W G I+L+ L+G   +EFD + AQ+E
Sbjct:    1 MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLDGMGCLEFDEERAQQE 135          
BLAST of Protein big brother vs. Ensembl Human
Match: CBFB (core-binding factor subunit beta [Source:HGNC Symbol;Acc:HGNC:1539])

HSP 1 Score: 84.7297 bits (208), Expect = 2.607e-19
Identity = 51/137 (37.23%), Postives = 75/137 (54.74%), Query Frame = 1
Query:  217 MPKTVLDQEGKFKQDEIFKRLSEDNRIRYTGCK--SGENAKNNFMQDLQSGKLNIAFVDSGINLRLDITGLS------DNENIRFDDEER----VFLQSHLILNGVCVKWLGHINLKDLEGSARIEFDRKMAQEESV 591
            MP+ V DQ  KF+ +E F++LS +  I+YTG +    E  +  F    + G+  IAFV +G NL L     S         +  + D ER    V+L++ +ILNGVCV W G I+L+ L+G   +EFD + AQ+E  
Sbjct:    1 MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLDGMGCLEFDEERAQQEDA 137          
BLAST of Protein big brother vs. Ensembl Human
Match: CBFB (core-binding factor subunit beta [Source:HGNC Symbol;Acc:HGNC:1539])

HSP 1 Score: 65.4698 bits (158), Expect = 4.194e-13
Identity = 40/125 (32.00%), Postives = 61/125 (48.80%), Query Frame = 1
Query:  217 MPKTVLDQEGKFKQDEIFKRLSEDNRIRYTGCK--SGENAKNNFMQDLQSGKLNIAFVDSGINLRLDITGLSDNENIRFDDEERVFLQSHLILNGVCVKWLGHINLKDLEGSARIEFDRKMAQEE 585
            MP+ V DQ  KF+ +E F++LS +  I+YTG +    E  +  F    + G+  I                             V+L++ +ILNGVCV W G I+L+ L+G   +EFD + AQ+E
Sbjct:    1 MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEI-----------------------------VYLKAPMILNGVCVIWKGWIDLQRLDGMGCLEFDEERAQQE 96          
BLAST of Protein big brother vs. Ensembl Celegans
Match: bro-1 (BROther (Drosophila tx factor partner) homolog [Source:UniProtKB/TrEMBL;Acc:Q95ZL9])

HSP 1 Score: 45.0542 bits (105), Expect = 8.706e-6
Identity = 29/116 (25.00%), Postives = 52/116 (44.83%), Query Frame = 1
Query:  217 MPKTVLDQEGKFKQDEIFKRLSEDNRIRYTGCKSGE--NAKNNFMQDLQSGKLNIAFVDSGINLRLDITGLSDNENIRFDDEERVFLQSHLILNGVCVKWLGHINLKDLEGSARIE 558
            M +T  DQ+  F+ D    +LS     +++  +       +  F   ++  ++ + F  +GIN+ + +     N N      E  F    L+ NG+ VK +G +N + LEG  R E
Sbjct:    1 MKRTTTDQQSSFQTDYFLTQLSHFTEAKFSLFEHAPLSERRERFRVHVERDEMPLTFCKTGINIPVKLEWSQTNGN------EISFRSRPLVFNGIWVKVIGAMNSESLEGRVRFE 110          
BLAST of Protein big brother vs. Ensembl Fly
Match: Bro (gene:FBgn0013755 transcript:FBtr0072760)

HSP 1 Score: 101.679 bits (252), Expect = 1.137e-25
Identity = 56/148 (37.84%), Postives = 86/148 (58.11%), Query Frame = 1
Query:  199 PDFHLKMPKTVLDQEGKFKQDEIFKRLSEDNRIRYTGCK--SGENAKNNFMQDLQSGKLNIAFVDSGINLRLDITG----LSDNENIRFDDEE-RVFLQSHLILNGVCVKWLGHINLKDLEGSARIEFDRKMAQEESVSCWNQLYDYN 621
            P F  KMP+ V DQ  KF  DE+F+RLS ++ +RYTG +  + E  +  F+ D + G   I+ V SG NL+L         +  ++  F+ E  +V L+S  I+NGVCV++ G ++L  L+G+A +EFD + AQ+E      Q+  YN
Sbjct:   31 PRFIFKMPRVVPDQRSKFDSDELFRRLSRESEVRYTGYRERAMEERRMRFVNDCRKGYAEISMVASGTNLQLYFNANHNPYAQEQDCDFERERGKVHLRSSFIMNGVCVRFRGWVDLDRLDGAACLEFDEQRAQQEDAQLQEQIQSYN 178          
BLAST of Protein big brother vs. Ensembl Fly
Match: Bgb (gene:FBgn0013753 transcript:FBtr0072758)

HSP 1 Score: 97.0561 bits (240), Expect = 6.139e-24
Identity = 58/162 (35.80%), Postives = 89/162 (54.94%), Query Frame = 1
Query:  199 PDFHLKMPKTVLDQEGKFKQDEIFKRLSEDNRIRYTGC--KSGENAKNNFMQDLQSGKLNIAFVDSGINLRLDITGLSDNENIRFDDEE--------RVFLQSHLILNGVCVKWLGHINLKDLEGSARIEFDRKMAQEESVSCWNQLYDYNFHFGFTEDNNK 654
            P F  KMP+ V DQ+ KF+ DE+F+RLS ++ +RYTG   +S E  +  FM   + G    +FV SG NL+L       N+N    D+E        +V ++S+ I+NGVCV++ G I+L+ L+G   +E+D + A  E     +Q+  YN      ED  +
Sbjct:   24 PRFIFKMPRVVPDQKSKFESDELFRRLSRESEVRYTGYRERSIEERQVRFMNGCREGHTEASFVASGTNLQLVFNA---NQNPYLHDKECDFDKEHGKVHIKSYFIMNGVCVRFRGWIDLERLDGVGCLEYDERRAMHEDAILRDQIDRYNQRLREFEDTKR 182          
BLAST of Protein big brother vs. Ensembl Fly
Match: Bgb (gene:FBgn0013753 transcript:FBtr0330180)

HSP 1 Score: 97.0561 bits (240), Expect = 1.663e-23
Identity = 58/162 (35.80%), Postives = 89/162 (54.94%), Query Frame = 1
Query:  199 PDFHLKMPKTVLDQEGKFKQDEIFKRLSEDNRIRYTGC--KSGENAKNNFMQDLQSGKLNIAFVDSGINLRLDITGLSDNENIRFDDEE--------RVFLQSHLILNGVCVKWLGHINLKDLEGSARIEFDRKMAQEESVSCWNQLYDYNFHFGFTEDNNK 654
            P F  KMP+ V DQ+ KF+ DE+F+RLS ++ +RYTG   +S E  +  FM   + G    +FV SG NL+L       N+N    D+E        +V ++S+ I+NGVCV++ G I+L+ L+G   +E+D + A  E     +Q+  YN      ED  +
Sbjct:   24 PRFIFKMPRVVPDQKSKFESDELFRRLSRESEVRYTGYRERSIEERQVRFMNGCREGHTEASFVASGTNLQLVFNA---NQNPYLHDKECDFDKEHGKVHIKSYFIMNGVCVRFRGWIDLERLDGVGCLEYDERRAMHEDAILRDQIDRYNQRLREFEDTKR 182          
BLAST of Protein big brother vs. Ensembl Zebrafish
Match: cbfb (core-binding factor subunit beta [Source:ZFIN;Acc:ZDB-GENE-980526-440])

HSP 1 Score: 83.1889 bits (204), Expect = 5.965e-19
Identity = 49/137 (35.77%), Postives = 74/137 (54.01%), Query Frame = 1
Query:  217 MPKTVLDQEGKFKQDEIFKRLSEDNRIRYTGCK--SGENAKNNFMQDLQSGKLNIAFVDSGINLRL---------DITGLSDNENIRFDDEE-RVFLQSHLILNGVCVKWLGHINLKDLEGSARIEFDRKMAQEESV 591
            MP+ V DQ  KF+ +E F++LS +  I+YTG +    E  +  F    + G+  IAFV +G NL L         D       E + F+ E  +V+L++ +ILNGVCV W G ++L  L+G   +E+D + AQ E  
Sbjct:    1 MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFPANLHGDQRQAPTREYVDFERETGKVYLKAPMILNGVCVIWRGWLDLHRLDGMGCLEYDDERAQHEDA 137          
BLAST of Protein big brother vs. Ensembl Zebrafish
Match: cbfb (core-binding factor subunit beta [Source:ZFIN;Acc:ZDB-GENE-980526-440])

HSP 1 Score: 83.1889 bits (204), Expect = 7.736e-19
Identity = 49/137 (35.77%), Postives = 74/137 (54.01%), Query Frame = 1
Query:  217 MPKTVLDQEGKFKQDEIFKRLSEDNRIRYTGCK--SGENAKNNFMQDLQSGKLNIAFVDSGINLRL---------DITGLSDNENIRFDDEE-RVFLQSHLILNGVCVKWLGHINLKDLEGSARIEFDRKMAQEESV 591
            MP+ V DQ  KF+ +E F++LS +  I+YTG +    E  +  F    + G+  IAFV +G NL L         D       E + F+ E  +V+L++ +ILNGVCV W G ++L  L+G   +E+D + AQ E  
Sbjct:    1 MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFPANLHGDQRQAPTREYVDFERETGKVYLKAPMILNGVCVIWRGWLDLHRLDGMGCLEYDDERAQHEDA 137          
BLAST of Protein big brother vs. Ensembl Zebrafish
Match: cbfb (core-binding factor subunit beta [Source:ZFIN;Acc:ZDB-GENE-980526-440])

HSP 1 Score: 83.1889 bits (204), Expect = 8.071e-19
Identity = 49/137 (35.77%), Postives = 74/137 (54.01%), Query Frame = 1
Query:  217 MPKTVLDQEGKFKQDEIFKRLSEDNRIRYTGCK--SGENAKNNFMQDLQSGKLNIAFVDSGINLRL---------DITGLSDNENIRFDDEE-RVFLQSHLILNGVCVKWLGHINLKDLEGSARIEFDRKMAQEESV 591
            MP+ V DQ  KF+ +E F++LS +  I+YTG +    E  +  F    + G+  IAFV +G NL L         D       E + F+ E  +V+L++ +ILNGVCV W G ++L  L+G   +E+D + AQ E  
Sbjct:    1 MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFPANLHGDQRQAPTREYVDFERETGKVYLKAPMILNGVCVIWRGWLDLHRLDGMGCLEYDDERAQHEDA 137          
BLAST of Protein big brother vs. Ensembl Zebrafish
Match: cbfb (core-binding factor subunit beta [Source:ZFIN;Acc:ZDB-GENE-980526-440])

HSP 1 Score: 83.1889 bits (204), Expect = 8.071e-19
Identity = 49/137 (35.77%), Postives = 74/137 (54.01%), Query Frame = 1
Query:  217 MPKTVLDQEGKFKQDEIFKRLSEDNRIRYTGCK--SGENAKNNFMQDLQSGKLNIAFVDSGINLRL---------DITGLSDNENIRFDDEE-RVFLQSHLILNGVCVKWLGHINLKDLEGSARIEFDRKMAQEESV 591
            MP+ V DQ  KF+ +E F++LS +  I+YTG +    E  +  F    + G+  IAFV +G NL L         D       E + F+ E  +V+L++ +ILNGVCV W G ++L  L+G   +E+D + AQ E  
Sbjct:    1 MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFPANLHGDQRQAPTREYVDFERETGKVYLKAPMILNGVCVIWRGWLDLHRLDGMGCLEYDDERAQHEDA 137          
BLAST of Protein big brother vs. Ensembl Zebrafish
Match: cbfb (core-binding factor subunit beta [Source:ZFIN;Acc:ZDB-GENE-980526-440])

HSP 1 Score: 82.4185 bits (202), Expect = 1.214e-18
Identity = 49/137 (35.77%), Postives = 74/137 (54.01%), Query Frame = 1
Query:  217 MPKTVLDQEGKFKQDEIFKRLSEDNRIRYTGCK--SGENAKNNFMQDLQSGKLNIAFVDSGINLRL---------DITGLSDNENIRFDDEE-RVFLQSHLILNGVCVKWLGHINLKDLEGSARIEFDRKMAQEESV 591
            MP+ V DQ  KF+ +E F++LS +  I+YTG +    E  +  F    + G+  IAFV +G NL L         D       E + F+ E  +V+L++ +ILNGVCV W G ++L  L+G   +E+D + AQ E  
Sbjct:    1 MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFPANLHGDQRQAPTREYVDFERETGKVYLKAPMILNGVCVIWRGWLDLHRLDGMGCLEYDDERAQHEDA 137          
BLAST of Protein big brother vs. Ensembl Xenopus
Match: or1s1 (olfactory receptor family 1 subfamily S member 1 (gene/pseudogene) [Source:Xenbase;Acc:XB-GENE-5904137])

HSP 1 Score: 82.8037 bits (203), Expect = 1.231e-18
Identity = 49/137 (35.77%), Postives = 74/137 (54.01%), Query Frame = 1
Query:  217 MPKTVLDQEGKFKQDEIFKRLSEDNRIRYTGCK--SGENAKNNFMQDLQSGKLNIAFVDSGINLRL---------DITGLSDNENIRFDDEE-RVFLQSHLILNGVCVKWLGHINLKDLEGSARIEFDRKMAQEESV 591
            MP+ V DQ  KF+ +E F++L+ ++ I+YTG +    E  +  F    + G+  IAFV +G NL L         +       E + F+ E  +V L++ +ILNGVCV W G I+L+ L+G   +EFD   AQ E  
Sbjct:    1 MPRVVPDQRAKFENEEFFRKLNRESEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFPANWQGEPRQAPTREYVDFEREPGKVHLKAPMILNGVCVLWKGWIDLQRLDGMGCLEFDDDRAQHEDA 137          
BLAST of Protein big brother vs. Ensembl Mouse
Match: Cbfb (core binding factor beta [Source:MGI Symbol;Acc:MGI:99851])

HSP 1 Score: 85.8853 bits (211), Expect = 8.111e-20
Identity = 51/135 (37.78%), Postives = 74/135 (54.81%), Query Frame = 1
Query:  217 MPKTVLDQEGKFKQDEIFKRLSEDNRIRYTGCK--SGENAKNNFMQDLQSGKLNIAFVDSGINLRLDITGLS------DNENIRFDDEER----VFLQSHLILNGVCVKWLGHINLKDLEGSARIEFDRKMAQEE 585
            MP+ V DQ  KF+ +E F++LS +  I+YTG +    E  +  F    + G+  IAFV +G NL L     S         +  + D ER    V+L++ +ILNGVCV W G I+L  L+G   +EFD + AQ+E
Sbjct:    1 MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQTRFQNACRDGRSEIAFVATGTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLHRLDGMGCLEFDEERAQQE 135          
BLAST of Protein big brother vs. Ensembl Mouse
Match: Cbfb (core binding factor beta [Source:MGI Symbol;Acc:MGI:99851])

HSP 1 Score: 84.7297 bits (208), Expect = 2.067e-19
Identity = 51/137 (37.23%), Postives = 74/137 (54.01%), Query Frame = 1
Query:  217 MPKTVLDQEGKFKQDEIFKRLSEDNRIRYTGCK--SGENAKNNFMQDLQSGKLNIAFVDSGINLRLDITGLS------DNENIRFDDEER----VFLQSHLILNGVCVKWLGHINLKDLEGSARIEFDRKMAQEESV 591
            MP+ V DQ  KF+ +E F++LS +  I+YTG +    E  +  F    + G+  IAFV +G NL L     S         +  + D ER    V+L++ +ILNGVCV W G I+L  L+G   +EFD + AQ+E  
Sbjct:    1 MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQTRFQNACRDGRSEIAFVATGTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLHRLDGMGCLEFDEERAQQEDA 137          
BLAST of Protein big brother vs. Ensembl Mouse
Match: Cbfb (core binding factor beta [Source:MGI Symbol;Acc:MGI:99851])

HSP 1 Score: 83.1889 bits (204), Expect = 3.904e-19
Identity = 50/133 (37.59%), Postives = 72/133 (54.14%), Query Frame = 1
Query:  217 MPKTVLDQEGKFKQDEIFKRLSEDNRIRYTGCK--SGENAKNNFMQDLQSGKLNIAFVDSGINLRLDITGLS------DNENIRFDDEER----VFLQSHLILNGVCVKWLGHINLKDLEGSARIEFDRKMAQ 579
            MP+ V DQ  KF+ +E F++LS +  I+YTG +    E  +  F    + G+  IAFV +G NL L     S         +  + D ER    V+L++ +ILNGVCV W G I+L  L+G   +EFD + AQ
Sbjct:    1 MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQTRFQNACRDGRSEIAFVATGTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLHRLDGMGCLEFDEERAQ 133          
BLAST of Protein big brother vs. Ensembl Mouse
Match: Cbfb (core binding factor beta [Source:MGI Symbol;Acc:MGI:99851])

HSP 1 Score: 65.0846 bits (157), Expect = 1.195e-12
Identity = 40/127 (31.50%), Postives = 60/127 (47.24%), Query Frame = 1
Query:  217 MPKTVLDQEGKFKQDEIFKRLSEDNRIRYTGCK--SGENAKNNFMQDLQSGKLNIAFVDSGINLRLDITGLSDNENIRFDDEERVFLQSHLILNGVCVKWLGHINLKDLEGSARIEFDRKMAQEESV 591
            MP+ V DQ  KF+ +E F++LS +  I+YTG +    E  +  F    + G+  I                             V+L++ +ILNGVCV W G I+L  L+G   +EFD + AQ+E  
Sbjct:    1 MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQTRFQNACRDGRSEI-----------------------------VYLKAPMILNGVCVIWKGWIDLHRLDGMGCLEFDEERAQQEDA 98          
BLAST of Protein big brother vs. UniProt/SwissProt
Match: sp|Q24039|BRO_DROME (Protein brother OS=Drosophila melanogaster OX=7227 GN=Bro PE=1 SV=2)

HSP 1 Score: 101.679 bits (252), Expect = 1.140e-24
Identity = 56/148 (37.84%), Postives = 86/148 (58.11%), Query Frame = 1
Query:  199 PDFHLKMPKTVLDQEGKFKQDEIFKRLSEDNRIRYTGCK--SGENAKNNFMQDLQSGKLNIAFVDSGINLRLDITG----LSDNENIRFDDEE-RVFLQSHLILNGVCVKWLGHINLKDLEGSARIEFDRKMAQEESVSCWNQLYDYN 621
            P F  KMP+ V DQ  KF  DE+F+RLS ++ +RYTG +  + E  +  F+ D + G   I+ V SG NL+L         +  ++  F+ E  +V L+S  I+NGVCV++ G ++L  L+G+A +EFD + AQ+E      Q+  YN
Sbjct:   31 PRFIFKMPRVVPDQRSKFDSDELFRRLSRESEVRYTGYRERAMEERRMRFVNDCRKGYAEISMVASGTNLQLYFNANHNPYAQEQDCDFERERGKVHLRSSFIMNGVCVRFRGWVDLDRLDGAACLEFDEQRAQQEDAQLQEQIQSYN 178          
BLAST of Protein big brother vs. UniProt/SwissProt
Match: sp|Q24040|BGB_DROME (Protein big brother OS=Drosophila melanogaster OX=7227 GN=Bgb PE=2 SV=3)

HSP 1 Score: 97.0561 bits (240), Expect = 6.154e-23
Identity = 58/162 (35.80%), Postives = 89/162 (54.94%), Query Frame = 1
Query:  199 PDFHLKMPKTVLDQEGKFKQDEIFKRLSEDNRIRYTGC--KSGENAKNNFMQDLQSGKLNIAFVDSGINLRLDITGLSDNENIRFDDEE--------RVFLQSHLILNGVCVKWLGHINLKDLEGSARIEFDRKMAQEESVSCWNQLYDYNFHFGFTEDNNK 654
            P F  KMP+ V DQ+ KF+ DE+F+RLS ++ +RYTG   +S E  +  FM   + G    +FV SG NL+L       N+N    D+E        +V ++S+ I+NGVCV++ G I+L+ L+G   +E+D + A  E     +Q+  YN      ED  +
Sbjct:   24 PRFIFKMPRVVPDQKSKFESDELFRRLSRESEVRYTGYRERSIEERQVRFMNGCREGHTEASFVASGTNLQLVFNA---NQNPYLHDKECDFDKEHGKVHIKSYFIMNGVCVRFRGWIDLERLDGVGCLEYDERRAMHEDAILRDQIDRYNQRLREFEDTKR 182          
BLAST of Protein big brother vs. UniProt/SwissProt
Match: sp|Q13951|PEBB_HUMAN (Core-binding factor subunit beta OS=Homo sapiens OX=9606 GN=CBFB PE=1 SV=2)

HSP 1 Score: 85.8853 bits (211), Expect = 4.811e-19
Identity = 51/135 (37.78%), Postives = 75/135 (55.56%), Query Frame = 1
Query:  217 MPKTVLDQEGKFKQDEIFKRLSEDNRIRYTGCK--SGENAKNNFMQDLQSGKLNIAFVDSGINLRLDITGLS------DNENIRFDDEER----VFLQSHLILNGVCVKWLGHINLKDLEGSARIEFDRKMAQEE 585
            MP+ V DQ  KF+ +E F++LS +  I+YTG +    E  +  F    + G+  IAFV +G NL L     S         +  + D ER    V+L++ +ILNGVCV W G I+L+ L+G   +EFD + AQ+E
Sbjct:    1 MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLDGMGCLEFDEERAQQE 135          
BLAST of Protein big brother vs. UniProt/SwissProt
Match: sp|Q08024|PEBB_MOUSE (Core-binding factor subunit beta OS=Mus musculus OX=10090 GN=Cbfb PE=1 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 1.446e-18
Identity = 51/137 (37.23%), Postives = 74/137 (54.01%), Query Frame = 1
Query:  217 MPKTVLDQEGKFKQDEIFKRLSEDNRIRYTGCK--SGENAKNNFMQDLQSGKLNIAFVDSGINLRLDITGLS------DNENIRFDDEER----VFLQSHLILNGVCVKWLGHINLKDLEGSARIEFDRKMAQEESV 591
            MP+ V DQ  KF+ +E F++LS +  I+YTG +    E  +  F    + G+  IAFV +G NL L     S         +  + D ER    V+L++ +ILNGVCV W G I+L  L+G   +EFD + AQ+E  
Sbjct:    1 MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQTRFQNACRDGRSEIAFVATGTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLHRLDGMGCLEFDEERAQQEDA 137          
BLAST of Protein big brother vs. TrEMBL
Match: E2BIL2 (Protein big brother OS=Harpegnathos saltator OX=610380 GN=EAI_13149 PE=4 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 1.228e-23
Identity = 61/149 (40.94%), Postives = 85/149 (57.05%), Query Frame = 1
Query:  199 PDFHLKMPKTVLDQEGKFKQDEIFKRLSEDNRIRYTGCK--SGENAKNNFMQDLQSGKLNIAFVDSGINLRLDITGLSDNENIR-----FDDEE-RVFLQSHLILNGVCVKWLGHINLKDLEGSARIEFDRKMAQEESVSCWNQLYDYN 621
            P    KMP+ V DQ+ KF+ DE+F+RLS ++ +RYTG +    E  +  F    + G   IAF  +G NL+L   G S N  +      FD E  +V L+SHLI+NGVCV+W G I+L+ L+G   +E+D + A EE      QL  YN
Sbjct:   28 PRLVFKMPRVVPDQKAKFESDELFRRLSRESEVRYTGYRDRPMEERQVRFQNGCREGHTEIAFAATGTNLQLVFGGASGNYPVDPCDCDFDKEHGKVHLRSHLIMNGVCVRWRGWIDLERLDGVGCLEYDEERAAEEDALLREQLERYN 176          
BLAST of Protein big brother vs. TrEMBL
Match: A0A158NKA4 (Uncharacterized protein OS=Atta cephalotes OX=12957 GN=105621100 PE=4 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 4.783e-23
Identity = 60/149 (40.27%), Postives = 85/149 (57.05%), Query Frame = 1
Query:  199 PDFHLKMPKTVLDQEGKFKQDEIFKRLSEDNRIRYTGCKSG--ENAKNNFMQDLQSGKLNIAFVDSGINLRLDITGLSDNENIR-----FDDEE-RVFLQSHLILNGVCVKWLGHINLKDLEGSARIEFDRKMAQEESVSCWNQLYDYN 621
            P    KMP+ V DQ+ KF+ DE+F+RLS ++ +RYTG +    E  +  F    + G   IAF  +G NL+L     S N  +      FD E  +V L+SHLI+NGVCV+W G I+L+ L+G   +E+D + A EE     +QL  YN
Sbjct:   28 PRLVFKMPRVVPDQKAKFESDELFRRLSRESEVRYTGYRDRPIEERQVRFQNGCREGHTEIAFAATGTNLQLVFGNASGNYPVDPNDCDFDKEHGKVHLRSHLIMNGVCVRWRGWIDLERLDGVGCLEYDEEHAAEEDALLRDQLERYN 176          
BLAST of Protein big brother vs. TrEMBL
Match: A0A151WIS2 (Protein big brother OS=Trachymyrmex zeteki OX=64791 GN=ALC60_13246 PE=4 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 4.783e-23
Identity = 60/149 (40.27%), Postives = 85/149 (57.05%), Query Frame = 1
Query:  199 PDFHLKMPKTVLDQEGKFKQDEIFKRLSEDNRIRYTGCKSG--ENAKNNFMQDLQSGKLNIAFVDSGINLRLDITGLSDNENIR-----FDDEE-RVFLQSHLILNGVCVKWLGHINLKDLEGSARIEFDRKMAQEESVSCWNQLYDYN 621
            P    KMP+ V DQ+ KF+ DE+F+RLS ++ +RYTG +    E  +  F    + G   IAF  +G NL+L     S N  +      FD E  +V L+SHLI+NGVCV+W G I+L+ L+G   +E+D + A EE     +QL  YN
Sbjct:   28 PRLVFKMPRVVPDQKAKFESDELFRRLSRESEVRYTGYRDRPIEERQVRFQNGCREGHTEIAFAATGTNLQLVFGNASGNYPVDPNDCDFDKEHGKVHLRSHLIMNGVCVRWRGWIDLERLDGVGCLEYDEEHAAEEDALLRDQLERYN 176          
BLAST of Protein big brother vs. TrEMBL
Match: A0A195EIT1 (Protein big brother OS=Trachymyrmex cornetzi OX=471704 GN=ALC57_02833 PE=4 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 4.783e-23
Identity = 60/149 (40.27%), Postives = 85/149 (57.05%), Query Frame = 1
Query:  199 PDFHLKMPKTVLDQEGKFKQDEIFKRLSEDNRIRYTGCKSG--ENAKNNFMQDLQSGKLNIAFVDSGINLRLDITGLSDNENIR-----FDDEE-RVFLQSHLILNGVCVKWLGHINLKDLEGSARIEFDRKMAQEESVSCWNQLYDYN 621
            P    KMP+ V DQ+ KF+ DE+F+RLS ++ +RYTG +    E  +  F    + G   IAF  +G NL+L     S N  +      FD E  +V L+SHLI+NGVCV+W G I+L+ L+G   +E+D + A EE     +QL  YN
Sbjct:   28 PRLVFKMPRVVPDQKAKFESDELFRRLSRESEVRYTGYRDRPIEERQVRFQNGCREGHTEIAFAATGTNLQLVFGNASGNYPVDPNDCDFDKEHGKVHLRSHLIMNGVCVRWRGWIDLERLDGVGCLEYDEEHAAEEDALLRDQLERYN 176          
BLAST of Protein big brother vs. TrEMBL
Match: A0A195BAT4 (Protein big brother OS=Atta colombica OX=520822 GN=ALC53_08098 PE=4 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 4.783e-23
Identity = 60/149 (40.27%), Postives = 85/149 (57.05%), Query Frame = 1
Query:  199 PDFHLKMPKTVLDQEGKFKQDEIFKRLSEDNRIRYTGCKSG--ENAKNNFMQDLQSGKLNIAFVDSGINLRLDITGLSDNENIR-----FDDEE-RVFLQSHLILNGVCVKWLGHINLKDLEGSARIEFDRKMAQEESVSCWNQLYDYN 621
            P    KMP+ V DQ+ KF+ DE+F+RLS ++ +RYTG +    E  +  F    + G   IAF  +G NL+L     S N  +      FD E  +V L+SHLI+NGVCV+W G I+L+ L+G   +E+D + A EE     +QL  YN
Sbjct:   28 PRLVFKMPRVVPDQKAKFESDELFRRLSRESEVRYTGYRDRPIEERQVRFQNGCREGHTEIAFAATGTNLQLVFGNASGNYPVDPNDCDFDKEHGKVHLRSHLIMNGVCVRWRGWIDLERLDGVGCLEYDEEHAAEEDALLRDQLERYN 176          
BLAST of Protein big brother vs. Ensembl Cavefish
Match: cbfb (core-binding factor subunit beta [Source:NCBI gene;Acc:103026750])

HSP 1 Score: 84.7297 bits (208), Expect = 1.247e-19
Identity = 49/137 (35.77%), Postives = 75/137 (54.74%), Query Frame = 1
Query:  217 MPKTVLDQEGKFKQDEIFKRLSEDNRIRYTGCK--SGENAKNNFMQDLQSGKLNIAFVDSGINLRLDITG---------LSDNENIRFDDEE-RVFLQSHLILNGVCVKWLGHINLKDLEGSARIEFDRKMAQEESV 591
            MP+ V DQ  KF+ +E F++LS +  I+YTG +    E  +  F    + G+  IAFV +G NL L             +   E + F+ E  +V+L++ +ILNGVCV W G I+L+ L+G   +E+D + AQ E  
Sbjct:    1 MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFPANLHGEQRQMPTREYVDFERETGKVYLKAPMILNGVCVIWRGWIDLQRLDGMGCLEYDDERAQHEDA 137          
BLAST of Protein big brother vs. Ensembl Cavefish
Match: cbfb (core-binding factor subunit beta [Source:NCBI gene;Acc:103026750])

HSP 1 Score: 83.9593 bits (206), Expect = 2.798e-19
Identity = 49/137 (35.77%), Postives = 75/137 (54.74%), Query Frame = 1
Query:  217 MPKTVLDQEGKFKQDEIFKRLSEDNRIRYTGCK--SGENAKNNFMQDLQSGKLNIAFVDSGINLRLDI---------TGLSDNENIRFDDEE-RVFLQSHLILNGVCVKWLGHINLKDLEGSARIEFDRKMAQEESV 591
            MP+ V DQ  KF+ +E F++LS +  I+YTG +    E  +  F    + G+  IAFV +G NL L             +   E + F+ E  +V+L++ +ILNGVCV W G I+L+ L+G   +E+D + AQ E  
Sbjct:    1 MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFPANLHGEQRQMPTREYVDFERETGKVYLKAPMILNGVCVIWRGWIDLQRLDGMGCLEYDDERAQHEDA 137          
BLAST of Protein big brother vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000610.1 (pep scaffold:Pmarinus_7.0:GL478173:5823:25505:-1 gene:ENSPMAG00000000551.1 transcript:ENSPMAT00000000610.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 45.4394 bits (106), Expect = 8.006e-7
Identity = 20/43 (46.51%), Postives = 32/43 (74.42%), Query Frame = 1
Query:  463 VFLQSHLILNGVCVKWLGHINLKDLEGSARIEFDRKMAQEESV 591
            V L++ +ILNGVCV W G ++L+ L+G A +EFD + A++E +
Sbjct:    2 VHLKAPMILNGVCVIWRGWVDLQRLDGMACLEFDEERARQEDL 44          
BLAST of Protein big brother vs. Ensembl Nematostella
Match: CBFBETA (Core-binding factor subunit beta; Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SV13])

HSP 1 Score: 90.1225 bits (222), Expect = 4.449e-22
Identity = 50/130 (38.46%), Postives = 82/130 (63.08%), Query Frame = 1
Query:  217 MPKTVLDQEGKFKQDEIFKRLSEDNRIRYTGCK--SGENAKNNFMQDLQSGKLNIAFVDSGINLRLDITGLSD----NENIRFDDEE-RVFLQSHLILNGVCVKWLGHINLKDLEGSARIEFDRKMAQEE 585
            MP+ V +Q+ KF+ DE+F++L+ ++ I+YTG +  S E     F  +++ G+ N+A+V SG NL L      D    +E + FD E  +V ++SH ILNGVC+ + G I+L+ L+G   IE+D + A++E
Sbjct:    1 MPRVVPEQKQKFENDEMFRKLARESEIKYTGYRDRSHEERVVRFQTEIRDGQSNVAYVASGTNLTLHFPKAEDGFIRSEFLDFDREPGKVHIKSHFILNGVCIIFKGWIDLQRLDGIGYIEYDEEKARKE 130          
BLAST of Protein big brother vs. Ensembl Medaka
Match: cbfb (core-binding factor subunit beta [Source:NCBI gene;Acc:101157051])

HSP 1 Score: 87.0409 bits (214), Expect = 1.477e-20
Identity = 49/137 (35.77%), Postives = 77/137 (56.20%), Query Frame = 1
Query:  217 MPKTVLDQEGKFKQDEIFKRLSEDNRIRYTGCK--SGENAKNNFMQDLQSGKLNIAFVDSGINLRL---------DITGLSDNENIRFDDEE-RVFLQSHLILNGVCVKWLGHINLKDLEGSARIEFDRKMAQEESV 591
            MP+ V DQ  KF+ +E F++LS +  I+YTG +    E  +  F    + G+  +AFV +G NL L         D   +   E + F+ E  +V+L++ +ILNGVCV W G I+L+ L+G   +E+D++ AQ E  
Sbjct:    1 MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEVAFVATGTNLSLQFFPANLHGDQRQVPTREYVDFERETGKVYLKAPMILNGVCVIWRGWIDLQRLDGMGYLEYDQERAQHEDA 137          
BLAST of Protein big brother vs. Ensembl Medaka
Match: cbfb (core-binding factor subunit beta [Source:NCBI gene;Acc:101157051])

HSP 1 Score: 87.0409 bits (214), Expect = 2.508e-20
Identity = 49/137 (35.77%), Postives = 77/137 (56.20%), Query Frame = 1
Query:  217 MPKTVLDQEGKFKQDEIFKRLSEDNRIRYTGCK--SGENAKNNFMQDLQSGKLNIAFVDSGINLRL---------DITGLSDNENIRFDDEE-RVFLQSHLILNGVCVKWLGHINLKDLEGSARIEFDRKMAQEESV 591
            MP+ V DQ  KF+ +E F++LS +  I+YTG +    E  +  F    + G+  +AFV +G NL L         D   +   E + F+ E  +V+L++ +ILNGVCV W G I+L+ L+G   +E+D++ AQ E  
Sbjct:    1 MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEVAFVATGTNLSLQFFPANLHGDQRQVPTREYVDFERETGKVYLKAPMILNGVCVIWRGWIDLQRLDGMGYLEYDQERAQHEDA 137          
BLAST of Protein big brother vs. Planmine SMEST
Match: SMESG000068819.1 (SMESG000068819.1)

HSP 1 Score: 304.294 bits (778), Expect = 8.922e-106
Identity = 148/148 (100.00%), Postives = 148/148 (100.00%), Query Frame = 1
Query:  217 MPKTVLDQEGKFKQDEIFKRLSEDNRIRYTGCKSGENAKNNFMQDLQSGKLNIAFVDSGINLRLDITGLSDNENIRFDDEERVFLQSHLILNGVCVKWLGHINLKDLEGSARIEFDRKMAQEESVSCWNQLYDYNFHFGFTEDNNKIE 660
            MPKTVLDQEGKFKQDEIFKRLSEDNRIRYTGCKSGENAKNNFMQDLQSGKLNIAFVDSGINLRLDITGLSDNENIRFDDEERVFLQSHLILNGVCVKWLGHINLKDLEGSARIEFDRKMAQEESVSCWNQLYDYNFHFGFTEDNNKIE
Sbjct:    1 MPKTVLDQEGKFKQDEIFKRLSEDNRIRYTGCKSGENAKNNFMQDLQSGKLNIAFVDSGINLRLDITGLSDNENIRFDDEERVFLQSHLILNGVCVKWLGHINLKDLEGSARIEFDRKMAQEESVSCWNQLYDYNFHFGFTEDNNKIE 148          
BLAST of Protein big brother vs. Planmine SMEST
Match: SMESG000068819.1 (SMESG000068819.1)

HSP 1 Score: 217.624 bits (553), Expect = 3.161e-72
Identity = 106/106 (100.00%), Postives = 106/106 (100.00%), Query Frame = 1
Query:  343 MQDLQSGKLNIAFVDSGINLRLDITGLSDNENIRFDDEERVFLQSHLILNGVCVKWLGHINLKDLEGSARIEFDRKMAQEESVSCWNQLYDYNFHFGFTEDNNKIE 660
            MQDLQSGKLNIAFVDSGINLRLDITGLSDNENIRFDDEERVFLQSHLILNGVCVKWLGHINLKDLEGSARIEFDRKMAQEESVSCWNQLYDYNFHFGFTEDNNKIE
Sbjct:    1 MQDLQSGKLNIAFVDSGINLRLDITGLSDNENIRFDDEERVFLQSHLILNGVCVKWLGHINLKDLEGSARIEFDRKMAQEESVSCWNQLYDYNFHFGFTEDNNKIE 106          
The following BLAST results are available for this feature:
BLAST of Protein big brother vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CBFB8.159e-2037.78core-binding factor subunit beta [Source:HGNC Symb... [more]
CBFB1.002e-1937.78core-binding factor subunit beta [Source:HGNC Symb... [more]
CBFB2.607e-1937.23core-binding factor subunit beta [Source:HGNC Symb... [more]
CBFB4.194e-1332.00core-binding factor subunit beta [Source:HGNC Symb... [more]
back to top
BLAST of Protein big brother vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
bro-18.706e-625.00BROther (Drosophila tx factor partner) homolog [S... [more]
back to top
BLAST of Protein big brother vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Bro1.137e-2537.84gene:FBgn0013755 transcript:FBtr0072760[more]
Bgb6.139e-2435.80gene:FBgn0013753 transcript:FBtr0072758[more]
Bgb1.663e-2335.80gene:FBgn0013753 transcript:FBtr0330180[more]
back to top
BLAST of Protein big brother vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cbfb5.965e-1935.77core-binding factor subunit beta [Source:ZFIN;Acc:... [more]
cbfb7.736e-1935.77core-binding factor subunit beta [Source:ZFIN;Acc:... [more]
cbfb8.071e-1935.77core-binding factor subunit beta [Source:ZFIN;Acc:... [more]
cbfb8.071e-1935.77core-binding factor subunit beta [Source:ZFIN;Acc:... [more]
cbfb1.214e-1835.77core-binding factor subunit beta [Source:ZFIN;Acc:... [more]
back to top
BLAST of Protein big brother vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
or1s11.231e-1835.77olfactory receptor family 1 subfamily S member 1 (... [more]
back to top
BLAST of Protein big brother vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Cbfb8.111e-2037.78core binding factor beta [Source:MGI Symbol;Acc:MG... [more]
Cbfb2.067e-1937.23core binding factor beta [Source:MGI Symbol;Acc:MG... [more]
Cbfb3.904e-1937.59core binding factor beta [Source:MGI Symbol;Acc:MG... [more]
Cbfb1.195e-1231.50core binding factor beta [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Protein big brother vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q24039|BRO_DROME1.140e-2437.84Protein brother OS=Drosophila melanogaster OX=7227... [more]
sp|Q24040|BGB_DROME6.154e-2335.80Protein big brother OS=Drosophila melanogaster OX=... [more]
sp|Q13951|PEBB_HUMAN4.811e-1937.78Core-binding factor subunit beta OS=Homo sapiens O... [more]
sp|Q08024|PEBB_MOUSE1.446e-1837.23Core-binding factor subunit beta OS=Mus musculus O... [more]
back to top
BLAST of Protein big brother vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
E2BIL21.228e-2340.94Protein big brother OS=Harpegnathos saltator OX=61... [more]
A0A158NKA44.783e-2340.27Uncharacterized protein OS=Atta cephalotes OX=1295... [more]
A0A151WIS24.783e-2340.27Protein big brother OS=Trachymyrmex zeteki OX=6479... [more]
A0A195EIT14.783e-2340.27Protein big brother OS=Trachymyrmex cornetzi OX=47... [more]
A0A195BAT44.783e-2340.27Protein big brother OS=Atta colombica OX=520822 GN... [more]
back to top
BLAST of Protein big brother vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cbfb1.247e-1935.77core-binding factor subunit beta [Source:NCBI gene... [more]
cbfb2.798e-1935.77core-binding factor subunit beta [Source:NCBI gene... [more]
back to top
BLAST of Protein big brother vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000000610.18.006e-746.51pep scaffold:Pmarinus_7.0:GL478173:5823:25505:-1 g... [more]
back to top
BLAST of Protein big brother vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein big brother vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
CBFBETA4.449e-2238.46Core-binding factor subunit beta; Predicted protei... [more]
back to top
BLAST of Protein big brother vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cbfb1.477e-2035.77core-binding factor subunit beta [Source:NCBI gene... [more]
cbfb2.508e-2035.77core-binding factor subunit beta [Source:NCBI gene... [more]
back to top
BLAST of Protein big brother vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000068819.18.922e-106100.00SMESG000068819.1[more]
SMESG000068819.13.161e-72100.00SMESG000068819.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016591 ID=SMED30016591|Name=Protein big brother|organism=Schmidtea mediterranea sexual|type=transcript|length=870bp
TTCAAATTCTATAATTATTACAAAAGAATATTGTAGTATGATAATGTGAT
TACTCATCGATACTGGCGCAAATTCGGTTAGACAGACAGAAATCCAATTT
GTAGTTATTCATACTTGAATTAATCATGCTCTGCATGCCTTATCAAAATA
AAAGATACAACTAGATATAATCTACTGCATTGATTCACTTATTTGTGTCC
TGATTTTCACCTCAAAATGCCGAAGACAGTTTTGGATCAAGAAGGAAAGT
TTAAGCAAGATGAAATTTTTAAAAGACTTTCAGAAGATAATAGAATTCGT
TATACAGGTTGCAAATCGGGTGAAAATGCGAAAAACAATTTCATGCAAGA
CCTACAATCAGGAAAACTAAATATAGCATTTGTGGATTCTGGAATCAACT
TGAGGCTGGACATCACCGGTTTATCGGATAATGAGAATATAAGATTCGAT
GATGAAGAACGTGTATTCCTTCAGTCACATTTGATTTTAAATGGCGTTTG
TGTAAAATGGCTTGGTCATATTAATCTTAAAGACTTAGAAGGAAGTGCTC
GAATTGAATTTGATCGGAAAATGGCTCAAGAGGAATCAGTATCGTGTTGG
AACCAATTATACGATTATAATTTCCATTTCGGATTCACAGAGGATAACAA
TAAAATCGAGTAACATTAGGAAAGTACAGTCAACAAAAACTGTTACATTT
AAATTACTATTTCTGTCCGTTTGCGCATTTATAACCGATCCAGATGTAGA
AATTTGATATTTGGATAAATTACTGTATTTGCTGTATACAATTTCTATCT
ATTTATTTTTGATAATTATATAATTGTTATATAAACCATTTTGTAATTTA
ATACCGATGTTTTTTAAAAA
back to top

protein sequence of SMED30016591-orf-1

>SMED30016591-orf-1 ID=SMED30016591-orf-1|Name=SMED30016591-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=149bp
MPKTVLDQEGKFKQDEIFKRLSEDNRIRYTGCKSGENAKNNFMQDLQSGK
LNIAFVDSGINLRLDITGLSDNENIRFDDEERVFLQSHLILNGVCVKWLG
HINLKDLEGSARIEFDRKMAQEESVSCWNQLYDYNFHFGFTEDNNKIE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:1903508positive regulation of nucleic acid-templated transcription
GO:1903506regulation of nucleic acid-templated transcription
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000101muscle cell
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002075pigment cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036552CBF_bsu_sf
IPR003417CBF_beta
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: molecular function
TermDefinition
GO:0003713transcription coactivator activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036552Core-binding factor, beta subunit superfamilyGENE3DG3DSA:2.40.250.10coord: 1..128
e-value: 7.3E-36
score: 125.1
IPR036552Core-binding factor, beta subunit superfamilySUPERFAMILYSSF50723Core binding factor beta, CBFcoord: 5..124
IPR003417Core-binding factor, beta subunitPFAMPF02312CBF_betacoord: 1..144
e-value: 1.3E-34
score: 119.3
IPR003417Core-binding factor, beta subunitPANTHERPTHR10276CORE-BINDING FACTOR, BETA SUBUNITcoord: 1..145