Synapsin

Overview
NameSynapsin
Smed IDSMED30016589
Length (bp)2365
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Synapsin (SMED30016589) t-SNE clustered cells

Violin plots show distribution of expression levels for Synapsin (SMED30016589) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Synapsin (SMED30016589) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Synapsin (SMED30016589) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016589

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30016589SMESG000063523.1 SmedASXL_014276SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30016589SMESG000063523.1 dd_Smed_v4_3135_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30016589SMESG000063523.1 dd_Smed_v4_3135_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30016589SMESG000063523.1 dd_Smed_v4_3135_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30016589SMESG000063523.1 dd_Smed_v4_3135_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30016589SMESG000063523.1 dd_Smed_v4_3135_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016589SMESG000063523.1 Contig18502uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016589SMESG000063523.1 Contig18502newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016589SMESG000063523.1 Contig22476uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016589SMESG000063523.1 Contig22476newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016589SMESG000063523.1 Contig44796uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016589SMESG000063523.1 Contig44796newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30016589SMESG000063523.1 AY067773smed_ncbi_20200123PMID:21566185
Wagner et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
nervous systemSMED30016589SMESG000063523.1 dd_Smed_v6_3135_0_1dd_Smed_v6PMID:21566185
Wagner et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
head regionSMED30016589SMESG000063523.1 dd_Smed_v6_3135_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
central nervous systemSMED30016589SMESG000063523.1 AY067773smed_ncbi_20200123PMID:22385657
Wagner et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Synapsin vs. Ensembl Human
Match: SYN2 (synapsin II [Source:HGNC Symbol;Acc:HGNC:11495])

HSP 1 Score: 374.4 bits (960), Expect = 4.166e-121
Identity = 166/319 (52.04%), Postives = 246/319 (77.12%), Query Frame = 3
Query:  639 KCKTLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQST--CDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKM-QIFCR 1586
            K K LL++DEPH DW+K FRG+K+ GD+D ++EQAEF+E+++V++++    VD+QV ++GTK +RSF+PDF+++RQ       NE++++ ++G  Y G+PS+NSL +++N  D+PW++A L  +   LG E FPLIEQ YYP+HKEM+          +PT FP+V+KIG+  +G GK+KVENH++FQDIASVVA+  T+AT+EPFID+K D+ +QKIGNN+KA++R S+SG+WKTNTGSA+LEQ+ ++D++KLW+   +++FGGLDICA+KAV  K+ + +I+EV   +M L+GE Q EDR+LI EL+ SKM Q+  R
Sbjct:  112 KAKVLLVVDEPHADWAKCFRGKKVLGDYDIKVEQAEFSELNLVAHADGTYAVDMQVLRNGTKVVRSFRPDFVLIRQHAFGMAENEDFRHLIIGMQYAGLPSINSLESIYNFCDKPWVFAQLVAIYKTLGGEKFPLIEQTYYPNHKEML---------TLPT-FPVVVKIGHAHSGMGKVKVENHYDFQDIASVVALTQTYATAEPFIDSKYDIRVQKIGNNYKAYMRTSISGNWKTNTGSAMLEQIAMSDRYKLWVDTCSEMFGGLDICAVKAVHGKDGKDYIFEVMDCSMPLIGEHQVEDRQLITELVISKMNQLLSR 420          
BLAST of Synapsin vs. Ensembl Human
Match: SYN2 (synapsin II [Source:HGNC Symbol;Acc:HGNC:11495])

HSP 1 Score: 377.096 bits (967), Expect = 7.209e-121
Identity = 166/319 (52.04%), Postives = 246/319 (77.12%), Query Frame = 3
Query:  639 KCKTLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQST--CDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKM-QIFCR 1586
            K K LL++DEPH DW+K FRG+K+ GD+D ++EQAEF+E+++V++++    VD+QV ++GTK +RSF+PDF+++RQ       NE++++ ++G  Y G+PS+NSL +++N  D+PW++A L  +   LG E FPLIEQ YYP+HKEM+          +PT FP+V+KIG+  +G GK+KVENH++FQDIASVVA+  T+AT+EPFID+K D+ +QKIGNN+KA++R S+SG+WKTNTGSA+LEQ+ ++D++KLW+   +++FGGLDICA+KAV  K+ + +I+EV   +M L+GE Q EDR+LI EL+ SKM Q+  R
Sbjct:  112 KAKVLLVVDEPHADWAKCFRGKKVLGDYDIKVEQAEFSELNLVAHADGTYAVDMQVLRNGTKVVRSFRPDFVLIRQHAFGMAENEDFRHLIIGMQYAGLPSINSLESIYNFCDKPWVFAQLVAIYKTLGGEKFPLIEQTYYPNHKEML---------TLPT-FPVVVKIGHAHSGMGKVKVENHYDFQDIASVVALTQTYATAEPFIDSKYDIRVQKIGNNYKAYMRTSISGNWKTNTGSAMLEQIAMSDRYKLWVDTCSEMFGGLDICAVKAVHGKDGKDYIFEVMDCSMPLIGEHQVEDRQLITELVISKMNQLLSR 420          
BLAST of Synapsin vs. Ensembl Human
Match: SYN1 (synapsin I [Source:HGNC Symbol;Acc:HGNC:11494])

HSP 1 Score: 364.77 bits (935), Expect = 4.651e-115
Identity = 153/310 (49.35%), Postives = 240/310 (77.42%), Query Frame = 3
Query:  648 TLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQS--TCDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKM 1571
             LL+IDEPHTDW+KYF+G+KI G+ D ++EQAEF+++++V+++  G +VD++V ++G K +RS KPDF+++RQ   +   N ++++ ++G  Y G+PS+NSLH+++N  D+PW++A +  +  +LG E FPLI+Q +YP+HKEM+ + T          +P+V+K+G+  +G GK+KV+N  +FQDIASVVA+  T+AT+EPFIDAK DV +QKIG N+KA++R S+SG+WKTNTGSA+LEQ+ ++D++KLW+   +++FGGLDICA++A+  K+   HI EV GS+M L+G+ Q+ED++LI EL+ +KM
Sbjct:  115 VLLVIDEPHTDWAKYFKGKKIHGEIDIKVEQAEFSDLNLVAHANGGFSVDMEVLRNGVKVVRSLKPDFVLIRQHAFSMARNGDYRSLVIGLQYAGIPSVNSLHSVYNFCDKPWVFAQMVRLHKKLGTEEFPLIDQTFYPNHKEMLSSTT----------YPVVVKMGHAHSGMGKVKVDNQHDFQDIASVVALTKTYATAEPFIDAKYDVRVQKIGQNYKAYMRTSVSGNWKTNTGSAMLEQIAMSDRYKLWVDTCSEIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKM 414          
BLAST of Synapsin vs. Ensembl Human
Match: SYN1 (synapsin I [Source:HGNC Symbol;Acc:HGNC:11494])

HSP 1 Score: 364.385 bits (934), Expect = 1.621e-114
Identity = 153/310 (49.35%), Postives = 240/310 (77.42%), Query Frame = 3
Query:  648 TLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQS--TCDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKM 1571
             LL+IDEPHTDW+KYF+G+KI G+ D ++EQAEF+++++V+++  G +VD++V ++G K +RS KPDF+++RQ   +   N ++++ ++G  Y G+PS+NSLH+++N  D+PW++A +  +  +LG E FPLI+Q +YP+HKEM+ + T          +P+V+K+G+  +G GK+KV+N  +FQDIASVVA+  T+AT+EPFIDAK DV +QKIG N+KA++R S+SG+WKTNTGSA+LEQ+ ++D++KLW+   +++FGGLDICA++A+  K+   HI EV GS+M L+G+ Q+ED++LI EL+ +KM
Sbjct:  115 VLLVIDEPHTDWAKYFKGKKIHGEIDIKVEQAEFSDLNLVAHANGGFSVDMEVLRNGVKVVRSLKPDFVLIRQHAFSMARNGDYRSLVIGLQYAGIPSVNSLHSVYNFCDKPWVFAQMVRLHKKLGTEEFPLIDQTFYPNHKEMLSSTT----------YPVVVKMGHAHSGMGKVKVDNQHDFQDIASVVALTKTYATAEPFIDAKYDVRVQKIGQNYKAYMRTSVSGNWKTNTGSAMLEQIAMSDRYKLWVDTCSEIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKM 414          
BLAST of Synapsin vs. Ensembl Human
Match: SYN3 (synapsin III [Source:HGNC Symbol;Acc:HGNC:11496])

HSP 1 Score: 348.206 bits (892), Expect = 1.029e-109
Identity = 156/321 (48.60%), Postives = 235/321 (73.21%), Query Frame = 3
Query:  639 KCKTLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSM-RSFKPDFLVVRQS--TCDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKMQIFCRPN 1592
            + + LL+ID+ HTDWSKYF G+K+ G+ + R+EQAEF+E+++ +Y   GC VD+QV ++GTK + RSFKPDF++VRQ   +    E++++ ++G  YGG+P++NSL++++N   +PW+++ L  + + LG E FPL+EQ ++P+HK M          V    FP+V+K+G+   G GKIKVEN  +FQDI SVVA+A T+AT+E FID+K D+ IQKIG+N+KA++R S+SG+WK NTGSA+LEQV + ++++LW+   +++FGGLDICA+KAV SK+   +I EV  S+M L+GE  EEDR+L+A+L+ SKM     P 
Sbjct:   90 RPRILLVIDDAHTDWSKYFHGKKVNGEIEIRVEQAEFSELNLAAYVTGGCMVDMQVVRNGTKVVSRSFKPDFILVRQHAYSMALGEDYRSLVIGLQYGGLPAVNSLYSVYNFCSKPWVFSQLIKIFHSLGPEKFPLVEQTFFPNHKPM----------VTAPHFPVVVKLGHAHAGMGKIKVENQLDFQDITSVVAMAKTYATTEAFIDSKYDIRIQKIGSNYKAYMRTSISGNWKANTGSAMLEQVAMTERYRLWVDSCSEMFGGLDICAVKAVHSKDGRDYIIEVMDSSMPLIGEHVEEDRQLMADLVVSKMSQLPMPG 400          
BLAST of Synapsin vs. Ensembl Celegans
Match: snn-1 (Synapsin [Source:UniProtKB/TrEMBL;Acc:G5EGI2])

HSP 1 Score: 152.525 bits (384), Expect = 2.217e-39
Identity = 112/409 (27.38%), Postives = 195/409 (47.68%), Query Frame = 3
Query:  558 ESITGQITNTIS--------RGFFAASAKPT----SSKGK-----CKTLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPD--FLVVRQSTCDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAV---ANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKMQIFCRPNIPKAESLHVMNRQNDSPINTSNPPTSASSVNITSQIGSRLPS 1718
            +SI  +++NTIS        R   AA+ + +     S+G+      K LL+ID  H DWSKYFR      ++  R+EQ + +E+ ++  +E  CTV++    +  K +R+F P   FL    + C      K     F+   +P LNS  +     DR  +   L+ +    G  + P++   +YP   +          +   + +PMV+ +     G GKIKV NH E  D+  ++ +    +T    +PF+DAK D+ IQKIG+ +K F+R+ +   WK+N GS++LEQ+   ++ K ++  +    G + IC++  + SK     +++V    +   GE+ E+DR+  + L    ++    P I              SPI    P TS ++  +T+  G+  P+
Sbjct:   32 QSIANKVSNTISAPTSPAKSRESLAAALERSLNHDRSRGEPLMKDAKVLLVIDSHHVDWSKYFRNHT---EYAIRVEQGDIDELDVMC-TEKNCTVELN---TPGKDVRTFTPSAVFLGAGATRC---AQLKTITRAFIAAHIPFLNSHTSAVAFLDRNNLKKQLKKITLSDG-ASIPMLPIVHYPHFHKF--------HQSQSSTYPMVVSVNEGFQGIGKIKVNNHEELCDVEGMLQIMSKGDTEVEVQPFVDAKYDLHIQKIGHEYKTFIRRGICKHWKSNVGSSVLEQISTCERHKKYLKAITDHVGPMHICSIDILVSKEGREFVHDVNDV-IAYFGESAEDDRRAASLL----LRALVAPRI-------------TSPIAAEPPATSPTTSAVTNGHGNHGPA 403          
BLAST of Synapsin vs. Ensembl Celegans
Match: snn-1 (Synapsin [Source:UniProtKB/TrEMBL;Acc:G5EGI2])

HSP 1 Score: 150.214 bits (378), Expect = 3.841e-39
Identity = 101/363 (27.82%), Postives = 175/363 (48.21%), Query Frame = 3
Query:  645 KTLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPD--FLVVRQSTCDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAV---ANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKMQIFCRPNIPKAESLHVMNRQNDSPINTSNPPTSASSVNITSQIGSRLPS 1718
            K LL+ID  H DWSKYFR      ++  R+EQ + +E+ ++  +E  CTV++    +  K +R+F P   FL    + C      K     F+   +P LNS  +     DR  +   L+ +    G  + P++   +YP   +          +   + +PMV+ +     G GKIKV NH E  D+  ++ +    +T    +PF+DAK D+ IQKIG+ +K F+R+ +   WK+N GS++LEQ+   ++ K ++  +    G + IC++  + SK     +++V    +   GE+ E+DR+  + L    ++    P I              SPI    P TS ++  +T+  G+  P+
Sbjct:    5 KVLLVIDSHHVDWSKYFRNHT---EYAIRVEQGDIDELDVMC-TEKNCTVELN---TPGKDVRTFTPSAVFLGAGATRC---AQLKTITRAFIAAHIPFLNSHTSAVAFLDRNNLKKQLKKITLSDG-ASIPMLPIVHYPHFHKF--------HQSQSSTYPMVVSVNEGFQGIGKIKVNNHEELCDVEGMLQIMSKGDTEVEVQPFVDAKYDLHIQKIGHEYKTFIRRGICKHWKSNVGSSVLEQISTCERHKKYLKAITDHVGPMHICSIDILVSKEGREFVHDVNDV-IAYFGESAEDDRRAASLL----LRALVAPRI-------------TSPIAAEPPATSPTTSAVTNGHGNHGPA 330          
BLAST of Synapsin vs. Ensembl Fly
Match: Syn (gene:FBgn0004575 transcript:FBtr0100472)

HSP 1 Score: 342.428 bits (877), Expect = 1.151e-107
Identity = 188/489 (38.45%), Postives = 290/489 (59.30%), Query Frame = 3
Query:  273 YLKRRFSSGDLQDEAADQREQEGLPSFLNPFNANPQPSKPNQPV-------NNNINRMQQRPTSTEPSIANTAPTHRXXXXXXXXXXXXXXXXXGFSAAPM---VESITG----QITNTISRGFFAASAK-PTSSKGKCKTLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQSTCDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVA----NTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKMQIFCRPNIP-----KAESLHVMNRQNDSPINTSNPPT 1667
            +LKRRFSSGDL  E  D  +   LP    P     QP+KP  PV              Q    + E S++  A       A          ++   S   +   V+S+TG    Q  + +     +A+ + P  SK K  TLL++D+ +TDWSKYFRGR++ GD+D R+EQAEF ++++VS ++ G  V +   +SGT+  RSF+PDF+++RQ   D + ++++ ++G  YGGVPS+NSLH+++   D+PW+++HL  ++ RLGR+ FPLIEQ ++P+ +++             TKFP V+K G+C  G    ++EN    QD A +V+ A    + + T EP+IDAK  V IQKIGNN+KAF+RKS++G+WKTN GSA+LEQ+ L +K+K W+ E+++LFGG+++C L  V +K+   +I     S   L+G+TQEEDR+ IA+L+  +MQ  CRP++      K  S   ++ + +SP +    PT
Sbjct:   16 FLKRRFSSGDLSSEV-DDVDPNSLPPAARPIQD--QPTKP--PVAGGPPNMPPPPAPGQPAGAAPELSLSFGAGKTPATAAPAPPRGVSAPTSPAKSRESLLQRVQSLTGAARDQGASILGAAVQSATQRAPAFSKDKYFTLLVLDDQNTDWSKYFRGRRLHGDFDIRVEQAEFRDITVVSSADTGPVVTMAAYRSGTRVARSFRPDFVLIRQPPRDGSSDYRSTILGLKYGGVPSINSLHSIYQFQDKPWVFSHLLQLQRRLGRDGFPLIEQTFFPNPRDLFQF----------TKFPSVLKAGHCHGGVATARLENQSALQDAAGLVSGAGNDSHCYCTIEPYIDAKFSVHIQKIGNNYKAFMRKSITGNWKTNQGSAMLEQITLTEKYKSWVDEISELFGGMEVCGLSVVVAKDGREYIISACDSTFALIGDTQEEDRRQIADLVSGRMQNVCRPSMAQTGPGKLPSRSSVSSRAESPTDEGVAPT 489          
BLAST of Synapsin vs. Ensembl Fly
Match: Syn (gene:FBgn0004575 transcript:FBtr0089477)

HSP 1 Score: 339.347 bits (869), Expect = 3.227e-107
Identity = 156/363 (42.98%), Postives = 242/363 (66.67%), Query Frame = 3
Query:  606 AASAKPTSSKGKCKTLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQSTCDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVA----NTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKMQIFCRPNIP-----KAESLHVMNRQNDSPINTSNPPT 1667
            A    P  SK K  TLL++D+ +TDWSKYFRGR++ GD+D R+EQAEF ++++VS ++ G  V +   +SGT+  RSF+PDF+++RQ   D + ++++ ++G  YGGVPS+NSLH+++   D+PW+++HL  ++ RLGR+ FPLIEQ ++P+ +++             TKFP V+K G+C  G    ++EN    QD A +V+ A    + + T EP+IDAK  V IQKIGNN+KAF+RKS++G+WKTN GSA+LEQ+ L +K+K W+ E+++LFGG+++C L  V +K+   +I     S   L+G+TQEEDR+ IA+L+  +MQ  CRP++      K  S   ++ + +SP +    PT
Sbjct:   77 ATQRAPAFSKDKYFTLLVLDDQNTDWSKYFRGRRLHGDFDIRVEQAEFRDITVVSSADTGPVVTMAAYRSGTRVARSFRPDFVLIRQPPRDGSSDYRSTILGLKYGGVPSINSLHSIYQFQDKPWVFSHLLQLQRRLGRDGFPLIEQTFFPNPRDLFQF----------TKFPSVLKAGHCHGGVATARLENQSALQDAAGLVSGAGNDSHCYCTIEPYIDAKFSVHIQKIGNNYKAFMRKSITGNWKTNQGSAMLEQITLTEKYKSWVDEISELFGGMEVCGLSVVVAKDGREYIISACDSTFALIGDTQEEDRRQIADLVSGRMQNVCRPSMAQTGPGKLPSRSSVSSRAESPTDEGVAPT 429          
BLAST of Synapsin vs. Ensembl Fly
Match: Syn (gene:FBgn0004575 transcript:FBtr0100471)

HSP 1 Score: 346.28 bits (887), Expect = 1.045e-104
Identity = 188/489 (38.45%), Postives = 290/489 (59.30%), Query Frame = 3
Query:  273 YLKRRFSSGDLQDEAADQREQEGLPSFLNPFNANPQPSKPNQPV-------NNNINRMQQRPTSTEPSIANTAPTHRXXXXXXXXXXXXXXXXXGFSAAPM---VESITG----QITNTISRGFFAASAK-PTSSKGKCKTLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQSTCDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVA----NTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKMQIFCRPNIP-----KAESLHVMNRQNDSPINTSNPPT 1667
            +LKRRFSSGDL  E  D  +   LP    P     QP+KP  PV              Q    + E S++  A       A          ++   S   +   V+S+TG    Q  + +     +A+ + P  SK K  TLL++D+ +TDWSKYFRGR++ GD+D R+EQAEF ++++VS ++ G  V +   +SGT+  RSF+PDF+++RQ   D + ++++ ++G  YGGVPS+NSLH+++   D+PW+++HL  ++ RLGR+ FPLIEQ ++P+ +++             TKFP V+K G+C  G    ++EN    QD A +V+ A    + + T EP+IDAK  V IQKIGNN+KAF+RKS++G+WKTN GSA+LEQ+ L +K+K W+ E+++LFGG+++C L  V +K+   +I     S   L+G+TQEEDR+ IA+L+  +MQ  CRP++      K  S   ++ + +SP +    PT
Sbjct:   16 FLKRRFSSGDLSSEV-DDVDPNSLPPAARPIQD--QPTKP--PVAGGPPNMPPPPAPGQPAGAAPELSLSFGAGKTPATAAPAPPRGVSAPTSPAKSRESLLQRVQSLTGAARDQGASILGAAVQSATQRAPAFSKDKYFTLLVLDDQNTDWSKYFRGRRLHGDFDIRVEQAEFRDITVVSSADTGPVVTMAAYRSGTRVARSFRPDFVLIRQPPRDGSSDYRSTILGLKYGGVPSINSLHSIYQFQDKPWVFSHLLQLQRRLGRDGFPLIEQTFFPNPRDLFQF----------TKFPSVLKAGHCHGGVATARLENQSALQDAAGLVSGAGNDSHCYCTIEPYIDAKFSVHIQKIGNNYKAFMRKSITGNWKTNQGSAMLEQITLTEKYKSWVDEISELFGGMEVCGLSVVVAKDGREYIISACDSTFALIGDTQEEDRRQIADLVSGRMQNVCRPSMAQTGPGKLPSRSSVSSRAESPTDEGVAPT 489          
BLAST of Synapsin vs. Ensembl Fly
Match: Syn (gene:FBgn0004575 transcript:FBtr0089475)

HSP 1 Score: 343.584 bits (880), Expect = 3.005e-104
Identity = 156/363 (42.98%), Postives = 242/363 (66.67%), Query Frame = 3
Query:  606 AASAKPTSSKGKCKTLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQSTCDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVA----NTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKMQIFCRPNIP-----KAESLHVMNRQNDSPINTSNPPT 1667
            A    P  SK K  TLL++D+ +TDWSKYFRGR++ GD+D R+EQAEF ++++VS ++ G  V +   +SGT+  RSF+PDF+++RQ   D + ++++ ++G  YGGVPS+NSLH+++   D+PW+++HL  ++ RLGR+ FPLIEQ ++P+ +++             TKFP V+K G+C  G    ++EN    QD A +V+ A    + + T EP+IDAK  V IQKIGNN+KAF+RKS++G+WKTN GSA+LEQ+ L +K+K W+ E+++LFGG+++C L  V +K+   +I     S   L+G+TQEEDR+ IA+L+  +MQ  CRP++      K  S   ++ + +SP +    PT
Sbjct:   77 ATQRAPAFSKDKYFTLLVLDDQNTDWSKYFRGRRLHGDFDIRVEQAEFRDITVVSSADTGPVVTMAAYRSGTRVARSFRPDFVLIRQPPRDGSSDYRSTILGLKYGGVPSINSLHSIYQFQDKPWVFSHLLQLQRRLGRDGFPLIEQTFFPNPRDLFQF----------TKFPSVLKAGHCHGGVATARLENQSALQDAAGLVSGAGNDSHCYCTIEPYIDAKFSVHIQKIGNNYKAFMRKSITGNWKTNQGSAMLEQITLTEKYKSWVDEISELFGGMEVCGLSVVVAKDGREYIISACDSTFALIGDTQEEDRRQIADLVSGRMQNVCRPSMAQTGPGKLPSRSSVSSRAESPTDEGVAPT 429          
BLAST of Synapsin vs. Ensembl Zebrafish
Match: syn2b (synapsin IIb [Source:ZFIN;Acc:ZDB-GENE-051127-49])

HSP 1 Score: 366.311 bits (939), Expect = 1.961e-115
Identity = 165/339 (48.67%), Postives = 249/339 (73.45%), Query Frame = 3
Query:  576 ITNTISRGFFAASA-----KPTSSKGKCKTLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQS--TCDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKM 1571
            ITN + +   AASA      P ++  K K LL+IDEP  DW+K FRG+K+ GD+D ++EQAEF+E+++V+++   C+VD+QV ++GTK +RSFKPDF++VRQ   +   NE+++N ++G  Y G+PS+NSL +++N+ D+PW +A L  V  ++G E FPL++Q +Y ++++MI   T          FP+V+KIG+  +G GK+KV+NH +FQDIASVVA+  T+ T+EPFIDAK D+ +QKIG ++KA++R S+SG+WK+NTGSA+LEQV + DK+KLW+   A +FGGL+ICA+KA+  K+ + +I EV GS+M L+GE Q EDR+LI  ++ +KM
Sbjct:   81 ITNVVKQT--AASAGLVEQSPATASRKFKILLVIDEPQNDWTKLFRGKKVQGDYDIKVEQAEFSEINLVAHANGTCSVDMQVIRNGTKVVRSFKPDFVLVRQHAYSMAQNEDFRNIIIGLQYAGIPSVNSLESIYNLCDKPWAFAQLISVYKKMGPEKFPLVDQTFYSNYRDMISMPT----------FPVVVKIGHAHSGMGKVKVDNHSDFQDIASVVAITQTYTTTEPFIDAKYDIRVQKIGFDYKAYMRTSISGNWKSNTGSAMLEQVAMTDKYKLWVDTCADVFGGLEICAVKAIHGKDGKDYITEVVGSSMPLIGEHQMEDRQLITAIVLAKM 407          
BLAST of Synapsin vs. Ensembl Zebrafish
Match: syn2a (synapsin IIa [Source:ZFIN;Acc:ZDB-GENE-040718-341])

HSP 1 Score: 356.295 bits (913), Expect = 1.602e-114
Identity = 170/373 (45.58%), Postives = 261/373 (69.97%), Query Frame = 3
Query:  561 SITGQITNTI-SRGFFAASAKPTSSKGKCKTLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQS--TCDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKMQ--IFCRPNIPKAESLHVMNRQNDSPINTSNPP 1664
            SIT  +  T  S G    ++ P SSK + K LL+IDEP  DW+K FRG+K+ GD+D ++EQAEF ++S+V+++   C V VQV ++  K +RSFKPDF+++RQ   +   NE+++N ++G  Y G+PS+NSL +++N+ D+PW +A L     +LG+E FPLIEQ +YP++KEM+          +P  FP+V+KIG+  +G GK+KVENH +FQDIASVVA+  T++T EPFID K D+ IQKIGN++KA++R S+SG+WK+NTG+A++EQV + D++KLW+    ++FGGL+ICA+KA+  K+ + +I EV GS+M L+GE Q +D++LIA+++ +KM   +   P  P A     +  +N++ +   N P
Sbjct:   73 SITNVVKQTAASAGLVEQTSVPASSK-RIKILLVIDEPQHDWAKLFRGKKLNGDYDIKVEQAEFGDISIVAHANGSCNVAVQVLQNENKVLRSFKPDFVLIRQHAFSMTENEDFRNLIIGLQYAGIPSINSLESVYNLCDKPWAFACLINTYKKLGQEKFPLIEQTFYPNYKEMV---------TMPA-FPVVVKIGHAHSGVGKVKVENHTKFQDIASVVAITQTYSTCEPFIDPKYDIRIQKIGNDYKAYMRTSVSGNWKSNTGTAMVEQVAMTDRYKLWVDTCCEIFGGLEICAVKAINGKDGKDYITEVMGSSMPLMGEHQAQDQQLIADMVIAKMNHVMAQNPKRPTAIQPKQITVENNTLVEVKNAP 434          
BLAST of Synapsin vs. Ensembl Zebrafish
Match: syn1 (synapsin I [Source:ZFIN;Acc:ZDB-GENE-081105-93])

HSP 1 Score: 352.058 bits (902), Expect = 2.187e-110
Identity = 152/314 (48.41%), Postives = 233/314 (74.20%), Query Frame = 3
Query:  636 GKCKTLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQS--TCDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKM 1571
            G  K LL+ID+  TDW+K F+G+K+ GD D ++EQA+F+EV++V+++    +VD++  +SG K  +  KPDF++VRQ   +   N + +N ++G  Y G+PS+NSLH+++N  D+PW+++ L  +  +LG E FPLI+Q YYP+HKEMI T            FP+V+K+G+  +G GK+KV+N ++FQDIASVVA+  T+ATSEPFIDAK D+ IQKIG N+KA++R S+SG+WKTNTGSA+LEQV ++D++++W+   +++FGGLDICA++A+  K+   +I EV G +M L+G+ Q+EDR L+A+L+ +KM
Sbjct:   89 GNAKILLVIDDQQTDWAKVFKGKKVHGDCDIKVEQADFSEVNLVAHATGSYSVDIEAIRSGNKITKCIKPDFVLVRQHAFSMAKNGDHRNIVIGLQYAGLPSVNSLHSVYNFCDKPWVFSQLSRLYKQLGPEEFPLIDQVYYPNHKEMITT----------PGFPVVVKMGHAHSGMGKVKVDNQYDFQDIASVVALTKTYATSEPFIDAKYDIRIQKIGENYKAYMRTSISGNWKTNTGSAMLEQVAMSDRYRMWVDVCSEVFGGLDICAVEALHGKDGRDYIIEVVGCSMPLIGDQQDEDRALMADLVVAKM 392          
BLAST of Synapsin vs. Ensembl Zebrafish
Match: syn1 (synapsin I [Source:ZFIN;Acc:ZDB-GENE-081105-93])

HSP 1 Score: 352.058 bits (902), Expect = 2.187e-110
Identity = 152/314 (48.41%), Postives = 233/314 (74.20%), Query Frame = 3
Query:  636 GKCKTLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQS--TCDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKM 1571
            G  K LL+ID+  TDW+K F+G+K+ GD D ++EQA+F+EV++V+++    +VD++  +SG K  +  KPDF++VRQ   +   N + +N ++G  Y G+PS+NSLH+++N  D+PW+++ L  +  +LG E FPLI+Q YYP+HKEMI T            FP+V+K+G+  +G GK+KV+N ++FQDIASVVA+  T+ATSEPFIDAK D+ IQKIG N+KA++R S+SG+WKTNTGSA+LEQV ++D++++W+   +++FGGLDICA++A+  K+   +I EV G +M L+G+ Q+EDR L+A+L+ +KM
Sbjct:   89 GNAKILLVIDDQQTDWAKVFKGKKVHGDCDIKVEQADFSEVNLVAHATGSYSVDIEAIRSGNKITKCIKPDFVLVRQHAFSMAKNGDHRNIVIGLQYAGLPSVNSLHSVYNFCDKPWVFSQLSRLYKQLGPEEFPLIDQVYYPNHKEMITT----------PGFPVVVKMGHAHSGMGKVKVDNQYDFQDIASVVALTKTYATSEPFIDAKYDIRIQKIGENYKAYMRTSISGNWKTNTGSAMLEQVAMSDRYRMWVDVCSEVFGGLDICAVEALHGKDGRDYIIEVVGCSMPLIGDQQDEDRALMADLVVAKM 392          
BLAST of Synapsin vs. Ensembl Xenopus
Match: syn3 (synapsin III [Source:NCBI gene;Acc:100170548])

HSP 1 Score: 343.199 bits (879), Expect = 2.109e-108
Identity = 148/313 (47.28%), Postives = 232/313 (74.12%), Query Frame = 3
Query:  639 KCKTLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQS--TCDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKM 1571
            K K LL+ID+PHTDW+KYFRG+K           AEF+E+++ +Y   GC VD+QV ++GTK ++SFKPDFL++RQ   +    E++++ ++G  YG +PS+NSL++++N   +PW+++ L  +  +LG + FPL++Q+++P+HK+M+   +          FP+V+K+G+   G GK+KV+N ++FQD+ASVVA+A T+ T+EPFID+K D+ IQKIGNN+KA++R S+SG+WK NTGSA+LEQ+ + D+++LW+   +++FGGLDICA+KAV SK+ + +I EV  S+M L+GE  EEDR L+A+L+ +KM
Sbjct:   92 KPKILLVIDDPHTDWAKYFRGKK-----------AEFSELNLAAYVNGGCMVDMQVMRNGTKVVKSFKPDFLLIRQHAYSMTLGEDFRSLVIGLQYGNLPSVNSLYSIYNFCSKPWVFSQLIKIFQKLGADKFPLVDQSFFPNHKQMLTAAS----------FPVVVKMGHAHAGMGKVKVDNQYDFQDMASVVAMAKTYVTTEPFIDSKYDIRIQKIGNNYKAYMRTSISGNWKANTGSAMLEQIAMTDRYRLWVDSCSEMFGGLDICAVKAVHSKDGKDYIIEVMDSSMPLIGEHVEEDRHLVADLVIAKM 383          
BLAST of Synapsin vs. Ensembl Xenopus
Match: syn3 (synapsin III [Source:NCBI gene;Acc:100170548])

HSP 1 Score: 326.25 bits (835), Expect = 1.388e-101
Identity = 145/314 (46.18%), Postives = 228/314 (72.61%), Query Frame = 3
Query:  639 KCKTLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQS--TCDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCR-NGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKM 1571
            K K LL+ID+PHTDW+KYFRG+K           AEF+E+++ +Y   GC VD+QV ++GTK ++SFKPDFL++RQ   +    E++++ ++G  YG +PS+NSL++++N   +PW+++ L  +  +LG + FPL++Q+++P+HK+M+    +            V+  G    +G+GK+KV+N ++FQD+ASVVA+A T+ T+EPFID+K D+ IQKIGNN+KA++R S+SG+WK NTGSA+LEQ+ + D+++LW+   +++FGGLDICA+KAV SK+ + +I EV  S+M L+GE  EEDR L+A+L+ +KM
Sbjct:   92 KPKILLVIDDPHTDWAKYFRGKK-----------AEFSELNLAAYVNGGCMVDMQVMRNGTKVVKSFKPDFLLIRQHAYSMTLGEDFRSLVIGLQYGNLPSVNSLYSIYNFCSKPWVFSQLIKIFQKLGADKFPLVDQSFFPNHKQMVSVAHVS----------YVLYNGMEEVSGQGKVKVDNQYDFQDMASVVAMAKTYVTTEPFIDSKYDIRIQKIGNNYKAYMRTSISGNWKANTGSAMLEQIAMTDRYRLWVDSCSEMFGGLDICAVKAVHSKDGKDYIIEVMDSSMPLIGEHVEEDRHLVADLVIAKM 384          
BLAST of Synapsin vs. Ensembl Xenopus
Match: osbpl1a (oxysterol binding protein like 1A [Source:Xenbase;Acc:XB-GENE-1011513])

HSP 1 Score: 199.134 bits (505), Expect = 3.922e-56
Identity = 90/166 (54.22%), Postives = 131/166 (78.92%), Query Frame = 3
Query: 1104 VVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKM-QIFCRPNIP 1598
             +PT FP+V+KIG+   G GK+KVENH++FQDIASVVA+  T+AT+EPFID+K D+ IQKIGNN+KA++R S+SG+WKT+ GSA+LEQV +++++KLW+   +++FGGLDICA+K V  K+ + +I EV    M ++G+ Q EDR+LIA+L+ +KM QI  +  +P
Sbjct:   47 AMPT-FPVVVKIGHAHAGMGKVKVENHYDFQDIASVVALTQTYATTEPFIDSKYDIRIQKIGNNYKAYMRTSMSGNWKTSAGSAMLEQVAMSERYKLWVDLCSEIFGGLDICAVKVVHGKDGKDYIMEVMDCTMPVIGDHQAEDRQLIADLVVNKMNQIRSKSPVP 211          
BLAST of Synapsin vs. Ensembl Xenopus
Match: osbpl1a (oxysterol binding protein like 1A [Source:Xenbase;Acc:XB-GENE-1011513])

HSP 1 Score: 184.496 bits (467), Expect = 7.488e-48
Identity = 77/138 (55.80%), Postives = 113/138 (81.88%), Query Frame = 3
Query: 1158 KGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKM 1571
            K ++KVENH++FQDIASVVA+  T+AT+EPFID+K D+ IQKIGNN+KA++R S+SG+WKT+ GSA+LEQV +++++KLW+   +++FGGLDICA+K V  K+ + +I EV    M ++G+ Q EDR+LIA+L+ +KM
Sbjct:  332 KSQVKVENHYDFQDIASVVALTQTYATTEPFIDSKYDIRIQKIGNNYKAYMRTSMSGNWKTSAGSAMLEQVAMSERYKLWVDLCSEIFGGLDICAVKVVHGKDGKDYIMEVMDCTMPVIGDHQAEDRQLIADLVVNKM 469          
BLAST of Synapsin vs. Ensembl Mouse
Match: Syn2 (synapsin II [Source:MGI Symbol;Acc:MGI:103020])

HSP 1 Score: 379.407 bits (973), Expect = 2.790e-123
Identity = 169/345 (48.99%), Postives = 258/345 (74.78%), Query Frame = 3
Query:  561 SITGQITNTISRGFFAASAKPTSSKGKCKTLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQST--CDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKM-QIFCR 1586
            S++  +  T +      +  P+++  K K LL++DEPHTDW+K FRG+KI GD+D ++EQAEF+E+++V++++    VD+QV ++GTK +RSF+PDF+++RQ       NE++++ ++G  Y G+PS+NSL +++N  D+PW++A +  +   LG E FPLIEQ YYP+H+EM+          +PT FP+V+KIG+  +G GK+KVENH++FQDIASVVA+  T+AT+EPFIDAK D+ +QKIGNN+KA++R S+SG+WKTNTGSA+LEQ+ ++D++KLW+   +++FGGLDICA+KAV  K+ + +I+EV   +M L+GE Q EDR+LI +L+ SKM Q+  R
Sbjct:   87 SLSQAVKQTAASAGLVDAPAPSAASRKAKVLLVVDEPHTDWAKCFRGKKILGDYDIKVEQAEFSELNLVAHADGTYAVDMQVLRNGTKVVRSFRPDFVLIRQHAFGMAENEDFRHLVIGMQYAGLPSINSLESIYNFCDKPWVFAQMVAIFKTLGGEKFPLIEQTYYPNHREML---------TLPT-FPVVVKIGHAHSGMGKVKVENHYDFQDIASVVALTQTYATAEPFIDAKYDIRVQKIGNNYKAYMRTSISGNWKTNTGSAMLEQIAMSDRYKLWVDACSEMFGGLDICAVKAVHGKDGKDYIFEVMDCSMPLIGEHQVEDRQLITDLVISKMNQLLSR 421          
BLAST of Synapsin vs. Ensembl Mouse
Match: Syn2 (synapsin II [Source:MGI Symbol;Acc:MGI:103020])

HSP 1 Score: 379.407 bits (973), Expect = 2.790e-123
Identity = 169/345 (48.99%), Postives = 258/345 (74.78%), Query Frame = 3
Query:  561 SITGQITNTISRGFFAASAKPTSSKGKCKTLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQST--CDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKM-QIFCR 1586
            S++  +  T +      +  P+++  K K LL++DEPHTDW+K FRG+KI GD+D ++EQAEF+E+++V++++    VD+QV ++GTK +RSF+PDF+++RQ       NE++++ ++G  Y G+PS+NSL +++N  D+PW++A +  +   LG E FPLIEQ YYP+H+EM+          +PT FP+V+KIG+  +G GK+KVENH++FQDIASVVA+  T+AT+EPFIDAK D+ +QKIGNN+KA++R S+SG+WKTNTGSA+LEQ+ ++D++KLW+   +++FGGLDICA+KAV  K+ + +I+EV   +M L+GE Q EDR+LI +L+ SKM Q+  R
Sbjct:   87 SLSQAVKQTAASAGLVDAPAPSAASRKAKVLLVVDEPHTDWAKCFRGKKILGDYDIKVEQAEFSELNLVAHADGTYAVDMQVLRNGTKVVRSFRPDFVLIRQHAFGMAENEDFRHLVIGMQYAGLPSINSLESIYNFCDKPWVFAQMVAIFKTLGGEKFPLIEQTYYPNHREML---------TLPT-FPVVVKIGHAHSGMGKVKVENHYDFQDIASVVALTQTYATAEPFIDAKYDIRVQKIGNNYKAYMRTSISGNWKTNTGSAMLEQIAMSDRYKLWVDACSEMFGGLDICAVKAVHGKDGKDYIFEVMDCSMPLIGEHQVEDRQLITDLVISKMNQLLSR 421          
BLAST of Synapsin vs. Ensembl Mouse
Match: Syn2 (synapsin II [Source:MGI Symbol;Acc:MGI:103020])

HSP 1 Score: 382.104 bits (980), Expect = 8.923e-123
Identity = 169/345 (48.99%), Postives = 258/345 (74.78%), Query Frame = 3
Query:  561 SITGQITNTISRGFFAASAKPTSSKGKCKTLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQST--CDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKM-QIFCR 1586
            S++  +  T +      +  P+++  K K LL++DEPHTDW+K FRG+KI GD+D ++EQAEF+E+++V++++    VD+QV ++GTK +RSF+PDF+++RQ       NE++++ ++G  Y G+PS+NSL +++N  D+PW++A +  +   LG E FPLIEQ YYP+H+EM+          +PT FP+V+KIG+  +G GK+KVENH++FQDIASVVA+  T+AT+EPFIDAK D+ +QKIGNN+KA++R S+SG+WKTNTGSA+LEQ+ ++D++KLW+   +++FGGLDICA+KAV  K+ + +I+EV   +M L+GE Q EDR+LI +L+ SKM Q+  R
Sbjct:   87 SLSQAVKQTAASAGLVDAPAPSAASRKAKVLLVVDEPHTDWAKCFRGKKILGDYDIKVEQAEFSELNLVAHADGTYAVDMQVLRNGTKVVRSFRPDFVLIRQHAFGMAENEDFRHLVIGMQYAGLPSINSLESIYNFCDKPWVFAQMVAIFKTLGGEKFPLIEQTYYPNHREML---------TLPT-FPVVVKIGHAHSGMGKVKVENHYDFQDIASVVALTQTYATAEPFIDAKYDIRVQKIGNNYKAYMRTSISGNWKTNTGSAMLEQIAMSDRYKLWVDACSEMFGGLDICAVKAVHGKDGKDYIFEVMDCSMPLIGEHQVEDRQLITDLVISKMNQLLSR 421          
BLAST of Synapsin vs. Ensembl Mouse
Match: Syn1 (synapsin I [Source:MGI Symbol;Acc:MGI:98460])

HSP 1 Score: 364.77 bits (935), Expect = 3.316e-115
Identity = 153/310 (49.35%), Postives = 240/310 (77.42%), Query Frame = 3
Query:  648 TLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQS--TCDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKM 1571
             LL+IDEPHTDW+KYF+G+KI G+ D ++EQAEF+++++V+++  G +VD++V ++G K +RS KPDF+++RQ   +   N ++++ ++G  Y G+PS+NSLH+++N  D+PW++A +  +  +LG E FPLI+Q +YP+HKEM+ + T          +P+V+K+G+  +G GK+KV+N  +FQDIASVVA+  T+AT+EPFIDAK DV +QKIG N+KA++R S+SG+WKTNTGSA+LEQ+ ++D++KLW+   +++FGGLDICA++A+  K+   HI EV GS+M L+G+ Q+ED++LI EL+ +KM
Sbjct:  115 VLLVIDEPHTDWAKYFKGKKIHGEIDIKVEQAEFSDLNLVAHANGGFSVDMEVLRNGVKVVRSLKPDFVLIRQHAFSMARNGDYRSLVIGLQYAGIPSVNSLHSVYNFCDKPWVFAQMVRLHKKLGTEEFPLIDQTFYPNHKEMLSSTT----------YPVVVKMGHAHSGMGKVKVDNQHDFQDIASVVALTKTYATAEPFIDAKYDVRVQKIGQNYKAYMRTSVSGNWKTNTGSAMLEQIAMSDRYKLWVDTCSEIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKM 414          
BLAST of Synapsin vs. Ensembl Mouse
Match: Syn1 (synapsin I [Source:MGI Symbol;Acc:MGI:98460])

HSP 1 Score: 364.385 bits (934), Expect = 1.167e-114
Identity = 153/310 (49.35%), Postives = 240/310 (77.42%), Query Frame = 3
Query:  648 TLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQS--TCDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKM 1571
             LL+IDEPHTDW+KYF+G+KI G+ D ++EQAEF+++++V+++  G +VD++V ++G K +RS KPDF+++RQ   +   N ++++ ++G  Y G+PS+NSLH+++N  D+PW++A +  +  +LG E FPLI+Q +YP+HKEM+ + T          +P+V+K+G+  +G GK+KV+N  +FQDIASVVA+  T+AT+EPFIDAK DV +QKIG N+KA++R S+SG+WKTNTGSA+LEQ+ ++D++KLW+   +++FGGLDICA++A+  K+   HI EV GS+M L+G+ Q+ED++LI EL+ +KM
Sbjct:  115 VLLVIDEPHTDWAKYFKGKKIHGEIDIKVEQAEFSDLNLVAHANGGFSVDMEVLRNGVKVVRSLKPDFVLIRQHAFSMARNGDYRSLVIGLQYAGIPSVNSLHSVYNFCDKPWVFAQMVRLHKKLGTEEFPLIDQTFYPNHKEMLSSTT----------YPVVVKMGHAHSGMGKVKVDNQHDFQDIASVVALTKTYATAEPFIDAKYDVRVQKIGQNYKAYMRTSVSGNWKTNTGSAMLEQIAMSDRYKLWVDTCSEIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKM 414          
BLAST of Synapsin vs. UniProt/SwissProt
Match: sp|Q6QM28|SYN_HELPO (Synapsin OS=Helix pomatia OX=6536 GN=SYN PE=1 SV=1)

HSP 1 Score: 392.504 bits (1007), Expect = 2.937e-127
Identity = 175/337 (51.93%), Postives = 255/337 (75.67%), Query Frame = 3
Query:  585 TISRGFFAASA--KPTSSKGKCKTLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQSTCDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKMQIFCRP 1589
            TI +  F+ +   KP S K + KTLL+ID  HTDWSKYF+G+K+FGDWD ++EQAEF+E+++ S SE G TV++Q  ++G K+ RS KPDFL++RQ   DA  +W++ L+GF YGGVPS+NSL A FN  D+PW++A L  ++ RL ++ FPLI+Q Y+ +H+EM+ +           KFP+V+KIG+   G GKIKV+N    +D+ASV+A  +++AT+EPFID+K D+ +QKIG N+KA+LRKS++G+WK NTGSA+LEQ+P++++FKLW  E ++LFGGLD+ +++A+Q K+   HI EV GS+M LLGE QEEDR+LI+E++ +KMQ+ C+P
Sbjct:   51 TIGQKLFSGTVGVKPVS-KDRYKTLLVIDGQHTDWSKYFKGKKLFGDWDVKVEQAEFSELNLASNSETGTTVEIQAIRNGNKTTRSLKPDFLLIRQHVRDAKVDWRHLLLGFRYGGVPSINSLTAEFNFLDKPWVFAQLIDIQKRLSKDVFPLIDQTYFSNHEEMLNS----------PKFPLVVKIGHAHRGLGKIKVDNVQTLEDLASVMATMSSYATTEPFIDSKYDIHVQKIGTNYKAYLRKSIAGNWKANTGSAMLEQIPMDERFKLWADECSQLFGGLDVVSVEAIQGKDGRDHIIEVNGSSMALLGEAQEEDRRLISEMVMAKMQMMCKP 376          
BLAST of Synapsin vs. UniProt/SwissProt
Match: sp|Q64332|SYN2_MOUSE (Synapsin-2 OS=Mus musculus OX=10090 GN=Syn2 PE=1 SV=2)

HSP 1 Score: 382.104 bits (980), Expect = 6.241e-122
Identity = 169/345 (48.99%), Postives = 258/345 (74.78%), Query Frame = 3
Query:  561 SITGQITNTISRGFFAASAKPTSSKGKCKTLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQST--CDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKM-QIFCR 1586
            S++  +  T +      +  P+++  K K LL++DEPHTDW+K FRG+KI GD+D ++EQAEF+E+++V++++    VD+QV ++GTK +RSF+PDF+++RQ       NE++++ ++G  Y G+PS+NSL +++N  D+PW++A +  +   LG E FPLIEQ YYP+H+EM+          +PT FP+V+KIG+  +G GK+KVENH++FQDIASVVA+  T+AT+EPFIDAK D+ +QKIGNN+KA++R S+SG+WKTNTGSA+LEQ+ ++D++KLW+   +++FGGLDICA+KAV  K+ + +I+EV   +M L+GE Q EDR+LI +L+ SKM Q+  R
Sbjct:   87 SLSQAVKQTAASAGLVDAPAPSAASRKAKVLLVVDEPHTDWAKCFRGKKILGDYDIKVEQAEFSELNLVAHADGTYAVDMQVLRNGTKVVRSFRPDFVLIRQHAFGMAENEDFRHLVIGMQYAGLPSINSLESIYNFCDKPWVFAQMVAIFKTLGGEKFPLIEQTYYPNHREML---------TLPT-FPVVVKIGHAHSGMGKVKVENHYDFQDIASVVALTQTYATAEPFIDAKYDIRVQKIGNNYKAYMRTSISGNWKTNTGSAMLEQIAMSDRYKLWVDACSEMFGGLDICAVKAVHGKDGKDYIFEVMDCSMPLIGEHQVEDRQLITDLVISKMNQLLSR 421          
BLAST of Synapsin vs. UniProt/SwissProt
Match: sp|Q63537|SYN2_RAT (Synapsin-2 OS=Rattus norvegicus OX=10116 GN=Syn2 PE=1 SV=1)

HSP 1 Score: 381.333 bits (978), Expect = 8.967e-122
Identity = 169/345 (48.99%), Postives = 258/345 (74.78%), Query Frame = 3
Query:  561 SITGQITNTISRGFFAASAKPTSSKGKCKTLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQST--CDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKM-QIFCR 1586
            S++  +  T +      +  P+++  K K LL++DEPHTDW+K FRG+KI GD+D ++EQAEF+E+++V++++    VD+QV ++GTK +RSF+PDF+++RQ       NE++++ ++G  Y G+PS+NSL +++N  D+PW++A +  +   LG E FPLIEQ YYP+H+EM+          +PT FP+V+KIG+  +G GK+KVENH++FQDIASVVA+  T+AT+EPFIDAK D+ +QKIGNN+KA++R S+SG+WKTNTGSA+LEQ+ ++D++KLW+   +++FGGLDICA+KAV  K+ + +I+EV   +M L+GE Q EDR+LI +L+ SKM Q+  R
Sbjct:   87 SLSQAVKQTAASAGLVDAPAPSAASRKAKVLLVVDEPHTDWAKCFRGKKILGDYDIKVEQAEFSELNLVAHADGTYAVDMQVLRNGTKVVRSFRPDFVLIRQHAFGMAENEDFRHLVIGMQYAGLPSINSLESIYNFCDKPWVFAQMVAIFKTLGGEKFPLIEQTYYPNHREML---------TLPT-FPVVVKIGHAHSGMGKVKVENHYDFQDIASVVALTQTYATAEPFIDAKYDIRVQKIGNNYKAYMRTSISGNWKTNTGSAMLEQIAMSDRYKLWVDACSEMFGGLDICAVKAVHGKDGKDYIFEVMDCSMPLIGEHQVEDRQLITDLVISKMNQLLSR 421          
BLAST of Synapsin vs. UniProt/SwissProt
Match: sp|Q92777|SYN2_HUMAN (Synapsin-2 OS=Homo sapiens OX=9606 GN=SYN2 PE=2 SV=4)

HSP 1 Score: 377.096 bits (967), Expect = 3.462e-120
Identity = 166/319 (52.04%), Postives = 246/319 (77.12%), Query Frame = 3
Query:  639 KCKTLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQST--CDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKM-QIFCR 1586
            K K LL++DEPH DW+K FRG+K+ GD+D ++EQAEF+E+++V++++    VD+QV ++GTK +RSF+PDF+++RQ       NE++++ ++G  Y G+PS+NSL +++N  D+PW++A L  +   LG E FPLIEQ YYP+HKEM+          +PT FP+V+KIG+  +G GK+KVENH++FQDIASVVA+  T+AT+EPFID+K D+ +QKIGNN+KA++R S+SG+WKTNTGSA+LEQ+ ++D++KLW+   +++FGGLDICA+KAV  K+ + +I+EV   +M L+GE Q EDR+LI EL+ SKM Q+  R
Sbjct:  112 KAKVLLVVDEPHADWAKCFRGKKVLGDYDIKVEQAEFSELNLVAHADGTYAVDMQVLRNGTKVVRSFRPDFVLIRQHAFGMAENEDFRHLIIGMQYAGLPSINSLESIYNFCDKPWVFAQLVAIYKTLGGEKFPLIEQTYYPNHKEML---------TLPT-FPVVVKIGHAHSGMGKVKVENHYDFQDIASVVALTQTYATAEPFIDSKYDIRVQKIGNNYKAYMRTSISGNWKTNTGSAMLEQIAMSDRYKLWVDTCSEMFGGLDICAVKAVHGKDGKDYIFEVMDCSMPLIGEHQVEDRQLITELVISKMNQLLSR 420          
BLAST of Synapsin vs. UniProt/SwissProt
Match: sp|P17600|SYN1_HUMAN (Synapsin-1 OS=Homo sapiens OX=9606 GN=SYN1 PE=1 SV=3)

HSP 1 Score: 364.385 bits (934), Expect = 7.785e-114
Identity = 153/310 (49.35%), Postives = 240/310 (77.42%), Query Frame = 3
Query:  648 TLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQS--TCDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKM 1571
             LL+IDEPHTDW+KYF+G+KI G+ D ++EQAEF+++++V+++  G +VD++V ++G K +RS KPDF+++RQ   +   N ++++ ++G  Y G+PS+NSLH+++N  D+PW++A +  +  +LG E FPLI+Q +YP+HKEM+ + T          +P+V+K+G+  +G GK+KV+N  +FQDIASVVA+  T+AT+EPFIDAK DV +QKIG N+KA++R S+SG+WKTNTGSA+LEQ+ ++D++KLW+   +++FGGLDICA++A+  K+   HI EV GS+M L+G+ Q+ED++LI EL+ +KM
Sbjct:  115 VLLVIDEPHTDWAKYFKGKKIHGEIDIKVEQAEFSDLNLVAHANGGFSVDMEVLRNGVKVVRSLKPDFVLIRQHAFSMARNGDYRSLVIGLQYAGIPSVNSLHSVYNFCDKPWVFAQMVRLHKKLGTEEFPLIDQTFYPNHKEMLSSTT----------YPVVVKMGHAHSGMGKVKVDNQHDFQDIASVVALTKTYATAEPFIDAKYDVRVQKIGQNYKAYMRTSVSGNWKTNTGSAMLEQIAMSDRYKLWVDTCSEIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKM 414          
BLAST of Synapsin vs. TrEMBL
Match: A0A075A0T9 (ATP-grasp domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_00821 PE=4 SV=1)

HSP 1 Score: 470.315 bits (1209), Expect = 6.341e-151
Identity = 235/503 (46.72%), Postives = 322/503 (64.02%), Query Frame = 3
Query:  258 IAMFGYLKRRFSSGDLQDEAADQREQEGLPSFL--------------------------NPFNANPQPSKPNQPVNNNI-------NRMQQ----RPTSTEPSIANTAPTHRXXXXXXXXXXXXXXXXXGFSAAPMVESITGQITNTISRGFFAASA--------KPTSSKGKCKTLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQSTCDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKMQIFCRPN-IPKAESLHVMNR 1628
            + M  +LKRRFSSGDLQ EAAD+REQEGLPSFL                           P+    QP     P+ N +       NR  Q    R  +T+ S  N A + R          +     SG    PM  +ITG I++TI RGF  A++        + TS+K K K LL+ID+  TDW KYF+GRK+ GDWD R+EQA F+E++M +YSE GC +++    + TK +RSFKPDF+++RQ +  ANE+W+  L G +Y G P +N+LHA++NM +RPW++AHL L+RNRLG+E FPLI Q Y+ SHKEM          V    FP +IK+G    G+GKI+ +N   +QD+ S++A  NT+AT+EPFIDAKCDV +QKIG  +KAF+RKS+SG WK+N GS+ILE+VP+N++FK W+ EVA++FGGLDIC+++A+QSK  E+ IY+V GS+MNL GE+QEEDR+ IAE++  +MQ  C  N + KA SL  ++R
Sbjct:    1 MEMITFLKRRFSSGDLQGEAADKREQEGLPSFLRFGTTAPSGPQAQPNQTFQSNSIQQQTPYRTQDQPVPAAGPLTNAVSQIPPGTNRPSQGQYVRTGTTDESSTNVARS-RGAYPSAPTSPARGYGGSGSFMGPM-SNITGHISSTIMRGFSTAASTAHSMAAGRSTSTKEKQKVLLVIDDSQTDWCKYFKGRKLLGDWDLRVEQANFSEITMTAYSERGCVINIYQGLNQTKPVRSFKPDFVLLRQHSSGANEDWQPILTGLMYAGTPCMNTLHAVYNMKNRPWLFAHLLLLRNRLGKEAFPLITQVYHTSHKEM----------VTAPAFPTIIKVGLGHGGEGKIRTDNLVAYQDVTSLLAAGNTYATTEPFIDAKCDVHVQKIGPQYKAFVRKSISGHWKSNIGSSILEKVPMNERFKQWVDEVARMFGGLDICSIEALQSKTGEYFIYDVNGSDMNLFGESQEEDRREIAEIVVQRMQTVCMQNSLTKASSLQSVSR 491          

HSP 2 Score: 65.855 bits (159), Expect = 3.639e-7
Identity = 31/54 (57.41%), Postives = 39/54 (72.22%), Query Frame = 3
Query: 2031 GPP-----NKVGSQPNRPTIPPRQTSLKSNASVDDGDDTMKNLRKTFAGIFGDM 2177
            GPP     N+  +  ++P +PPRQTSL+  +  +D DDTMKNLRKTFAGIFGDM
Sbjct:  735 GPPISSTQNQDSAVADKPFVPPRQTSLRRGSGAEDTDDTMKNLRKTFAGIFGDM 788          
BLAST of Synapsin vs. TrEMBL
Match: G7Y5I4 (Synapsin-3 OS=Clonorchis sinensis OX=79923 GN=CLF_101332 PE=4 SV=1)

HSP 1 Score: 466.463 bits (1199), Expect = 1.660e-149
Identity = 238/506 (47.04%), Postives = 326/506 (64.43%), Query Frame = 3
Query:  258 IAMFGYLKRRFSSGDLQDEAADQREQEGLPSFLN-----PFNANPQPSK---------------PNQ------PVNNNI-------NRMQQ----RPTSTEPSIANTAPTHRXXXXXXXXXXXXXXXXXGFSAAPMVESITGQITNTISRGFFAASA--------KPTSSKGKCKTLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQSTCDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKMQIFCRPN-IPKAESLHVMNRQND 1637
            + M  +LKRRFSSGDLQ EAAD+REQEGLPSFL      P     QP++               P+Q      P  N +       NR  Q    R  +T+ S  N A   R          + +   SG    PM  +ITG I++TI RGF  A++        + TS+K K K LL+ID+  TDW KYF+GRK+ GDWD R+EQA F+E++M +YSE GC +++    + TK +RSFKPDF+++RQ +  ANE+W+  L G +Y G P +N+LHA++NM +RPW++AHL L+RNRLG+E FPLI Q Y+ SHKEM          V    FP +IKIG    G+GKI+ +N   +QD+ S++A   ++AT+EPFIDAKCDV +QKIG  +KAF+RKS+SG WK+NTGS+ILE+VP+N++FK W+ EVA++FGGLDIC+++A+QSK  E+ IY+V GS+MNL GE+QEEDR+ IAEL+  +MQ  C  N + KA SL  ++R  +
Sbjct:    1 MEMITFLKRRFSSGDLQGEAADKREQEGLPSFLRFGTTAPSGPQAQPNQTFQSNSIQQQTPYRTPDQSVPAAGPPTNAVSQIPPGTNRPSQGQYTRTGTTDESSTNVA-RGRGAYPSAPTSPTRSYGGSGSFMGPM-SNITGHISSTIMRGFSTAASTAHSMAAGRSTSTKEKQKVLLVIDDSQTDWCKYFKGRKLLGDWDLRVEQANFSEITMTAYSERGCVINIYQGLNQTKPVRSFKPDFVLLRQHSSGANEDWQPILTGLMYAGTPCMNTLHAVYNMKNRPWLFAHLLLLRNRLGKEAFPLITQVYHTSHKEM----------VTAPAFPTIIKIGLGHGGEGKIRTDNLVAYQDVTSLLAAGKSYATTEPFIDAKCDVHVQKIGPQYKAFVRKSISGHWKSNTGSSILEKVPMNERFKQWVDEVARMFGGLDICSVEALQSKTGEYFIYDVNGSDMNLFGESQEEDRREIAELVVQRMQTVCTQNSLTKASSLQSVSRAGE 494          

HSP 2 Score: 64.6994 bits (156), Expect = 7.537e-7
Identity = 27/39 (69.23%), Postives = 33/39 (84.62%), Query Frame = 3
Query: 2061 NRPTIPPRQTSLKSNASVDDGDDTMKNLRKTFAGIFGDM 2177
            ++P +PPRQTSL+  +  +D DDTMKNLRKTFAGIFGDM
Sbjct:  750 DKPFVPPRQTSLRRGSGAEDTDDTMKNLRKTFAGIFGDM 788          
BLAST of Synapsin vs. TrEMBL
Match: O76322 (Synapsin s-syn-short (Fragment) OS=Doryteuthis pealeii OX=1051067 PE=2 SV=1)

HSP 1 Score: 448.743 bits (1153), Expect = 5.313e-147
Identity = 194/335 (57.91%), Postives = 270/335 (80.60%), Query Frame = 3
Query:  588 ISRGFFAASAKPTSSKGKCKTLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQSTCDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKMQIFCRPN 1592
            I++G F+   K + +K +CKTLL+ID+PHTDWSKYFRG+KIFGDWD R+EQ EF+E+++ +Y++ G  VD+QV ++GT+ +RSFKPDF++VRQ   DA+E+W+N +MGF YGG+PSLNS H+++N  D+PW  AHL  ++ ++G ENFPLIEQAYYP+HKEM++T           KFP+V+KIG+  +G GK+KV++H  FQDIASVVAV  ++AT+EP+ID KCD+ +QKIGNN+KAFLRKS+SG+WK NTGSA+LEQ+ +N+K+KLW+ E ++LFGGLDI A++A+Q K+   +I EV  S+M LLGETQEEDR+LIAE++  KM ++C+PN
Sbjct:   75 IAKGVFSG-PKASVNKDRCKTLLVIDDPHTDWSKYFRGKKIFGDWDLRVEQVEFHEINLAAYTDQGTMVDIQVMRNGTRVVRSFKPDFVLVRQHVRDASEDWRNLIMGFHYGGIPSLNSFHSIYNFQDKPWTMAHLIQIQKKVGAENFPLIEQAYYPNHKEMLVT----------PKFPVVVKIGHAHSGMGKVKVDHHHAFQDIASVVAVTKSYATTEPYIDCKCDIHVQKIGNNYKAFLRKSISGNWKANTGSAMLEQIQMNEKYKLWVDECSQLFGGLDIVAVEALQGKDGREYIIEVNDSSMALLGETQEEDRRLIAEMVLQKMHMYCKPN 398          
BLAST of Synapsin vs. TrEMBL
Match: O76323 (Synapsin s-syn-long (Fragment) OS=Doryteuthis pealeii OX=1051067 PE=2 SV=1)

HSP 1 Score: 449.899 bits (1156), Expect = 6.848e-147
Identity = 194/335 (57.91%), Postives = 270/335 (80.60%), Query Frame = 3
Query:  588 ISRGFFAASAKPTSSKGKCKTLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQSTCDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKMQIFCRPN 1592
            I++G F+   K + +K +CKTLL+ID+PHTDWSKYFRG+KIFGDWD R+EQ EF+E+++ +Y++ G  VD+QV ++GT+ +RSFKPDF++VRQ   DA+E+W+N +MGF YGG+PSLNS H+++N  D+PW  AHL  ++ ++G ENFPLIEQAYYP+HKEM++T           KFP+V+KIG+  +G GK+KV++H  FQDIASVVAV  ++AT+EP+ID KCD+ +QKIGNN+KAFLRKS+SG+WK NTGSA+LEQ+ +N+K+KLW+ E ++LFGGLDI A++A+Q K+   +I EV  S+M LLGETQEEDR+LIAE++  KM ++C+PN
Sbjct:   75 IAKGVFSG-PKASVNKDRCKTLLVIDDPHTDWSKYFRGKKIFGDWDLRVEQVEFHEINLAAYTDQGTMVDIQVMRNGTRVVRSFKPDFVLVRQHVRDASEDWRNLIMGFHYGGIPSLNSFHSIYNFQDKPWTMAHLIQIQKKVGAENFPLIEQAYYPNHKEMLVT----------PKFPVVVKIGHAHSGMGKVKVDHHHAFQDIASVVAVTKSYATTEPYIDCKCDIHVQKIGNNYKAFLRKSISGNWKANTGSAMLEQIQMNEKYKLWVDECSQLFGGLDIVAVEALQGKDGREYIIEVNDSSMALLGETQEEDRRLIAEMVLQKMHMYCKPN 398          
BLAST of Synapsin vs. TrEMBL
Match: G4VIG8 (Putative synapsin OS=Schistosoma mansoni OX=6183 GN=Smp_126990 PE=4 SV=1)

HSP 1 Score: 456.833 bits (1174), Expect = 7.209e-146
Identity = 224/503 (44.53%), Postives = 316/503 (62.82%), Query Frame = 3
Query:  264 MFGYLKRRFSSGDLQDEAADQREQEGLPSFL--------------------------NPFNANPQPSKPNQPVNNNINRMQQRPTSTE----PSIANTAPTH-----RXXXXXXXXXXXXXXXXXGFSAAPM--VESITGQITNTISRGFFAASAKPTSSKGKC------KTLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQSTCDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKMQ-IFCRPNIPKAESLHVMNRQNDS 1640
            M  YLKRRFSSGDLQ E AD+R QEGLPSFL                          + ++  PQ      P N ++      PT  E       A TA  H             +  +    + G  A+ M  + S+TGQI+NT+ R F  A++   +  GK       K LL+ID+  TDW KYFRG+K+ GDW+ ++EQA+F+E+S+ +YSE GC V +  D+  +K ++SFKPDF++VRQ   D  ENW+  L G +YGG P +N+LHA++NM +RPW++AHL ++RNRLG+ENFPLI Q Y+ S+KEM           V   FP+++K+G    G+GK+K +  F +QD+ S++    T+AT+EPFIDA CD+ +QKIG N+KAF+RK++SG+WK+NTGSA+LE+VP+NDKFKLWI EV++LFGGLDIC++ A+QS++ E+ IYE  GS+M L G++QE DR  IAEL+  +MQ I    +IPK  SL  + R +++
Sbjct:    1 MITYLKRRFSSGDLQGELADKRMQEGLPSFLRFGSSTQSGQSHQQYQQQSSNIQTTGHSYSNQPQDFSSTGPANYDMRYGSTAPTMAEQFSSSQTATTAANHIPGSVGRGRGAYPSAPTSPTRSMGLGASLMGPMGSLTGQISNTLMRSFNTAASTAQNISGKMSSKEHQKILLVIDDTQTDWCKYFRGKKLMGDWEIKVEQAQFSEISLTAYSEQGCVVSIYPDQIRSKPLKSFKPDFVLVRQHPSDLKENWQPILTGLMYGGTPCMNTLHAIYNMKNRPWLFAHLLMIRNRLGKENFPLISQTYHTSYKEM----------AVAPAFPVIVKVGVGHRGEGKVKADTPFIYQDLVSLMISGQTYATTEPFIDANCDLHVQKIGTNYKAFMRKAISGNWKSNTGSALLEKVPMNDKFKLWIDEVSRLFGGLDICSIDALQSRSGEYFIYEANGSDMTLYGDSQESDRTEIAELVMQRMQSITYSSSIPKVPSLQTIGRTSET 493          

HSP 2 Score: 71.2478 bits (173), Expect = 8.184e-9
Identity = 31/48 (64.58%), Postives = 39/48 (81.25%), Query Frame = 3
Query: 2034 PPNKVGSQPNRPTIPPRQTSLKSNASVDDGDDTMKNLRKTFAGIFGDM 2177
            P ++  S P+RP +PPRQTSL++  S +D DDTMKNLRKTFAGIFGD+
Sbjct:  732 PTSQTTSGPDRPDVPPRQTSLRTGPSSEDTDDTMKNLRKTFAGIFGDL 779          
BLAST of Synapsin vs. Ensembl Cavefish
Match: syn2b (synapsin-2 [Source:NCBI gene;Acc:103031721])

HSP 1 Score: 374.015 bits (959), Expect = 5.188e-118
Identity = 169/350 (48.29%), Postives = 252/350 (72.00%), Query Frame = 3
Query:  573 QITNTISRGFF----------AASA-----KPTSSKGKCKTLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQS--TCDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKM 1571
            Q   + S GFF          AASA      P     K K LL+IDEP  +W+K FRG+K+ GD+D R+EQAEF+E+++V+++   C+VD+QV ++GTK +RSFKPDF++VRQ   +   NE+++N ++G  Y G+PS+NSL +++N+ D+PW +A L     +LG E FPLIEQ +YP++++MI   T          FP+V+KIG+  +G GK+K++NH +FQDIASVVA+  T+ T+EPFIDAK D+ +QKIG+++KA++R S+SG+WK+NTGSA+LEQV + +K+KLW+   +++FGGL+ICA+KA+  K+ + +I EV GS+M L+GE Q EDR+LIAE++ +KM
Sbjct:   89 QPAQSTSSGFFSSITNVVKQTAASAGLVEQSPAQMSKKFKILLVIDEPQHEWAKVFRGKKVQGDFDIRVEQAEFSEINLVAHANGSCSVDMQVIRNGTKVVRSFKPDFVLVRQHAYSMTQNEDFRNMIIGLQYAGIPSVNSLESIYNLCDKPWAFAQLISTYKKLGPEKFPLIEQTFYPNYRDMISMPT----------FPVVVKIGHAHSGMGKVKIDNHNDFQDIASVVAITQTYTTTEPFIDAKYDIRVQKIGSDYKAYMRTSISGNWKSNTGSAMLEQVAMTEKYKLWVDVCSEIFGGLEICAVKAIHGKDGKDYITEVVGSSMQLIGEHQAEDRQLIAEVVLAKM 428          
BLAST of Synapsin vs. Ensembl Cavefish
Match: SYN3 (synapsin III [Source:HGNC Symbol;Acc:HGNC:11496])

HSP 1 Score: 349.747 bits (896), Expect = 3.191e-111
Identity = 154/313 (49.20%), Postives = 235/313 (75.08%), Query Frame = 3
Query:  639 KCKTLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQS--TCDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKM 1571
            K K LL+ID+ HTDW+KYFRGRK+ G+++ R+EQAEF+E+++ +   +GCTVD+QV + GTK +RS KPDF+++RQ   +    E++++ ++G  YGGV S+NSLH+++N   +PW+++H+  + + LG E FPL EQ ++P+H +M+ T            FP+V+K+G+   G GKIKVEN  +FQDI SVVA+A T+AT+EPF+++K D+ IQKIG+N+KA++R S+SG+WK NTGSA+LEQ+ + D+++LW+   A++FGGLDICA+KAV  K+ + +I EV  S+M L+GE  EED++LI +L+ +KM
Sbjct:  109 KPKVLLVIDDAHTDWAKYFRGRKLNGEYEIRVEQAEFSEINLAANVNNGCTVDMQVTRGGTKVVRSVKPDFVLIRQHAFSMTPGEDFRSLVIGLQYGGVASINSLHSIYNFCSKPWVFSHMIKLYHALGPEKFPLNEQTFFPNHTQMLPT----------PAFPVVVKMGHAHAGMGKIKVENPNDFQDITSVVALAKTYATAEPFVESKYDIRIQKIGSNYKAYMRTSISGNWKANTGSAMLEQIAMTDRYRLWVDSCAEMFGGLDICAVKAVHGKDGKDYIIEVMDSSMPLIGEHAEEDKQLITDLVLNKM 411          
BLAST of Synapsin vs. Ensembl Cavefish
Match: syn1 (synapsin-1 [Source:NCBI gene;Acc:103031680])

HSP 1 Score: 349.747 bits (896), Expect = 5.925e-110
Identity = 151/317 (47.63%), Postives = 234/317 (73.82%), Query Frame = 3
Query:  627 SSKGKCKTLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQS--TCDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKM 1571
            +S  + K LL+ID+  TDW+K F+G+K+ G++D ++EQA+F+E+++V+++    +VD+   + G K  +SFKPDF++VRQ   +   N + +N ++G  Y G+  +NSLH+++N  D+PW++A +  +  +LG E FPLIEQ YYP+H+EMI T            FP+V+K+G+  +G GK+KV+N ++FQDIASVVA+  T+ATSEPFIDAK DV IQKIG+N+KA++R S+SG+WKTNTGSA+LEQV ++D+++ W+   + +FGGLD+CA++A+  K+ + +I EV G +M L+G+ Q+EDR LIA+L+ SKM
Sbjct:   84 ASSSQAKILLVIDDQQTDWAKVFKGKKVHGEFDIKVEQADFSEINLVAHATGSYSVDIDAIRGGHKITKSFKPDFVLVRQHAFSMAKNGDHRNIVIGLQYAGIAGVNSLHSVYNFCDKPWVFAQMSRLYKQLGPEEFPLIEQVYYPNHREMITT----------PGFPVVVKMGHAHSGMGKVKVDNQYDFQDIASVVALTKTYATSEPFIDAKYDVRIQKIGDNYKAYMRTSISGNWKTNTGSAMLEQVAMSDRYRKWVDWCSDVFGGLDMCAVEALHGKDGQDYIIEVVGCSMPLIGDQQDEDRSLIADLVVSKM 390          
BLAST of Synapsin vs. Ensembl Cavefish
Match: syn2a (synapsin IIa [Source:ZFIN;Acc:ZDB-GENE-040718-341])

HSP 1 Score: 337.806 bits (865), Expect = 1.155e-107
Identity = 160/339 (47.20%), Postives = 239/339 (70.50%), Query Frame = 3
Query:  576 ITNTISRGFFAASA-----KPTSSKGKCKTLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQSTCDANEN--WKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKM 1571
            ITN + +   AASA      P     + K LL+IDEP  +W     G+K+ GD+D ++EQAEF ++++VS++   C V +QV ++GT   R   PDF+++RQ      EN  ++N ++G  Y G+PS+NSL +++N+ D+PW +A L     RLG E FPLIEQ +YP+H+EM+          +PT FP+V+KIG+   G GK+KV+NH +FQDIASVVA+  T++TSEPFID+K D+ IQKIGN++KA++R S+SG+WK+NTG+A+LEQV + D++KLW+   ++LFGGLD+CA+KA+  K+ + +I +V GS+M L+G+ Q EDR+LIAE++ +KM
Sbjct:   71 ITNVVKQT--AASAGLVEQTPVPVSKRFKILLVIDEPQQEWYVCAVGKKLQGDYDIKVEQAEFRDLNVVSHANGTCNVAMQVLRNGT---RVVSPDFVLIRQHAFSMTENADFRNLIIGLQYAGIPSVNSLESIYNLCDKPWAFAQLISTHKRLGAEKFPLIEQTFYPNHREMV---------TMPT-FPVVVKIGHAHAGMGKVKVDNHTKFQDIASVVALTQTYSTSEPFIDSKYDIRIQKIGNDYKAYMRTSISGNWKSNTGTAMLEQVAMTDRYKLWVDACSELFGGLDLCAVKAIHGKDGKDYITDVVGSSMPLVGDHQAEDRQLIAEMVLAKM 394          
BLAST of Synapsin vs. Ensembl Cavefish
Match: syn1 (synapsin-1 [Source:NCBI gene;Acc:103031680])

HSP 1 Score: 312.768 bits (800), Expect = 5.259e-97
Identity = 157/354 (44.35%), Postives = 239/354 (67.51%), Query Frame = 3
Query:  627 SSKGKCKTLLIIDEPHTDWSKYFR-GRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQS--TCDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKM-QIFCRPNIPK-AESLHVMNRQNDSPINTSNPPTSA 1673
            +S  + K LL+ID+ H   +K    G  IF D  F+   A+F+E+++V+++    +VD+   + G K  +SFKPDF++VRQ   +   N + +N ++G  Y G+  +NSLH+++N  D+PW++A +  +  +LG E FPLIEQ YYP+H+EMI T            FP+V+K+G+  +G GK+KV+N ++FQDIASVVA+  T+ATSEPFIDAK DV IQKIG+N+KA++R S+SG+WKTNTGSA+LEQV ++D+++ W+   + +FGGLD+CA++A+  K+ + +I EV G +M L+G+ Q+EDR LIA+L+ SKM Q   R +    A+++   N QN  P     PP +A
Sbjct:   85 ASSSQAKILLVIDD-HPQIAKSATVGNHIFCDSVFK---ADFSEINLVAHATGSYSVDIDAIRGGHKITKSFKPDFVLVRQHAFSMAKNGDHRNIVIGLQYAGIAGVNSLHSVYNFCDKPWVFAQMSRLYKQLGPEEFPLIEQVYYPNHREMITT----------PGFPVVVKMGHAHSGMGKVKVDNQYDFQDIASVVALTKTYATSEPFIDAKYDVRIQKIGDNYKAYMRTSISGNWKTNTGSAMLEQVAMSDRYRKWVDWCSDVFGGLDMCAVEALHGKDGQDYIIEVVGCSMPLIGDQQDEDRSLIADLVVSKMNQTVPRTSAASPAKTVTSSNAQN-PPAQQPKPPNTA 423          
BLAST of Synapsin vs. Ensembl Sea Lamprey
Match: syn2a (synapsin IIa [Source:ZFIN;Acc:ZDB-GENE-040718-341])

HSP 1 Score: 374.4 bits (960), Expect = 5.681e-121
Identity = 164/359 (45.68%), Postives = 254/359 (70.75%), Query Frame = 3
Query:  540 SAAPMVESITGQITNTISRGFFAASAKPTSSKGKCKTLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQS--TCDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKM-QIFCRPNIPKAE 1607
            +AA +VE   G ++ +  R              K K LL+ID+  TDW+K+FRG+K+ G++D ++EQAEF+E+++ +Y + GCTVD+Q+ +SGTK +RS KPDF++VRQ   +   ++++++ ++G  YGGVP+LNSLH+++N   +PW+++ L  ++  LG E FPLIEQ Y+P+H+EM+ T T          FP+V+KIG+   G GK+KV+NH++FQD+ASVVA+  T+AT EP++D+K D+ IQKIG N+KA++R S+SG+WK NTGSA+LEQ+ + D++++WI   A+LFGGLD+C +KAV  K+   +I E+  S+M LLGE Q+EDR LI +L+ ++M Q+  R   P  +
Sbjct:  144 AAAGLVEQTAGSVSGSAGR--------------KSKVLLVIDDQQTDWAKFFRGKKVLGEYDVKVEQAEFSELNLAAYVDGGCTVDMQLYRSGTKVVRSLKPDFVLVRQPAYSMAGSQDYRSIVIGLQYGGVPTLNSLHSVYNFCSKPWVFSQLIRIQKSLGAEKFPLIEQTYFPNHREMLTTPT----------FPVVVKIGHAHAGVGKVKVDNHYDFQDVASVVALTKTYATVEPYVDSKYDIRIQKIGANYKAYMRTSISGNWKANTGSAMLEQIAMTDRYRMWIDTCAELFGGLDVCGVKAVHGKDGRDYIIEIMDSSMPLLGEHQDEDRALIVDLVVARMNQVLPRTPAPSPQ 478          
BLAST of Synapsin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006593.1 (pep scaffold:Pmarinus_7.0:GL480202:19522:29525:1 gene:ENSPMAG00000005954.1 transcript:ENSPMAT00000006593.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 125.561 bits (314), Expect = 2.817e-34
Identity = 51/113 (45.13%), Postives = 83/113 (73.45%), Query Frame = 3
Query:  738 QAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQSTCDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMI 1076
            QAEF+E+++ +Y+E GC VD+Q+ ++GTK +RSFKPDF++VRQ      E+++  L+G  YGGVP++N L ++    D+PW+++ L  +R  LG + FPLIEQ+++  H+EM+
Sbjct:    1 QAEFSEINLAAYTETGCMVDMQLMRNGTKVVRSFKPDFVLVRQPARGTGEDFRTLLVGLEYGGVPAVNPLSSVHAFCDKPWVFSQLIRIRKNLGSKRFPLIEQSFFADHREMV 113          
BLAST of Synapsin vs. Ensembl Nematostella
Match: EDO39526 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9R2])

HSP 1 Score: 238.039 bits (606), Expect = 1.437e-71
Identity = 130/334 (38.92%), Postives = 196/334 (58.68%), Query Frame = 3
Query:  609 ASAKPTSSKGKCKTLLIIDEPHTDWSKYFRGRKIF-GDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQST--CDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKI-KVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNF-KAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKMQIFCRPNI 1595
            +  K   SK   KTLLIID    DWSK F+GR +  G +  R+EQAEF ++++ SYS+ G  VD+QV + GT  +RSF+PDF++VRQS       E++++ L+G  +G VPS+NSL +++N  ++PW+++ L  ++ RLG+E FPLIEQAYYP+HKEM           V  +  + I  G   +  G I ++ +   F      +  +    T  P   +          N    A  R S+S +WKTNTGSA+LEQ+ + D++KLW  E +KLFGGLDI  ++A+  K+ + +I EV  + M L  +T +ED++ IA+L+  KM+    P I
Sbjct:   14 SKTKSPESKKLTKTLLIIDSADHDWSKIFKGRNLHNGSYGIRVEQAEFADINLASYSDSGTMVDIQVFREGTVVVRSFRPDFVLVRQSIRGIGPREDYRHILLGLQFGNVPSVNSLESIYNFAEKPWVFSQLIQIKKRLGKEEFPLIEQAYYPNHKEM-----------VSHRARITISYGCSNSVLGCILRIISRHYFSASLFRIFPSCIHLTVFPSRYSSLVFTFSIFANRLPVAHRRTSISDNWKTNTGSAVLEQIEITDRYKLWAEECSKLFGGLDIMCVEAILGKDKKEYIIEVTDTAMRLFNDTVDEDQQRIADLVIQKMEAHYPPTI 336          
BLAST of Synapsin vs. Ensembl Medaka
Match: syn2b (synapsin II [Source:NCBI gene;Acc:101154941])

HSP 1 Score: 371.318 bits (952), Expect = 1.052e-116
Identity = 166/340 (48.82%), Postives = 246/340 (72.35%), Query Frame = 3
Query:  576 ITNTISR------GFFAASAKPTSSKGKCKTLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQS--TCDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKM 1571
            ITN + +      GF   SA   S   K K LL+IDEP  +W+K FRG+K+ GD+D ++EQAEF+E+++VS+S   C VD+QV + GTK +RSFKPDF++VRQ   +   NE+++N ++G  Y G+PS+N+L  ++N+ D+PW ++ L   + RLG + FPLI+Q +YP++K+MI T            FP+V+KIG+  +G GK+KV+N  +FQDIASVVA+  T+ T+EPFIDAK D+ +QKIG ++KA++R S+SG+WK+NTGSA+LEQV + DK+KLW+   +++FGGLDICA+KA+  K+   +I EV GS+M L+G+ Q EDR+LI+E++ +KM
Sbjct:  105 ITNAVKQTAASAAGFVEQSAPSPSLSKKFKILLVIDEPQHEWAKVFRGKKVLGDYDIKVEQAEFSELNLVSHSNGTCNVDMQVMRGGTKVVRSFKPDFVLVRQHAFSMAQNEDFRNLIIGLQYAGIPSVNTLETIYNLCDKPWAFSQLINNQKRLGSDKFPLIDQTFYPNYKDMITT----------PGFPVVVKIGHAHSGMGKVKVDNISDFQDIASVVAITQTYCTTEPFIDAKYDIRVQKIGADYKAYMRTSISGNWKSNTGSAMLEQVAMTDKYKLWVDTCSEIFGGLDICAVKAICGKDGNDYITEVIGSSMQLIGDHQAEDRQLISEVVLAKM 434          
BLAST of Synapsin vs. Ensembl Medaka
Match: syn2b (synapsin II [Source:NCBI gene;Acc:101154941])

HSP 1 Score: 370.933 bits (951), Expect = 4.672e-116
Identity = 166/340 (48.82%), Postives = 246/340 (72.35%), Query Frame = 3
Query:  576 ITNTISR------GFFAASAKPTSSKGKCKTLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQS--TCDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKM 1571
            ITN + +      GF   SA   S   K K LL+IDEP  +W+K FRG+K+ GD+D ++EQAEF+E+++VS+S   C VD+QV + GTK +RSFKPDF++VRQ   +   NE+++N ++G  Y G+PS+N+L  ++N+ D+PW ++ L   + RLG + FPLI+Q +YP++K+MI T            FP+V+KIG+  +G GK+KV+N  +FQDIASVVA+  T+ T+EPFIDAK D+ +QKIG ++KA++R S+SG+WK+NTGSA+LEQV + DK+KLW+   +++FGGLDICA+KA+  K+   +I EV GS+M L+G+ Q EDR+LI+E++ +KM
Sbjct:  105 ITNAVKQTAASAAGFVEQSAPSPSLSKKFKILLVIDEPQHEWAKVFRGKKVLGDYDIKVEQAEFSELNLVSHSNGTCNVDMQVMRGGTKVVRSFKPDFVLVRQHAFSMAQNEDFRNLIIGLQYAGIPSVNTLETIYNLCDKPWAFSQLINNQKRLGSDKFPLIDQTFYPNYKDMITT----------PGFPVVVKIGHAHSGMGKVKVDNISDFQDIASVVAITQTYCTTEPFIDAKYDIRVQKIGADYKAYMRTSISGNWKSNTGSAMLEQVAMTDKYKLWVDTCSEIFGGLDICAVKAICGKDGNDYITEVIGSSMQLIGDHQAEDRQLISEVVLAKM 434          
BLAST of Synapsin vs. Ensembl Medaka
Match: syn2b (synapsin II [Source:NCBI gene;Acc:101154941])

HSP 1 Score: 359.377 bits (921), Expect = 5.517e-116
Identity = 166/340 (48.82%), Postives = 246/340 (72.35%), Query Frame = 3
Query:  576 ITNTISR------GFFAASAKPTSSKGKCKTLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQS--TCDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKM 1571
            ITN + +      GF   SA   S   K K LL+IDEP  +W+K FRG+K+ GD+D ++EQAEF+E+++VS+S   C VD+QV + GTK +RSFKPDF++VRQ   +   NE+++N ++G  Y G+PS+N+L  ++N+ D+PW ++ L   + RLG + FPLI+Q +YP++K+MI T            FP+V+KIG+  +G GK+KV+N  +FQDIASVVA+  T+ T+EPFIDAK D+ +QKIG ++KA++R S+SG+WK+NTGSA+LEQV + DK+KLW+   +++FGGLDICA+KA+  K+   +I EV GS+M L+G+ Q EDR+LI+E++ +KM
Sbjct:   75 ITNAVKQTAASAAGFVEQSAPSPSLSKKFKILLVIDEPQHEWAKVFRGKKVLGDYDIKVEQAEFSELNLVSHSNGTCNVDMQVMRGGTKVVRSFKPDFVLVRQHAFSMAQNEDFRNLIIGLQYAGIPSVNTLETIYNLCDKPWAFSQLINNQKRLGSDKFPLIDQTFYPNYKDMITT----------PGFPVVVKIGHAHSGMGKVKVDNISDFQDIASVVAITQTYCTTEPFIDAKYDIRVQKIGADYKAYMRTSISGNWKSNTGSAMLEQVAMTDKYKLWVDTCSEIFGGLDICAVKAICGKDGNDYITEVIGSSMQLIGDHQAEDRQLISEVVLAKM 404          
BLAST of Synapsin vs. Ensembl Medaka
Match: syn2a (synapsin-2 [Source:NCBI gene;Acc:101174347])

HSP 1 Score: 357.066 bits (915), Expect = 6.588e-115
Identity = 164/346 (47.40%), Postives = 251/346 (72.54%), Query Frame = 3
Query:  540 SAAPMVESITGQITNTISRGFFAASAKPTSSKGKCKTLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQS--TCDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKM 1571
            + A    SIT  +  T +        + T+ K K K LL+IDEP  +W+K FRG+K+ GD+D ++EQAEFN++++V+++   C V++Q  ++GTK +RSFKPDF+++RQ   +   NE+++N ++G  YGGVPS+NSL +++N+ D+PW +A L     +LG + FPLIEQ +YP++KEM+          +P+ FP+V+KIG+  +G GK+KV+NH +FQDIASVVA+  T++T+EP ID+K D+ IQKIG ++KA++R S+SG+WKTNTGSA+LEQV + D++K+W    +++FGGL+ICA+KA+  K+   +I EV GS+M L+GE Q EDR+LIA+L+ +KM
Sbjct:   68 TGAGFFSSITNVVKQTAASAGLVEQTQVTTPK-KFKILLVIDEPQQEWAKLFRGKKVHGDYDIKVEQAEFNDINVVAHANGTCIVNMQALRNGTKVVRSFKPDFVLIRQHAFSMTQNEDFRNMIIGLQYGGVPSINSLESIYNLCDKPWAFAQLINTCRKLGVDKFPLIEQTFYPNYKEMV---------SMPS-FPVVVKIGHAHSGIGKVKVDNHTKFQDIASVVALTQTYSTTEPLIDSKYDIRIQKIGTDYKAYMRTSISGNWKTNTGSAMLEQVAMTDRYKVWADTCSEIFGGLEICAVKAIHGKDGRDYITEVVGSSMPLVGEHQNEDRQLIADLVLAKM 402          
BLAST of Synapsin vs. Ensembl Medaka
Match: syn1 (synapsin-1 [Source:NCBI gene;Acc:101163826])

HSP 1 Score: 358.221 bits (918), Expect = 3.370e-113
Identity = 158/312 (50.64%), Postives = 230/312 (73.72%), Query Frame = 3
Query:  642 CKTLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQS--TCDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKM 1571
             K +L+ID+  TDW K FRGRK+ G++D ++EQAEF E+++V  S     VD+   ++G K  +SFKPDF+++RQ   + D N + +N ++G  Y GVPS+NSLH+++N  D+PW++A +  +  +LG E FPLIEQ YYP+HKEMI +           +FP+V+K+G+  +G GK+KV+N ++FQDIASVVA+  T+ATSEPFIDAK DV IQKIGNN+KA++R S+SG+WKTNTGS+ILEQV ++DK++LW+   A++FGGLDICA++A+  K+   +I EV   +M L+G+ Q+EDR  IA+L+ S+M
Sbjct:  108 AKIILVIDDQQTDWVKIFRGRKVHGEFDIKVEQAEFTEINLVVNSTGSFNVDIDAIRNGHKVTKSFKPDFVLIRQHAFSMDKNGDHRNIVIGLQYAGVPSVNSLHSVYNFCDKPWVFAQMSRLHKQLGPEEFPLIEQVYYPNHKEMITS----------PRFPVVVKMGHAHSGMGKVKVDNQYDFQDIASVVALTKTYATSEPFIDAKYDVRIQKIGNNYKAYMRTSVSGNWKTNTGSSILEQVAMSDKYRLWVDSCAEIFGGLDICAVEALHGKDGIDYIIEVDDCSMPLIGDQQDEDRVQIADLVLSRM 409          
BLAST of Synapsin vs. Planmine SMEST
Match: SMESG000063523.1 (SMESG000063523.1)

HSP 1 Score: 1208.74 bits (3126), Expect = 0.000e+0
Identity = 638/638 (100.00%), Postives = 638/638 (100.00%), Query Frame = 3
Query:  264 MFGYLKRRFSSGDLQDEAADQREQEGLPSFLNPFNANPQPSKPNQPVNNNINRMQQRPTSTEPSIANTAPTHRXXXXXXXXXXXXXXXXXGFSAAPMVESITGQITNTISRGFFAASAKPTSSKGKCKTLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQSTCDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKMQIFCRPNIPKAESLHVMNRQNDSPINTSNPPTSASSVNITSQIGSRLPSQMSTSGISHDYTVAXXXXXXXXXXXXXXXXXRNQNFADNVSKSNIGHTSSLPAXXXXXXXXXXXXXXXXXXXXEPMRLPDGHQGGQNNASSAAGYVPNMNLRSAGPPNKVGSQPNRPTIPPRQTSLKSNASVDDGDDTMKNLRKTFAGIFGDM 2177
            MFGYLKRRFSSGDLQDEAADQREQEGLPSFLNPFNANPQPSKPNQPVNNNINRMQQRPTSTEPSIANTAPTHRPKTAYPSAPTSPTRSTSGFSAAPMVESITGQITNTISRGFFAASAKPTSSKGKCKTLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQSTCDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKMQIFCRPNIPKAESLHVMNRQNDSPINTSNPPTSASSVNITSQIGSRLPSQMSTSGISHDYTVAPSTSTTFTQPPLTTMATRNQNFADNVSKSNIGHTSSLPASSSITATSNSMSSISGMNASEPMRLPDGHQGGQNNASSAAGYVPNMNLRSAGPPNKVGSQPNRPTIPPRQTSLKSNASVDDGDDTMKNLRKTFAGIFGDM
Sbjct:    1 MFGYLKRRFSSGDLQDEAADQREQEGLPSFLNPFNANPQPSKPNQPVNNNINRMQQRPTSTEPSIANTAPTHRPKTAYPSAPTSPTRSTSGFSAAPMVESITGQITNTISRGFFAASAKPTSSKGKCKTLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQSTCDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKMQIFCRPNIPKAESLHVMNRQNDSPINTSNPPTSASSVNITSQIGSRLPSQMSTSGISHDYTVAPSTSTTFTQPPLTTMATRNQNFADNVSKSNIGHTSSLPASSSITATSNSMSSISGMNASEPMRLPDGHQGGQNNASSAAGYVPNMNLRSAGPPNKVGSQPNRPTIPPRQTSLKSNASVDDGDDTMKNLRKTFAGIFGDM 638          
BLAST of Synapsin vs. Planmine SMEST
Match: SMESG000063523.1 (SMESG000063523.1)

HSP 1 Score: 1180.62 bits (3053), Expect = 0.000e+0
Identity = 628/638 (98.43%), Postives = 628/638 (98.43%), Query Frame = 3
Query:  264 MFGYLKRRFSSGDLQDEAADQREQEGLPSFLNPFNANPQPSKPNQPVNNNINRMQQRPTSTEPSIANTAPTHRXXXXXXXXXXXXXXXXXGFSAAPMVESITGQITNTISRGFFAASAKPTSSKGKCKTLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQSTCDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKMQIFCRPNIPKAESLHVMNRQNDSPINTSNPPTSASSVNITSQIGSRLPSQMSTSGISHDYTVAXXXXXXXXXXXXXXXXXRNQNFADNVSKSNIGHTSSLPAXXXXXXXXXXXXXXXXXXXXEPMRLPDGHQGGQNNASSAAGYVPNMNLRSAGPPNKVGSQPNRPTIPPRQTSLKSNASVDDGDDTMKNLRKTFAGIFGDM 2177
            MFGYLKRRFSSGDLQDEAADQREQEGLPSFLNPFNANPQPSKPNQPVNNNINRMQQRPTSTEPSIANTAPTHRPKTAYPSAPTSPTRSTSGFSAAPMVESITGQITNTISRGFFAASAKPTSSKGKCKTLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQSTCDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEM          VVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKMQIFCRPNIPKAESLHVMNRQNDSPINTSNPPTSASSVNITSQIGSRLPSQMSTSGISHDYTVAPSTSTTFTQPPLTTMATRNQNFADNVSKSNIGHTSSLPASSSITATSNSMSSISGMNASEPMRLPDGHQGGQNNASSAAGYVPNMNLRSAGPPNKVGSQPNRPTIPPRQTSLKSNASVDDGDDTMKNLRKTFAGIFGDM
Sbjct:    1 MFGYLKRRFSSGDLQDEAADQREQEGLPSFLNPFNANPQPSKPNQPVNNNINRMQQRPTSTEPSIANTAPTHRPKTAYPSAPTSPTRSTSGFSAAPMVESITGQITNTISRGFFAASAKPTSSKGKCKTLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQSTCDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEM----------VVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKMQIFCRPNIPKAESLHVMNRQNDSPINTSNPPTSASSVNITSQIGSRLPSQMSTSGISHDYTVAPSTSTTFTQPPLTTMATRNQNFADNVSKSNIGHTSSLPASSSITATSNSMSSISGMNASEPMRLPDGHQGGQNNASSAAGYVPNMNLRSAGPPNKVGSQPNRPTIPPRQTSLKSNASVDDGDDTMKNLRKTFAGIFGDM 628          
BLAST of Synapsin vs. Planmine SMEST
Match: SMESG000063523.1 (SMESG000063523.1)

HSP 1 Score: 1070.84 bits (2768), Expect = 0.000e+0
Identity = 575/585 (98.29%), Postives = 575/585 (98.29%), Query Frame = 3
Query:  423 MQQRPTSTEPSIANTAPTHRXXXXXXXXXXXXXXXXXGFSAAPMVESITGQITNTISRGFFAASAKPTSSKGKCKTLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQSTCDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKMQIFCRPNIPKAESLHVMNRQNDSPINTSNPPTSASSVNITSQIGSRLPSQMSTSGISHDYTVAXXXXXXXXXXXXXXXXXRNQNFADNVSKSNIGHTSSLPAXXXXXXXXXXXXXXXXXXXXEPMRLPDGHQGGQNNASSAAGYVPNMNLRSAGPPNKVGSQPNRPTIPPRQTSLKSNASVDDGDDTMKNLRKTFAGIFGDM 2177
            MQQRPTSTEPSIANTAPTHRPKTAYPSAPTSPTRSTSGFSAAPMVESITGQITNTISRGFFAASAKPTSSKGKCKTLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQSTCDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEM          VVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKMQIFCRPNIPKAESLHVMNRQNDSPINTSNPPTSASSVNITSQIGSRLPSQMSTSGISHDYTVAPSTSTTFTQPPLTTMATRNQNFADNVSKSNIGHTSSLPASSSITATSNSMSSISGMNASEPMRLPDGHQGGQNNASSAAGYVPNMNLRSAGPPNKVGSQPNRPTIPPRQTSLKSNASVDDGDDTMKNLRKTFAGIFGDM
Sbjct:    1 MQQRPTSTEPSIANTAPTHRPKTAYPSAPTSPTRSTSGFSAAPMVESITGQITNTISRGFFAASAKPTSSKGKCKTLLIIDEPHTDWSKYFRGRKIFGDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVRQSTCDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNRLGRENFPLIEQAYYPSHKEM----------VVPTKFPMVIKIGNCRNGKGKIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLRKSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSKNDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKMQIFCRPNIPKAESLHVMNRQNDSPINTSNPPTSASSVNITSQIGSRLPSQMSTSGISHDYTVAPSTSTTFTQPPLTTMATRNQNFADNVSKSNIGHTSSLPASSSITATSNSMSSISGMNASEPMRLPDGHQGGQNNASSAAGYVPNMNLRSAGPPNKVGSQPNRPTIPPRQTSLKSNASVDDGDDTMKNLRKTFAGIFGDM 575          
The following BLAST results are available for this feature:
BLAST of Synapsin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYN24.166e-12152.04synapsin II [Source:HGNC Symbol;Acc:HGNC:11495][more]
SYN27.209e-12152.04synapsin II [Source:HGNC Symbol;Acc:HGNC:11495][more]
SYN14.651e-11549.35synapsin I [Source:HGNC Symbol;Acc:HGNC:11494][more]
SYN11.621e-11449.35synapsin I [Source:HGNC Symbol;Acc:HGNC:11494][more]
SYN31.029e-10948.60synapsin III [Source:HGNC Symbol;Acc:HGNC:11496][more]
back to top
BLAST of Synapsin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
snn-12.217e-3927.38Synapsin [Source:UniProtKB/TrEMBL;Acc:G5EGI2][more]
snn-13.841e-3927.82Synapsin [Source:UniProtKB/TrEMBL;Acc:G5EGI2][more]
back to top
BLAST of Synapsin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Syn1.151e-10738.45gene:FBgn0004575 transcript:FBtr0100472[more]
Syn3.227e-10742.98gene:FBgn0004575 transcript:FBtr0089477[more]
Syn1.045e-10438.45gene:FBgn0004575 transcript:FBtr0100471[more]
Syn3.005e-10442.98gene:FBgn0004575 transcript:FBtr0089475[more]
back to top
BLAST of Synapsin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
syn2b1.961e-11548.67synapsin IIb [Source:ZFIN;Acc:ZDB-GENE-051127-49][more]
syn2a1.602e-11445.58synapsin IIa [Source:ZFIN;Acc:ZDB-GENE-040718-341][more]
syn12.187e-11048.41synapsin I [Source:ZFIN;Acc:ZDB-GENE-081105-93][more]
syn12.187e-11048.41synapsin I [Source:ZFIN;Acc:ZDB-GENE-081105-93][more]
back to top
BLAST of Synapsin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
syn32.109e-10847.28synapsin III [Source:NCBI gene;Acc:100170548][more]
syn31.388e-10146.18synapsin III [Source:NCBI gene;Acc:100170548][more]
osbpl1a3.922e-5654.22oxysterol binding protein like 1A [Source:Xenbase;... [more]
osbpl1a7.488e-4855.80oxysterol binding protein like 1A [Source:Xenbase;... [more]
back to top
BLAST of Synapsin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Syn22.790e-12348.99synapsin II [Source:MGI Symbol;Acc:MGI:103020][more]
Syn22.790e-12348.99synapsin II [Source:MGI Symbol;Acc:MGI:103020][more]
Syn28.923e-12348.99synapsin II [Source:MGI Symbol;Acc:MGI:103020][more]
Syn13.316e-11549.35synapsin I [Source:MGI Symbol;Acc:MGI:98460][more]
Syn11.167e-11449.35synapsin I [Source:MGI Symbol;Acc:MGI:98460][more]
back to top
BLAST of Synapsin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6QM28|SYN_HELPO2.937e-12751.93Synapsin OS=Helix pomatia OX=6536 GN=SYN PE=1 SV=1[more]
sp|Q64332|SYN2_MOUSE6.241e-12248.99Synapsin-2 OS=Mus musculus OX=10090 GN=Syn2 PE=1 S... [more]
sp|Q63537|SYN2_RAT8.967e-12248.99Synapsin-2 OS=Rattus norvegicus OX=10116 GN=Syn2 P... [more]
sp|Q92777|SYN2_HUMAN3.462e-12052.04Synapsin-2 OS=Homo sapiens OX=9606 GN=SYN2 PE=2 SV... [more]
sp|P17600|SYN1_HUMAN7.785e-11449.35Synapsin-1 OS=Homo sapiens OX=9606 GN=SYN1 PE=1 SV... [more]
back to top
BLAST of Synapsin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A075A0T96.341e-15146.72ATP-grasp domain-containing protein OS=Opisthorchi... [more]
G7Y5I41.660e-14947.04Synapsin-3 OS=Clonorchis sinensis OX=79923 GN=CLF_... [more]
O763225.313e-14757.91Synapsin s-syn-short (Fragment) OS=Doryteuthis pea... [more]
O763236.848e-14757.91Synapsin s-syn-long (Fragment) OS=Doryteuthis peal... [more]
G4VIG87.209e-14644.53Putative synapsin OS=Schistosoma mansoni OX=6183 G... [more]
back to top
BLAST of Synapsin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syn2b5.188e-11848.29synapsin-2 [Source:NCBI gene;Acc:103031721][more]
SYN33.191e-11149.20synapsin III [Source:HGNC Symbol;Acc:HGNC:11496][more]
syn15.925e-11047.63synapsin-1 [Source:NCBI gene;Acc:103031680][more]
syn2a1.155e-10747.20synapsin IIa [Source:ZFIN;Acc:ZDB-GENE-040718-341][more]
syn15.259e-9744.35synapsin-1 [Source:NCBI gene;Acc:103031680][more]
back to top
BLAST of Synapsin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
syn2a5.681e-12145.68synapsin IIa [Source:ZFIN;Acc:ZDB-GENE-040718-341][more]
ENSPMAT00000006593.12.817e-3445.13pep scaffold:Pmarinus_7.0:GL480202:19522:29525:1 g... [more]
back to top
BLAST of Synapsin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Synapsin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO395261.437e-7138.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Synapsin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syn2b1.052e-11648.82synapsin II [Source:NCBI gene;Acc:101154941][more]
syn2b4.672e-11648.82synapsin II [Source:NCBI gene;Acc:101154941][more]
syn2b5.517e-11648.82synapsin II [Source:NCBI gene;Acc:101154941][more]
syn2a6.588e-11547.40synapsin-2 [Source:NCBI gene;Acc:101174347][more]
syn13.370e-11350.64synapsin-1 [Source:NCBI gene;Acc:101163826][more]
back to top
BLAST of Synapsin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000063523.10.000e+0100.00SMESG000063523.1[more]
SMESG000063523.10.000e+098.43SMESG000063523.1[more]
SMESG000063523.10.000e+098.29SMESG000063523.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016589 ID=SMED30016589|Name=Synapsin|organism=Schmidtea mediterranea sexual|type=transcript|length=2365bp
TACATTATTAATCAAACGTGTAGAAAATCGATTATCTGCAAACATGGAGC
ATTTGGAAAGAAACTTTCTCATCACAGTTGAGAATGTATGAGCGTGTTTG
ACAATTGTTGACGAAAAGGGAGAAAATTCAACAAGGAAATCCACACCGAG
ATGGAAAGCTCTAGTAATGACAATGCTGAAATTCGGATTTTGCTGTTGTT
AGTGACGGGACATTTGGAACTCTTTCACCAAGAGTGACTTAGAACTTTCC
TTTTCCAATTGCAATGTTCGGTTACTTGAAACGTCGATTTTCTTCTGGTG
ATTTACAGGATGAGGCCGCTGATCAAAGAGAACAAGAGGGTCTTCCGAGT
TTTCTGAATCCATTCAACGCTAATCCTCAGCCATCTAAACCTAACCAACC
AGTTAATAACAACATTAATAGGATGCAGCAACGTCCAACAAGCACAGAGC
CATCAATAGCAAACACTGCTCCTACACATCGACCAAAAACAGCTTATCCA
AGTGCTCCAACTTCTCCTACTCGGTCGACTTCTGGGTTCTCTGCGGCGCC
AATGGTCGAAAGCATAACCGGACAAATAACGAATACAATTAGCCGTGGAT
TTTTCGCAGCTTCCGCGAAGCCAACCTCAAGCAAGGGAAAGTGCAAAACT
CTGCTAATAATCGATGAGCCTCACACAGATTGGTCCAAATACTTCCGGGG
CAGAAAGATATTCGGAGACTGGGACTTTCGAATCGAACAAGCTGAATTCA
ATGAGGTTAGTATGGTCTCCTATAGTGAGCACGGATGCACAGTCGATGTG
CAGGTGGACAAAAGCGGAACGAAATCCATGAGGTCATTCAAGCCGGATTT
TTTAGTTGTTAGACAATCGACTTGTGATGCAAATGAAAATTGGAAGAACT
TCTTGATGGGATTTTTGTATGGGGGAGTTCCTTCATTGAATTCATTGCAC
GCATTATTTAATATGCATGACAGACCTTGGATGTATGCTCATCTCGAGCT
CGTTCGCAATCGCCTGGGCAGAGAGAACTTTCCTCTCATTGAACAGGCTT
ACTATCCAAGCCATAAAGAAATGATCTTGACTTGCACATTGGATACGAAA
AAGGTGGTACCAACGAAATTTCCCATGGTCATTAAAATAGGAAATTGCCG
AAATGGGAAAGGAAAAATAAAAGTGGAAAACCATTTTGAATTTCAAGATA
TTGCTAGTGTAGTTGCAGTTGCTAACACCTTCGCCACTAGTGAGCCTTTC
ATTGATGCCAAATGTGACGTTGTCATTCAGAAAATCGGGAACAATTTCAA
AGCTTTTCTACGAAAGTCGCTATCAGGTTCTTGGAAAACAAACACTGGAT
CAGCAATTTTGGAACAAGTCCCATTAAATGACAAGTTCAAATTGTGGATC
ACCGAAGTGGCCAAATTATTCGGAGGATTAGACATTTGCGCCCTCAAAGC
AGTTCAATCAAAAAATGATGAATTTCACATTTATGAAGTAAAAGGATCTA
ACATGAATTTACTCGGAGAAACTCAAGAAGAAGATCGCAAACTCATCGCT
GAACTAATATGGTCAAAAATGCAAATATTTTGTCGTCCTAATATTCCTAA
AGCAGAAAGTTTGCATGTGATGAACCGCCAAAATGATTCGCCAATAAACA
CATCGAATCCTCCTACTAGTGCATCATCAGTCAACATTACTTCTCAGATT
GGTAGCAGACTGCCTTCGCAAATGTCAACATCTGGAATATCGCATGATTA
TACAGTTGCGCCGTCTACATCCACAACTTTTACACAACCACCCTTAACGA
CAATGGCAACTCGCAATCAGAACTTTGCAGATAATGTCAGTAAGTCGAAT
ATTGGTCACACATCTAGCTTGCCAGCTTCATCATCTATTACTGCAACATC
AAACTCAATGAGTTCTATCAGTGGGATGAATGCCAGTGAGCCAATGAGAT
TGCCGGATGGACATCAAGGCGGACAAAACAATGCGAGCAGTGCTGCAGGA
TACGTTCCCAACATGAACCTGAGATCTGCTGGACCACCAAATAAAGTAGG
TAGTCAGCCAAACCGACCAACCATTCCACCTCGTCAAACCTCTCTTAAGT
CGAATGCCAGTGTCGATGATGGAGATGACACAATGAAAAATCTGAGGAAG
ACTTTCGCAGGCATTTTTGGCGACATGTAGTAGTAGATGTATAAATTAGA
CATCGCTAACAGATATTTAATCAAATCCTATTTGTTTTGTGTTAGATAGA
CATTATTATTCATAATATCTATGGGAGAACTTTGATTATTTTGTGATTTT
CTTTCTCTTTATTAGTTGATAGTAAATGATTTTCCGAATGAAATATTTAC
AAGTGTCGTTTATTT
back to top

protein sequence of SMED30016589-orf-1

>SMED30016589-orf-1 ID=SMED30016589-orf-1|Name=SMED30016589-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=639bp
MFGYLKRRFSSGDLQDEAADQREQEGLPSFLNPFNANPQPSKPNQPVNNN
INRMQQRPTSTEPSIANTAPTHRPKTAYPSAPTSPTRSTSGFSAAPMVES
ITGQITNTISRGFFAASAKPTSSKGKCKTLLIIDEPHTDWSKYFRGRKIF
GDWDFRIEQAEFNEVSMVSYSEHGCTVDVQVDKSGTKSMRSFKPDFLVVR
QSTCDANENWKNFLMGFLYGGVPSLNSLHALFNMHDRPWMYAHLELVRNR
LGRENFPLIEQAYYPSHKEMILTCTLDTKKVVPTKFPMVIKIGNCRNGKG
KIKVENHFEFQDIASVVAVANTFATSEPFIDAKCDVVIQKIGNNFKAFLR
KSLSGSWKTNTGSAILEQVPLNDKFKLWITEVAKLFGGLDICALKAVQSK
NDEFHIYEVKGSNMNLLGETQEEDRKLIAELIWSKMQIFCRPNIPKAESL
HVMNRQNDSPINTSNPPTSASSVNITSQIGSRLPSQMSTSGISHDYTVAP
STSTTFTQPPLTTMATRNQNFADNVSKSNIGHTSSLPASSSITATSNSMS
SISGMNASEPMRLPDGHQGGQNNASSAAGYVPNMNLRSAGPPNKVGSQPN
RPTIPPRQTSLKSNASVDDGDDTMKNLRKTFAGIFGDM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000025nervous system
PLANA:0000099neuron
PLANA:0000103central nervous system
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001359Synapsin
IPR013815ATP_grasp_subdomain_1
IPR016185PreATP-grasp_dom_sf
IPR020897Synapsin_pre-ATP-grasp_dom
IPR020898Synapsin_ATP-bd_dom
IPR013816ATP_grasp_subdomain_2
Vocabulary: cellular component
TermDefinition
GO:0008021synaptic vesicle
Vocabulary: biological process
TermDefinition
GO:0007269neurotransmitter secretion
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0005524ATP binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001359SynapsinPRINTSPR01368SYNAPSINcoord: 139..148
score: 74.0
coord: 352..368
score: 80.0
coord: 371..392
score: 47.73
coord: 338..350
score: 68.46
coord: 154..166
score: 50.77
coord: 190..201
score: 70.0
NoneNo IPR availableGENE3DG3DSA:3.30.470.20coord: 227..415
e-value: 2.6E-123
score: 412.6
NoneNo IPR availableGENE3DG3DSA:3.40.50.20coord: 129..425
e-value: 2.6E-123
score: 412.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 532..554
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..92
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 591..617
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 591..622
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 28..92
NoneNo IPR availablePANTHERPTHR10841SYNAPSINcoord: 4..637
NoneNo IPR availableSUPERFAMILYSSF56059Glutathione synthetase ATP-binding domain-likecoord: 226..436
IPR013815ATP-grasp fold, subdomain 1GENE3DG3DSA:3.30.1490.20coord: 260..329
e-value: 2.6E-123
score: 412.6
IPR020897Synapsin, pre-ATP-grasp domainPFAMPF02078Synapsincoord: 126..224
e-value: 4.4E-40
score: 136.0
IPR020898Synapsin, ATP-binding domainPFAMPF02750Synapsin_Ccoord: 226..437
e-value: 5.5E-79
score: 264.4
IPR016185Pre-ATP-grasp domain superfamilySUPERFAMILYSSF52440PreATP-grasp domaincoord: 126..225