SMED30016562

Overview
NameSMED30016562
Smed IDSMED30016562
Length (bp)2548
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30016562 (SMED30016562) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30016562 (SMED30016562) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30016562 (SMED30016562) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30016562 (SMED30016562) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016562

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30016562 SmedASXL_076205SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
parenchymal cellSMED30016562SMESG000042104.1 dd_Smed_v4_7175_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30016562 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.017882:11201..13777 -12435
Homology
BLAST of SMED30016562 vs. Ensembl Human
Match: ERCC6 (ERCC excision repair 6, chromatin remodeling factor [Source:HGNC Symbol;Acc:HGNC:3438])

HSP 1 Score: 92.8189 bits (229), Expect = 6.459e-22
Identity = 91/336 (27.08%), Postives = 147/336 (43.75%), Query Frame = -1
Query:  533 LDTPYKYFAYFLDDEFLQIIYDETNLYGTQKYPNKATSYNINDIKRFIGICEYMSVVRLQRTRCYW--REDIGIEDVSNSMSINKFEQI-NTLHFSDNTKM--LDRGH--HPIWQNLQIKT-KFGSIPQEDRLSIDEQICATKVRHQLKQYLPMKHNKWGFKLFVLCSTAGFAYNFEIYKGTKNHYTKRKDDEPELGASSNVVVHLARCIKNMKXXXXXXXXXXIY---------------MLETVRRNRIPNCKLMEESQMKKLPXXXXXXXLASIDGVDVTNVGWFDNKVVTLLFTKVRELPNGTVKRYDRKKKESIIID*PNIIKKYNKHIGG 1471
            + TP +    FLDDE +++I   +NLY   K          ++ K F+GI      V + R R +W  R D+    VS +M  ++FE I + LH +DN  +  +D+     P+   L  +  KF  +P E   S DE +     RH  KQ++  K  ++G+K +   +  G+   F+ Y+G KN  TK +    E G  +++V+  +  +       +  +    +                  TVR++ I    L  +  +KK            IDG       W DN VVT+  +     P   V RY +K K+ I +  PN+IK YN+ +GG
Sbjct:  139 MRTPTEILELFLDDEVIELIVKYSNLYACSK--GVHLGLTSSEFKCFLGIIFLSGYVSVPRRRMFWEQRTDVHNVLVSAAMRRDRFETIFSNLHVADNANLDPVDKFSKLRPLISKLNERCMKF--VPNETYFSFDEFMVPYFGRHGCKQFIRGKPIRFGYKFWCGATCLGYICWFQPYQG-KNPNTKHE----EYGVGASLVLQFSEALTEAHPGQYHFVFNNFFTSIALLDKLSSMGHQATGTVRKDHIDRVPLESDVALKK---KERGTFDYRIDGKGNIVCRWNDNSVVTVASSGAGIHPLCLVSRYSQKLKKKIQVQQPNMIKVYNQFMGG 462          

HSP 2 Score: 32.7278 bits (73), Expect = 6.459e-22
Identity = 28/115 (24.35%), Postives = 46/115 (40.00%), Query Frame = -2
Query:  193 VGRYRIPLRSKKWYFRIFCHLIYIITINAWLLFRRATFEKTGEQSRMMLWEFRVEIAKCMCRIGTQNGKRGRPNSIQQGLENKNHKGPTACVPPLDV*TDKIAHWVIYENPRQRC 537
            + +YR  +R KKWY         ++  NAW L       KT ++  +   EFR  +   +C     +G    P   Q+G   K +         +D   D I H ++ +  + RC
Sbjct:  470 IDKYRASIRGKKWYSSPLLFCFELVLQNAWQL------HKTYDEKPVDFLEFRRRV---VCHYLETHGHPPEPG--QKGRPQKRN---------IDSRYDGINHVIVKQGKQTRC 564          
BLAST of SMED30016562 vs. Ensembl Human
Match: ERCC6 (ERCC excision repair 6, chromatin remodeling factor [Source:HGNC Symbol;Acc:HGNC:3438])

HSP 1 Score: 90.1225 bits (222), Expect = 5.920e-21
Identity = 89/336 (26.49%), Postives = 144/336 (42.86%), Query Frame = -1
Query:  533 LDTPYKYFAYFLDDEFLQIIYDETNLYGTQKYPNKATSYNINDIKRFIGICEYMSVVRLQRTRCYWREDIGIEDV--SNSMSINKFEQI-NTLHFSDNTKM--LDRGH--HPIWQNLQIKT-KFGSIPQEDRLSIDEQICATKVRHQLKQYLPMKHNKWGFKLFVLCSTAGFAYNFEIYKGTKNHYTKRKDDEPELGASSNVVVHLARCIKNMKXXX---------------XXXXXXXIYMLETVRRNRIPNCKLMEESQMKKLPXXXXXXXLASIDGVDVTNVGWFDNKVVTLLFTKVRELPNGTVKRYDRKKKESIIID*PNIIKKYNKHIGG 1471
            + TP +    FLDDE +++I   +NLY   K          ++ K F+GI      V + R R +W +   + +V  S +M  ++FE I + LH +DN  +  +D+     P+   L  +  KF  +P E   S DE +     RH  KQ++  K  ++G+K +   +  G+   F+ Y+G KN  TK +    E G  +++V+  +  +                                  TVR++ I    L  +  +KK            IDG       W DN VVT+  +     P   V RY +K K+ I +  PN+IK YN+ +GG
Sbjct:  607 MRTPTEILELFLDDEVIELIVKYSNLYACSK--GVHLGLTSSEFKCFLGIIFLSGYVSVPRRRMFWEQRTDVHNVLVSAAMRRDRFETIFSNLHVADNANLDPVDKFSKLRPLISKLNERCMKF--VPNETYFSFDEFMVPYFGRHGCKQFIRGKPIRFGYKFWCGATCLGYICWFQPYQG-KNPNTKHE----EYGVGASLVLQFSEALTEAHPGQYHFVFNNFFTSIALLDKLSSMGHQATGTVRKDHIDRVPLESDVALKK---KERGTFDYRIDGKGNIVCRWNDNSVVTVASSGAGIHPLCLVSRYSQKLKKKIQVQQPNMIKVYNQFMGG 930          

HSP 2 Score: 32.3426 bits (72), Expect = 5.920e-21
Identity = 28/115 (24.35%), Postives = 46/115 (40.00%), Query Frame = -2
Query:  193 VGRYRIPLRSKKWYFRIFCHLIYIITINAWLLFRRATFEKTGEQSRMMLWEFRVEIAKCMCRIGTQNGKRGRPNSIQQGLENKNHKGPTACVPPLDV*TDKIAHWVIYENPRQRC 537
            + +YR  +R KKWY         ++  NAW L       KT ++  +   EFR  +   +C     +G    P   Q+G   K +         +D   D I H ++ +  + RC
Sbjct:  938 IDKYRASIRGKKWYSSPLLFCFELVLQNAWQLH------KTYDEKPVDFLEFRRRV---VCHYLETHGHPPEPG--QKGRPQKRN---------IDSRYDGINHVIVKQGKQTRC 1032          
BLAST of SMED30016562 vs. Ensembl Human
Match: ERCC6 (ERCC excision repair 6, chromatin remodeling factor [Source:HGNC Symbol;Acc:HGNC:3438])

HSP 1 Score: 90.1225 bits (222), Expect = 5.920e-21
Identity = 89/336 (26.49%), Postives = 144/336 (42.86%), Query Frame = -1
Query:  533 LDTPYKYFAYFLDDEFLQIIYDETNLYGTQKYPNKATSYNINDIKRFIGICEYMSVVRLQRTRCYWREDIGIEDV--SNSMSINKFEQI-NTLHFSDNTKM--LDRGH--HPIWQNLQIKT-KFGSIPQEDRLSIDEQICATKVRHQLKQYLPMKHNKWGFKLFVLCSTAGFAYNFEIYKGTKNHYTKRKDDEPELGASSNVVVHLARCIKNMKXXX---------------XXXXXXXIYMLETVRRNRIPNCKLMEESQMKKLPXXXXXXXLASIDGVDVTNVGWFDNKVVTLLFTKVRELPNGTVKRYDRKKKESIIID*PNIIKKYNKHIGG 1471
            + TP +    FLDDE +++I   +NLY   K          ++ K F+GI      V + R R +W +   + +V  S +M  ++FE I + LH +DN  +  +D+     P+   L  +  KF  +P E   S DE +     RH  KQ++  K  ++G+K +   +  G+   F+ Y+G KN  TK +    E G  +++V+  +  +                                  TVR++ I    L  +  +KK            IDG       W DN VVT+  +     P   V RY +K K+ I +  PN+IK YN+ +GG
Sbjct:  607 MRTPTEILELFLDDEVIELIVKYSNLYACSK--GVHLGLTSSEFKCFLGIIFLSGYVSVPRRRMFWEQRTDVHNVLVSAAMRRDRFETIFSNLHVADNANLDPVDKFSKLRPLISKLNERCMKF--VPNETYFSFDEFMVPYFGRHGCKQFIRGKPIRFGYKFWCGATCLGYICWFQPYQG-KNPNTKHE----EYGVGASLVLQFSEALTEAHPGQYHFVFNNFFTSIALLDKLSSMGHQATGTVRKDHIDRVPLESDVALKK---KERGTFDYRIDGKGNIVCRWNDNSVVTVASSGAGIHPLCLVSRYSQKLKKKIQVQQPNMIKVYNQFMGG 930          

HSP 2 Score: 32.3426 bits (72), Expect = 5.920e-21
Identity = 28/115 (24.35%), Postives = 46/115 (40.00%), Query Frame = -2
Query:  193 VGRYRIPLRSKKWYFRIFCHLIYIITINAWLLFRRATFEKTGEQSRMMLWEFRVEIAKCMCRIGTQNGKRGRPNSIQQGLENKNHKGPTACVPPLDV*TDKIAHWVIYENPRQRC 537
            + +YR  +R KKWY         ++  NAW L       KT ++  +   EFR  +   +C     +G    P   Q+G   K +         +D   D I H ++ +  + RC
Sbjct:  938 IDKYRASIRGKKWYSSPLLFCFELVLQNAWQLH------KTYDEKPVDFLEFRRRV---VCHYLETHGHPPEPG--QKGRPQKRN---------IDSRYDGINHVIVKQGKQTRC 1032          
BLAST of SMED30016562 vs. Ensembl Human
Match: PGBD1 (piggyBac transposable element derived 1 [Source:HGNC Symbol;Acc:HGNC:19398])

HSP 1 Score: 83.9593 bits (206), Expect = 2.022e-20
Identity = 89/361 (24.65%), Postives = 155/361 (42.94%), Query Frame = -1
Query:  545 WTKRNICIDKGDLNFKGSSKLPSQILSLDT----PYKYFAYFLDDEFLQIIYDETNLYGTQKYPNKATSYNINDIKRFIGICEYMSVVRLQRTRCYWR-EDIGIEDVSNSMSINKFEQI-NTLHFSDNTKMLDRGH----HPIWQNLQIKTKFGSIPQEDRLSIDEQICATKVRHQLKQYLPMKHNKWGFKLFVLCSTAGFAYNFEIYKGTKNHYTKRKDDEPELGASSNVVVHLAR------------CIKNMKXXXXXXXXXXIYMLE---TVRRNRIPNCKLMEESQMKKLPXXXXXXXLASIDGVDVTNVGWFDNKVVTLLFTKVRELPNGTVKRYDRKKKESIIID*PNIIKKYNK 1552
            WTKR+I       NF   S L S +L+L +    P + F  F DDE   +I +ETN Y +QK  N +    + +++   G+      +R  R   YW   D     V +++  ++FE I + LHF+DN  +  +       P+ + +  K      P E+    D+ +C         Q+L  K  + G+K++   +T G+   FE Y   +   T + D++P+LG   N+V++ A             C  +   S+ +        +    T+R NR   C LM    MKK+     +  +   +  ++    W+ + +++L    V   P   V   D   +E   I  P+I+K Y++
Sbjct:  390 WTKRDI-----KPNFPSWSALDSGLLNLKSEKLNPVELFELFFDDETFNLIVNETNNYASQK--NVSLEVTVQEMRCVFGVLLLSGFMRHPRREMYWEVSDTDQNLVRDAIRRDRFELIFSNLHFADNGHLDQKDKFTKLRPLIKQMN-KNFLLYAPLEEYYCFDKSMCEC---FDSDQFLNGKPIRIGYKIWCGTTTQGYLVWFEPY---QEESTMKVDEDPDLGLGGNLVMNFADVLLERGQYPYHLCFDSFFTSVKLLSALKKKGVRATGTIRENRTEKCPLMNVEHMKKMKRGYFDFRIE--ENNEIILCRWYGDGIISLCSNAVGIEPVNEVSCCDADNEEIPQISQPSIVKVYDE 734          

HSP 2 Score: 36.5798 bits (83), Expect = 2.022e-20
Identity = 14/38 (36.84%), Postives = 25/38 (65.79%), Query Frame = -2
Query:  436 INILVGRYRIPLRSKKWYFRIFCHLIYIITINAWLLFR 549
            ++ ++ +YR+ +RSKKWY  +  ++I +   NAW L R
Sbjct:  742 MDQIISKYRVRIRSKKWYSILVSYMIDVAMNNAWQLHR 779          
BLAST of SMED30016562 vs. Ensembl Human
Match: PGBD2 (piggyBac transposable element derived 2 [Source:HGNC Symbol;Acc:HGNC:19399])

HSP 1 Score: 69.707 bits (169), Expect = 1.002e-16
Identity = 91/381 (23.88%), Postives = 154/381 (40.42%), Query Frame = -1
Query:  533 KRERLIFHPKKVVHRNILWTKRNICIDKGDLNFKGS--SKLPSQILSLDTPYKYFAYFLDDEFLQIIYDETNLYGTQKYPNKATSYNINDIKRFIGICEYMSVVRLQRTRCYWR--EDIGIEDVSNSMSINKFEQI-NTLHFSDNTKMLDRGHHPIWQNLQIKTKFG---SIPQEDRLSIDEQICATKVRHQLKQYLPMKHNKWGFKLFVLCSTAGFAYNFEIYKGTKNHYTKRKDDEPELGASSNVVVHLARCIKNMKXXXXXXXXXXIY---------------MLETVRRNRIPNCKLMEESQMKKLPXXXXXXXLASIDGVDVTNVGWFDNKVVTLLFTKVRELPNGTVKRYDRKKKESIIID*PNIIKKYNKHIGG 1606
            KR++ +  P+++      WTKR+I  D G           L SQ LS   P   F  F D+  +  I +ETN Y  QK  N   S    ++K  +GI      +   R R +W    D     V++++  ++FE I + LHF+DN ++         + L I+         P E+  S  E +C        KQ    K  + G+K++   ++ G+   FE  +GT   +TK  D   +LG S  +V+     ++      +      ++                  TVR  R   C L +  ++KK+   S +  +   + + V    W D+ VV +    V   P     R+    K    +  P+++K Y + +GG
Sbjct:  100 KRQKAVVKPQRI------WTKRDIRPDFGSWTASDPHIEDLKSQELS---PVGLFELFFDEGTINFIVNETNRYAWQK--NVNLSLTAQELKCVLGILILSGYISYPRRRMFWETSPDSHHHLVADAIRRDRFELIFSYLHFADNNELDASDRFAKVRPLIIRMNCNFQKHAPLEEFYSFGESMCEYFGHRGSKQLHRGKPVRLGYKIWCGTTSRGYLVWFEPSQGTL--FTK-PDRSLDLGGS--MVIKFVDALQERGFLPYHIFFDKVFTSVKLMSILRKKGVKATGTVREYRTERCPLKDPKELKKMKRGSFDYKVDESEEIIVCR--WHDSSVVNICSNAVGIEPVRLTSRHSGAAKTRTQVHQPSLVKLYQEKVGG 462          

HSP 2 Score: 38.5058 bits (88), Expect = 1.002e-16
Identity = 29/117 (24.79%), Postives = 49/117 (41.88%), Query Frame = -2
Query:  187 VGRYRIPLRSKKWYFRIFCHLIYIITINAWLLFRRATFEKTGEQSRMMLWEFRVEIAKCMCRIGTQNGKRGRPNSIQQGLENKNHKGPTACVPPLDV*TDKIAHWVIYENPRQRCKL 537
            + +Y++ +R  KWY     ++I     NAW L R        + +++ L  FR  IA            +GR +   + LE ++               D I HW+I+++ R RC L
Sbjct:  470 IAKYKVKIRGMKWYSSFIGYVIDAALNNAWQLHRICC-----QDAQVDLLAFRRYIACVYLESNADTTSQGRRS---RRLETESR-------------FDMIGHWIIHQDKRTRCAL 565          
BLAST of SMED30016562 vs. Ensembl Zebrafish
Match: si:ch211-255f4.7 (si:ch211-255f4.7 [Source:ZFIN;Acc:ZDB-GENE-050208-628])

HSP 1 Score: 97.8265 bits (242), Expect = 1.645e-31
Identity = 83/337 (24.63%), Postives = 142/337 (42.14%), Query Frame = -1
Query:  533 TPYKYFAYFLDDEFLQIIYDETNLYGTQKYPNKATSYNINDIKRFIGICEYMSVVRLQRTRCYWREDIGIEDVSNSMSINKFEQINTLHFSDNTKMLDRGHHPIWQNLQIKTKFGSI-PQEDR-----LSIDEQICATKVRHQL--------KQYLPMKHNKWGFKLFVLCSTAGFAYNFEIYKGTKNHYTKRKDDEPE-LGASSNVVVHLARCIKNMKXX-----------XXXXXXXXIYMLETVRRNRIPNCKLMEESQMKKLPXXXXXXXLASIDGVDVTNVGWFDNKVVTLLFTKVRELPNGTVKRYDRKKKESIIID*PNIIKKYNKHIGG 1465
            TP  YF  ++D + +  I + +N     K   +  +   ++I  F G C  MS +R    R YW + + I  +++     KF +          K++    H + ++L++  KF  + P  DR     LS++   CA      +        +QYLPMK N  G K FV  +  G   +FE+Y+GT +   K   +EPE LG    V+  L + +                     +   +YM  T+  NR+   K    S    +          S +   +  V W+DNK V L+       P  T +R+D+  K+ + +  P+I+++YN ++ G
Sbjct:  163 TPLDYFEQYMDRDLMMTIAECSNAMSLSK-SGEPLNVTTDEIYHFFGACILMSCIRYPTIRMYWSKALKITAITD-----KFTRARFFKLRGAIKVVI--DHDVPEDLRMSDKFWKVRPFLDRILQGCLSLNRPDCACIGEQMIPFTGACPYRQYLPMKPNPIGVKNFVCATADGIVLDFELYQGTGSLIGKV--EEPEGLGLGCLVIERLCQTLHRGTKVYCDRFFTTIKGAQRMMEKELYMTGTIMNNRLAGAKHKLPSDKAMISMGRGTSSEVSTEDGKLCVVKWYDNKPVLLMSVIHGTQPEDTCQRWDKNLKQYVTVSRPSIVREYNNNMAG 489          

HSP 2 Score: 59.6918 bits (143), Expect = 1.645e-31
Identity = 41/158 (25.95%), Postives = 77/158 (48.73%), Query Frame = -2
Query:  127 NIINILVGRYRIPLRSKKWYFRIFCHLIYIITINAWLLFRRATFEKTGEQSR-MMLWEFRVEIAKCMCRIGTQNGKRGRPNS-IQQGLENKNHKGPTACVPPLDV*TDKIAHW--VIYENPRQRCKLLG-----------CKVHLCLTKDKNCFLNFH 555
            ++++ ++G YR+  R+KKW  R+  H   +   N+WLL+++    + G ++R +   +FR+E+A  +  +   +G     ++  ++   N+  K     +P + V     AH   +I      RC+ LG           CKV LCL  ++NC+  FH
Sbjct:  491 DLMDRMIGYYRMSTRTKKWTMRMVMHFTDLALANSWLLYQKDHAIRAGTKTRPIQFLQFRMEVATIL--LAQHHGADADLSTHSEEEDSNQGVKRHVTELPHVSVRRRANAHLPEMIGLKNAMRCRQLGCTGRTRVRCMTCKVFLCLQVERNCYSAFH 646          
BLAST of SMED30016562 vs. Ensembl Zebrafish
Match: CABZ01069162.1 (pep scaffold:GRCz11:KN149950.1:74:5493:1 gene:ENSDARG00000115161.1 transcript:ENSDART00000191202.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01069162.1)

HSP 1 Score: 85.1149 bits (209), Expect = 1.715e-16
Identity = 90/359 (25.07%), Postives = 150/359 (41.78%), Query Frame = -1
Query:  533 FKGSSKLPSQILSLD--TPYKYFAYFLDDEFLQIIYDETNLYGTQKYPNKATSY---NINDIKRFIGICEYMSVVRLQRTRCYWRED--IGIEDVSNSMSINKFEQI-NTLHFSD-----------NTKMLDRGHH--PIWQNLQIKTKFGSIPQEDRLSIDEQICATKVRHQLKQYLPMKHNKWGFKLFVLC-STAGFAYNFEIYKGTKNHYTKRKD--------DEPELGASSNVVVHLARCIKNMKXXXXXXXXXXIYMLETVRRNRIPNCKLMEESQMKKLPXXXXXXXLASIDGVDVTNVGWFDNKVVTLLFTKVRELPNGTVKRYDRKKK---ESIIID*PNIIKKYNKHIGG 1510
            F+ + +   Q+++ D  +P + F  F     LQ I   +N Y T++      S+   ++ D+K ++ +  +M ++++     YWR      +   +  MS  KF  I N LH SD            T   DR     P++ N++   +    P ++ +SIDE++ A+K R  LKQY+  K  KWG+KLFVL  S  G+   F +Y+G +                DE  LG    + V                +   IY   T+R NRI   K+       KLP  +    +  I   D+  V W D + V +  T  +      V+R  +       ++ +  P  +  YN+ +GG
Sbjct:  203 FRPAREPGPQLVTTDRYSPLQLFQLFFTPSVLQTIMQHSNAYATKQRQGTDKSWKNISVEDLKSYLALVIFMGLLKVCALTDYWRRSDVYSVPLPTRIMSCRKFLNIANALHLSDPVDDEANEGRKGTAAYDRLGKIKPLYDNIRDACRAFYHPGQN-ISIDERMVASKARSGLKQYMKNKPTKWGYKLFVLADSQCGYTSEFFVYEGKRMSSPNGLSYESVMALIDEKYLGTGYKLYVD---NFYTSPKLFRDLLSKRIYACGTIRPNRIGFPKMA----TNKLPQDAPRGSMRWIREDDLLFVEWKDTREVLMCSTFHKAYGGDIVERKSKDNDGQWSTVHVPIPGAVLDYNRFMGG 553          
BLAST of SMED30016562 vs. Ensembl Zebrafish
Match: pgbd4 (piggyBac transposable element derived 4 [Source:ZFIN;Acc:ZDB-GENE-091204-417])

HSP 1 Score: 78.5666 bits (192), Expect = 1.628e-14
Identity = 64/215 (29.77%), Postives = 106/215 (49.30%), Query Frame = -1
Query:  953 IDKGDLNFKGSSKLPSQILSLDT--PYKYFAYFLDDEFLQIIYDETNLYGTQKYPNKATSY---NINDIKRFIGICEYMSVVRLQRTRCYWR-EDI-GIEDVSNSMSINKFEQIN-TLHFSD------NTKMLDRGHH-------PIWQNLQIKTKFGSIPQEDRLSIDEQICATKVRHQLKQYLPMKHNKWGFKLFVLC-STAGFAYNFEIYKG 1531
            I+   L FK       Q++S  +    +YF  F     +Q I D +N++G  ++  +   +    + D+K FI +  YM +V+    + YWR  D+  +   +  MS  KF  I+  LH SD      N K      +       P++Q+++   K    P ++ +SIDE++ A+K RH L QY+  +  KWG+KLFVL  S   + ++F IY+G
Sbjct:  129 IEPPQLLFKPKRTPGPQLISTASFSVLQYFELFFSQPVMQKIVDHSNIFGAMRHEARKRKWKDITVADLKSFIAMVIYMGIVKCFNLQDYWRMSDVYSLPYPAKIMSRIKFLTISWALHLSDPKVDAENDKKRGTPQYDPLCKIKPLYQDIRDACKASFHPHQN-ISIDERMVASKARHGLIQYI-SEPTKWGYKLFVLADSLCAYTWDFFIYEG 341          

HSP 2 Score: 50.8322 bits (120), Expect = 6.686e-6
Identity = 36/154 (23.38%), Postives = 65/154 (42.21%), Query Frame = -2
Query:  124 KNIINILVGRYRIPLRSKKWYFRIFCHLIYIITINAWLLFRRATFEKTGEQSRMMLWEFRVEIAKCMCRIGTQNGKRGRPNSIQQGLENKNHKGPTACVPPLDV*TDKIAHWVIYENPRQRCKL---------LGCKVHLCLTKDKNCFLNFHQ 558
            +++ N L+G Y +  ++KKWY   F H + I  +NA++L ++    K+  Q  M    FR  +   +  IG+ +    +      GL    +    + V                   R++CKL           C V LCL  ++NC++ +H+
Sbjct:  480 EDVSNALIGYYTVFRQTKKWYRSFFYHFVDIAIVNAFILHQQ--MAKSKNQKAMTQKAFRETLITELTGIGSASTSTPKAPVPTTGLHLPRYISGDSTV------------------GRRKCKLCQLKTPMICATCDVALCLVSNRNCYVKWHE 613          
BLAST of SMED30016562 vs. Ensembl Zebrafish
Match: pgbd4 (piggyBac transposable element derived 4 [Source:ZFIN;Acc:ZDB-GENE-091204-417])

HSP 1 Score: 78.5666 bits (192), Expect = 1.856e-14
Identity = 64/215 (29.77%), Postives = 106/215 (49.30%), Query Frame = -1
Query:  953 IDKGDLNFKGSSKLPSQILSLDT--PYKYFAYFLDDEFLQIIYDETNLYGTQKYPNKATSY---NINDIKRFIGICEYMSVVRLQRTRCYWR-EDI-GIEDVSNSMSINKFEQIN-TLHFSD------NTKMLDRGHH-------PIWQNLQIKTKFGSIPQEDRLSIDEQICATKVRHQLKQYLPMKHNKWGFKLFVLC-STAGFAYNFEIYKG 1531
            I+   L FK       Q++S  +    +YF  F     +Q I D +N++G  ++  +   +    + D+K FI +  YM +V+    + YWR  D+  +   +  MS  KF  I+  LH SD      N K      +       P++Q+++   K    P ++ +SIDE++ A+K RH L QY+  +  KWG+KLFVL  S   + ++F IY+G
Sbjct:  129 IEPPQLLFKPKRTPGPQLISTASFSVLQYFELFFSQPVMQKIVDHSNIFGAMRHEARKRKWKDITVADLKSFIAMVIYMGIVKCFNLQDYWRMSDVYSLPYPAKIMSRIKFLTISWALHLSDPKVDAENDKKRGTPQYDPLCKIKPLYQDIRDACKASFHPHQN-ISIDERMVASKARHGLIQYI-SEPTKWGYKLFVLADSLCAYTWDFFIYEG 341          
BLAST of SMED30016562 vs. Ensembl Zebrafish
Match: si:dkey-19f4.2 (si:dkey-19f4.2 [Source:ZFIN;Acc:ZDB-GENE-121214-262])

HSP 1 Score: 68.5514 bits (166), Expect = 1.787e-11
Identity = 52/150 (34.67%), Postives = 86/150 (57.33%), Query Frame = -1
Query:  935 RFIGICEYMSVVRLQRTRCYWRED--IGIEDVSNSMSINKFEQIN-TLHFS--DNTKMLDR-----GHHPIWQ----NLQIKTKFGSIPQ-EDRLSIDEQICATKVRHQLKQYLPMKHNKWGFKLFVLC-STAGFAYNFEIYKGTKNHYT 1336
            ++IG+  YM++++L R R YWR D  + +    + M+ ++F  I+ T+H S  D+    DR      + P+++     + IK    S+ Q   +++IDE++ ATK +  LKQY+  K  KWG KLFVL  S+ G+  +F IY G K+ +T
Sbjct:  173 KYIGLLIYMALLKLPRVRDYWRRDSHLSVHFPVSVMTRDRFMAISRTVHLSNPDDDIENDRKKGTPDYDPLYRLKPLYITIKDTCKSMWQPRKQIAIDERMVATKAKIALKQYMKAKPIKWGVKLFVLADSSNGYTSDFTIYTG-KSRFT 321          
BLAST of SMED30016562 vs. Ensembl Xenopus
Match: otud7b (OTU deubiquitinase 7B [Source:Xenbase;Acc:XB-GENE-968436])

HSP 1 Score: 73.559 bits (179), Expect = 2.302e-13
Identity = 60/218 (27.52%), Postives = 103/218 (47.25%), Query Frame = -1
Query:  878 PYKYFAYFLDDEFLQIIYDETNLYGTQ-----KYPNKATSY-----NINDIKRFIGICEYMSVVRLQRTRCYWRED--IGIEDVSNSMSINKFEQI-NTLHFSDNTKML-------DRGH--HPIWQNLQIKTKFGSIPQEDRLSIDEQICATKVRHQLKQYLPMKHNKWGFKLFVLC-STAGFAYNFEIYKGTKNHYTKRKDDEPELGASSNVVVHL 1462
            P  +F  F+ +  LQ +   TN+Y  Q       P  A ++     +I ++KRF+G+   M +++      YW     + I   S +MS N+++ +   LHF++N   +       DR H   P+  +L  +      P ++ + IDE +   K R Q +QY+P K  ++G K + LC S++G+   F IY+G K+         P+L  S  +V  L
Sbjct:  114 PINFFQLFMTEAILQDMVLYTNVYAEQYLTQNPLPRYARAHAWHPTDIAEMKRFVGLTLAMGLIKANSLESYWDTTTVLSIPVFSATMSRNRYQLLLRFLHFNNNATAVPPDQPGHDRLHKLRPLIDSLSERFAAVYTPCQN-ICIDESLLLFKGRLQFRQYIPSKRARYGIKFYKLCESSSGYTSYFLIYEG-KDSKLDPPGCPPDLTVSGKIVWEL 329          
BLAST of SMED30016562 vs. Ensembl Xenopus
Match: cldn5 (claudin 5 (transmembrane protein deleted in velocardiofacial syndrome) [Source:Xenbase;Acc:XB-GENE-976044])

HSP 1 Score: 73.9442 bits (180), Expect = 3.523e-13
Identity = 60/218 (27.52%), Postives = 103/218 (47.25%), Query Frame = -1
Query:  878 PYKYFAYFLDDEFLQIIYDETNLYGTQ-----KYPNKATSY-----NINDIKRFIGICEYMSVVRLQRTRCYWRED--IGIEDVSNSMSINKFEQI-NTLHFSDNTKML-------DRGH--HPIWQNLQIKTKFGSIPQEDRLSIDEQICATKVRHQLKQYLPMKHNKWGFKLFVLC-STAGFAYNFEIYKGTKNHYTKRKDDEPELGASSNVVVHL 1462
            P  +F  F+ +  LQ +   TN+Y  Q       P  A ++     +I ++KRF+G+   M +++      YW     + I   S +MS N+++ +   LHF++N   +       DR H   P+  +L  +      P ++ + IDE +   K R Q +QY+P K  ++G K + LC S++G+   F IY+G K+         P+L  S  +V  L
Sbjct:  114 PINFFQLFMTEAILQDMVLYTNVYAEQYLTQNPLPRYARAHAWHPTDIAEMKRFVGLTLAMGLIKANSLESYWDTTTVLSIPVFSATMSRNRYQLLLRFLHFNNNATAVPPDQPGHDRLHKLRPLIDSLSERFAAVYTPCQN-ICIDESLLLFKGRLQFRQYIPSKRARYGIKFYKLCESSSGYTSYFLIYEG-KDSKLDPPGCPPDLTVSGKIVWEL 329          
BLAST of SMED30016562 vs. Ensembl Xenopus
Match: ENSXETT00000039631.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:1:68190968:68192372:-1 gene:ENSXETG00000012484.1 transcript:ENSXETT00000039631.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.9366 bits (167), Expect = 1.097e-11
Identity = 61/219 (27.85%), Postives = 105/219 (47.95%), Query Frame = -1
Query:  878 YFAYFLDDEFLQIIYDETNLYGTQ-----KYPN--KATSYNINDI---KRFIGICEYMSVVRLQRTRCYWRED--IGIEDVSNSMSINKFEQI-NTLHFSDNTKML-------DRGH--HPIWQNLQIKTKFGSIPQEDRLSIDEQICATKVRHQLKQYLPMKHNKWGFKLFVLC-STAGFAYNFEIYKGTKNHYTKRKDDEP----ELGASSNVVVHL 1453
            +F  F+ +  LQ +   TNLY  Q       P   +A +++  DI   KRF+G+   M +V+      YW     + +   S +MS N+++ +   LHF++N   +       DR H   P+  +L  +      P ++ +S+DE +   K R + +QY+P K  ++G K + LC S++G+  +F IY+G  +       D P    +L AS  +V  L
Sbjct:  114 FFHLFVTEAILQDMVLYTNLYAEQFLAQNPLPRFARAQAWHPTDIMEMKRFVGLTLAMGLVKANSLESYWDTTTVLSMPIFSVTMSRNRYQLLLRFLHFNNNATAVPPNEPGHDRLHKLRPLINSLSERFAEMYTPSQN-ISVDESLLLFKGRLKFRQYIPSKRARYGIKFYKLCESSSGYTSHFLIYEGKDSQL-----DPPGCPIDLTASGKIVWEL 326          
BLAST of SMED30016562 vs. Ensembl Xenopus
Match: fibcd1 (fibrinogen C domain containing 1 [Source:Xenbase;Acc:XB-GENE-483361])

HSP 1 Score: 67.3958 bits (163), Expect = 4.065e-11
Identity = 52/190 (27.37%), Postives = 94/190 (49.47%), Query Frame = -1
Query:  953 YFAYFLDDEFLQIIYDETNLYGTQKYPN-------KATSY---NINDIKRFIGICEYMSVVRLQRTRCYWRED--IGIEDVSNSMSINKFE-QINTLHFSDNTKML-------DRGH--HPIWQNLQIKTKFGSIPQEDRLSIDEQICATKVRHQLKQYLPMKHNKWGFKLFVLC-STAGFAYNFEIYKG 1453
            +F  ++ +  LQ +   TNLY  Q   +       +A ++   NIN+IKRF+ +   M +V       YW  +  + I   S  M+ N+++  +  LHF+DNT  +       DR +   P+  +L  +      P ++ + +DE +   K R + +QY+P K +++G K + LC S+ G+   F +Y+G
Sbjct:  123 FFNLYITEAILQDMVRYTNLYAEQYLASNPLPGFSRAQAWYPTNINEIKRFLALTLAMGLVERNSLASYWDTNTVLSIPLFSAVMARNRYQILLRFLHFNDNTTAVAPNEPGYDRLYKLRPLIDSLSQRFAEVYTPSQN-VCVDESLLLFKGRLKFRQYIPSKRSRYGIKFYKLCESSTGYTSYFMLYEG 311          
BLAST of SMED30016562 vs. Ensembl Xenopus
Match: epc1 (enhancer of polycomb homolog 1 [Source:Xenbase;Acc:XB-GENE-493119])

HSP 1 Score: 67.3958 bits (163), Expect = 5.064e-11
Identity = 56/202 (27.72%), Postives = 99/202 (49.01%), Query Frame = -1
Query:  953 LSLDTP----YKYFAYFLDDEFLQIIYDETNLYGTQKYPN-------KATSY---NINDIKRFIGICEYMSVVRLQRTRCYWRED--IGIEDVSNSMSINKFE-QINTLHFSDNTKML-------DRGH--HPIWQNLQIKTKFGSIPQEDRLSIDEQICATKVRHQLKQYLPMKHNKWGFKLFVLC-STAGFAYNFEIYKG 1477
            LS+DT       +F  ++ +  LQ +   TNLY  Q   +       +A ++   NIN+IKRF+ +   M +V       YW  +  + I   S  M+ N+++  +  LHF+DNT  +       DR +   P+  +L  +      P ++ + +DE +   K R + +QY+P K +++G K + LC S+ G+   F +Y+G
Sbjct:  111 LSVDTTNFEIIDFFNLYITEAILQDMVRYTNLYAEQYLASNPLPGFSRAQAWYPTNINEIKRFLALTLAMGLVERNSLASYWDTNTVLSIPLFSAVMARNRYQILLRFLHFNDNTTAVAPNEPGYDRLYKLRPLIDSLSQRFAEVYTPSQN-VCVDESLLLFKGRLKFRQYIPSKRSRYGIKFYKLCESSTGYTSYFMLYEG 311          
BLAST of SMED30016562 vs. Ensembl Mouse
Match: Pgbd1 (piggyBac transposable element derived 1 [Source:MGI Symbol;Acc:MGI:2441675])

HSP 1 Score: 57.3806 bits (137), Expect = 4.152e-8
Identity = 60/203 (29.56%), Postives = 91/203 (44.83%), Query Frame = -1
Query:  977 WTKRNICIDKGDLNFKGSSKLPSQILSLDT----PYKYFAYFLDDEFLQIIYDETNLYGTQKYPNKATSYNINDIKRFIGICEYMSVVRLQRTRCYWR-EDIGIEDVSNSMSINKFEQI-NTLHFSDNTKMLDRGHHPIWQNL-----QIKTKFGSIPQEDRLSIDEQICATKVRHQLKQYLPMKHNKWGFKLFVLCSTAGFA 1552
            WTKR+        NF   S L S +L+L +    P + F  F D E   +I +ETN Y +QK  N +    + +++   G+      VR  R   YW   D     V N +  ++FE I + LHF+DN K LD+     + NL     Q+K      P E+    D+ +C         Q+L  K  + G+K++  C T  +A
Sbjct:  185 WTKRD-----SKPNFPSWSALDSGLLNLKSEKLNPVELFELFFDGETFNLIVNETNNYASQK--NVSLEVTVQEMRCVFGVLLCSGFVRHPRMGMYWEISDSDQTLVRNEIRRDRFELIFSCLHFADN-KHLDQKDK--FSNLRPLIKQMKNFPLVCPPEEYYCFDKSMCEC---FDCDQFLNGKPLQIGYKIW--CGTTNYA 372          
BLAST of SMED30016562 vs. Ensembl Mouse
Match: Pgbd1 (piggyBac transposable element derived 1 [Source:MGI Symbol;Acc:MGI:2441675])

HSP 1 Score: 57.3806 bits (137), Expect = 5.209e-8
Identity = 60/203 (29.56%), Postives = 91/203 (44.83%), Query Frame = -1
Query:  977 WTKRNICIDKGDLNFKGSSKLPSQILSLDT----PYKYFAYFLDDEFLQIIYDETNLYGTQKYPNKATSYNINDIKRFIGICEYMSVVRLQRTRCYWR-EDIGIEDVSNSMSINKFEQI-NTLHFSDNTKMLDRGHHPIWQNL-----QIKTKFGSIPQEDRLSIDEQICATKVRHQLKQYLPMKHNKWGFKLFVLCSTAGFA 1552
            WTKR+        NF   S L S +L+L +    P + F  F D E   +I +ETN Y +QK  N +    + +++   G+      VR  R   YW   D     V N +  ++FE I + LHF+DN K LD+     + NL     Q+K      P E+    D+ +C         Q+L  K  + G+K++  C T  +A
Sbjct:  222 WTKRD-----SKPNFPSWSALDSGLLNLKSEKLNPVELFELFFDGETFNLIVNETNNYASQK--NVSLEVTVQEMRCVFGVLLCSGFVRHPRMGMYWEISDSDQTLVRNEIRRDRFELIFSCLHFADN-KHLDQKDK--FSNLRPLIKQMKNFPLVCPPEEYYCFDKSMCEC---FDCDQFLNGKPLQIGYKIW--CGTTNYA 409          
BLAST of SMED30016562 vs. Ensembl Mouse
Match: Pgbd1 (piggyBac transposable element derived 1 [Source:MGI Symbol;Acc:MGI:2441675])

HSP 1 Score: 57.3806 bits (137), Expect = 5.209e-8
Identity = 60/203 (29.56%), Postives = 91/203 (44.83%), Query Frame = -1
Query:  977 WTKRNICIDKGDLNFKGSSKLPSQILSLDT----PYKYFAYFLDDEFLQIIYDETNLYGTQKYPNKATSYNINDIKRFIGICEYMSVVRLQRTRCYWR-EDIGIEDVSNSMSINKFEQI-NTLHFSDNTKMLDRGHHPIWQNL-----QIKTKFGSIPQEDRLSIDEQICATKVRHQLKQYLPMKHNKWGFKLFVLCSTAGFA 1552
            WTKR+        NF   S L S +L+L +    P + F  F D E   +I +ETN Y +QK  N +    + +++   G+      VR  R   YW   D     V N +  ++FE I + LHF+DN K LD+     + NL     Q+K      P E+    D+ +C         Q+L  K  + G+K++  C T  +A
Sbjct:  222 WTKRD-----SKPNFPSWSALDSGLLNLKSEKLNPVELFELFFDGETFNLIVNETNNYASQK--NVSLEVTVQEMRCVFGVLLCSGFVRHPRMGMYWEISDSDQTLVRNEIRRDRFELIFSCLHFADN-KHLDQKDK--FSNLRPLIKQMKNFPLVCPPEEYYCFDKSMCEC---FDCDQFLNGKPLQIGYKIW--CGTTNYA 409          
BLAST of SMED30016562 vs. UniProt/SwissProt
Match: sp|Q8N328|PGBD3_HUMAN (PiggyBac transposable element-derived protein 3 OS=Homo sapiens OX=9606 GN=PGBD3 PE=1 SV=3)

HSP 1 Score: 92.8189 bits (229), Expect = 2.850e-21
Identity = 91/336 (27.08%), Postives = 147/336 (43.75%), Query Frame = -1
Query:  533 LDTPYKYFAYFLDDEFLQIIYDETNLYGTQKYPNKATSYNINDIKRFIGICEYMSVVRLQRTRCYW--REDIGIEDVSNSMSINKFEQI-NTLHFSDNTKM--LDRGH--HPIWQNLQIKT-KFGSIPQEDRLSIDEQICATKVRHQLKQYLPMKHNKWGFKLFVLCSTAGFAYNFEIYKGTKNHYTKRKDDEPELGASSNVVVHLARCIKNMKXXXXXXXXXXIY---------------MLETVRRNRIPNCKLMEESQMKKLPXXXXXXXLASIDGVDVTNVGWFDNKVVTLLFTKVRELPNGTVKRYDRKKKESIIID*PNIIKKYNKHIGG 1471
            + TP +    FLDDE +++I   +NLY   K          ++ K F+GI      V + R R +W  R D+    VS +M  ++FE I + LH +DN  +  +D+     P+   L  +  KF  +P E   S DE +     RH  KQ++  K  ++G+K +   +  G+   F+ Y+G KN  TK +    E G  +++V+  +  +       +  +    +                  TVR++ I    L  +  +KK            IDG       W DN VVT+  +     P   V RY +K K+ I +  PN+IK YN+ +GG
Sbjct:  139 MRTPTEILELFLDDEVIELIVKYSNLYACSK--GVHLGLTSSEFKCFLGIIFLSGYVSVPRRRMFWEQRTDVHNVLVSAAMRRDRFETIFSNLHVADNANLDPVDKFSKLRPLISKLNERCMKF--VPNETYFSFDEFMVPYFGRHGCKQFIRGKPIRFGYKFWCGATCLGYICWFQPYQG-KNPNTKHE----EYGVGASLVLQFSEALTEAHPGQYHFVFNNFFTSIALLDKLSSMGHQATGTVRKDHIDRVPLESDVALKK---KERGTFDYRIDGKGNIVCRWNDNSVVTVASSGAGIHPLCLVSRYSQKLKKKIQVQQPNMIKVYNQFMGG 462          

HSP 2 Score: 32.7278 bits (73), Expect = 2.850e-21
Identity = 28/115 (24.35%), Postives = 46/115 (40.00%), Query Frame = -2
Query:  193 VGRYRIPLRSKKWYFRIFCHLIYIITINAWLLFRRATFEKTGEQSRMMLWEFRVEIAKCMCRIGTQNGKRGRPNSIQQGLENKNHKGPTACVPPLDV*TDKIAHWVIYENPRQRC 537
            + +YR  +R KKWY         ++  NAW L       KT ++  +   EFR  +   +C     +G    P   Q+G   K +         +D   D I H ++ +  + RC
Sbjct:  470 IDKYRASIRGKKWYSSPLLFCFELVLQNAWQL------HKTYDEKPVDFLEFRRRV---VCHYLETHGHPPEPG--QKGRPQKRN---------IDSRYDGINHVIVKQGKQTRC 564          
BLAST of SMED30016562 vs. UniProt/SwissProt
Match: sp|P0DP91|ERPG3_HUMAN (Chimeric ERCC6-PGBD3 protein OS=Homo sapiens OX=9606 GN=ERCC6 PE=1 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 2.611e-20
Identity = 89/336 (26.49%), Postives = 144/336 (42.86%), Query Frame = -1
Query:  533 LDTPYKYFAYFLDDEFLQIIYDETNLYGTQKYPNKATSYNINDIKRFIGICEYMSVVRLQRTRCYWREDIGIEDV--SNSMSINKFEQI-NTLHFSDNTKM--LDRGH--HPIWQNLQIKT-KFGSIPQEDRLSIDEQICATKVRHQLKQYLPMKHNKWGFKLFVLCSTAGFAYNFEIYKGTKNHYTKRKDDEPELGASSNVVVHLARCIKNMKXXX---------------XXXXXXXIYMLETVRRNRIPNCKLMEESQMKKLPXXXXXXXLASIDGVDVTNVGWFDNKVVTLLFTKVRELPNGTVKRYDRKKKESIIID*PNIIKKYNKHIGG 1471
            + TP +    FLDDE +++I   +NLY   K          ++ K F+GI      V + R R +W +   + +V  S +M  ++FE I + LH +DN  +  +D+     P+   L  +  KF  +P E   S DE +     RH  KQ++  K  ++G+K +   +  G+   F+ Y+G KN  TK +    E G  +++V+  +  +                                  TVR++ I    L  +  +KK            IDG       W DN VVT+  +     P   V RY +K K+ I +  PN+IK YN+ +GG
Sbjct:  607 MRTPTEILELFLDDEVIELIVKYSNLYACSK--GVHLGLTSSEFKCFLGIIFLSGYVSVPRRRMFWEQRTDVHNVLVSAAMRRDRFETIFSNLHVADNANLDPVDKFSKLRPLISKLNERCMKF--VPNETYFSFDEFMVPYFGRHGCKQFIRGKPIRFGYKFWCGATCLGYICWFQPYQG-KNPNTKHE----EYGVGASLVLQFSEALTEAHPGQYHFVFNNFFTSIALLDKLSSMGHQATGTVRKDHIDRVPLESDVALKK---KERGTFDYRIDGKGNIVCRWNDNSVVTVASSGAGIHPLCLVSRYSQKLKKKIQVQQPNMIKVYNQFMGG 930          

HSP 2 Score: 32.3426 bits (72), Expect = 2.611e-20
Identity = 28/115 (24.35%), Postives = 46/115 (40.00%), Query Frame = -2
Query:  193 VGRYRIPLRSKKWYFRIFCHLIYIITINAWLLFRRATFEKTGEQSRMMLWEFRVEIAKCMCRIGTQNGKRGRPNSIQQGLENKNHKGPTACVPPLDV*TDKIAHWVIYENPRQRC 537
            + +YR  +R KKWY         ++  NAW L       KT ++  +   EFR  +   +C     +G    P   Q+G   K +         +D   D I H ++ +  + RC
Sbjct:  938 IDKYRASIRGKKWYSSPLLFCFELVLQNAWQLH------KTYDEKPVDFLEFRRRV---VCHYLETHGHPPEPG--QKGRPQKRN---------IDSRYDGINHVIVKQGKQTRC 1032          
BLAST of SMED30016562 vs. UniProt/SwissProt
Match: sp|Q96JS3|PGBD1_HUMAN (PiggyBac transposable element-derived protein 1 OS=Homo sapiens OX=9606 GN=PGBD1 PE=1 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 8.918e-20
Identity = 89/361 (24.65%), Postives = 155/361 (42.94%), Query Frame = -1
Query:  545 WTKRNICIDKGDLNFKGSSKLPSQILSLDT----PYKYFAYFLDDEFLQIIYDETNLYGTQKYPNKATSYNINDIKRFIGICEYMSVVRLQRTRCYWR-EDIGIEDVSNSMSINKFEQI-NTLHFSDNTKMLDRGH----HPIWQNLQIKTKFGSIPQEDRLSIDEQICATKVRHQLKQYLPMKHNKWGFKLFVLCSTAGFAYNFEIYKGTKNHYTKRKDDEPELGASSNVVVHLAR------------CIKNMKXXXXXXXXXXIYMLE---TVRRNRIPNCKLMEESQMKKLPXXXXXXXLASIDGVDVTNVGWFDNKVVTLLFTKVRELPNGTVKRYDRKKKESIIID*PNIIKKYNK 1552
            WTKR+I       NF   S L S +L+L +    P + F  F DDE   +I +ETN Y +QK  N +    + +++   G+      +R  R   YW   D     V +++  ++FE I + LHF+DN  +  +       P+ + +  K      P E+    D+ +C         Q+L  K  + G+K++   +T G+   FE Y   +   T + D++P+LG   N+V++ A             C  +   S+ +        +    T+R NR   C LM    MKK+     +  +   +  ++    W+ + +++L    V   P   V   D   +E   I  P+I+K Y++
Sbjct:  390 WTKRDI-----KPNFPSWSALDSGLLNLKSEKLNPVELFELFFDDETFNLIVNETNNYASQK--NVSLEVTVQEMRCVFGVLLLSGFMRHPRREMYWEVSDTDQNLVRDAIRRDRFELIFSNLHFADNGHLDQKDKFTKLRPLIKQMN-KNFLLYAPLEEYYCFDKSMCEC---FDSDQFLNGKPIRIGYKIWCGTTTQGYLVWFEPY---QEESTMKVDEDPDLGLGGNLVMNFADVLLERGQYPYHLCFDSFFTSVKLLSALKKKGVRATGTIRENRTEKCPLMNVEHMKKMKRGYFDFRIE--ENNEIILCRWYGDGIISLCSNAVGIEPVNEVSCCDADNEEIPQISQPSIVKVYDE 734          

HSP 2 Score: 36.5798 bits (83), Expect = 8.918e-20
Identity = 14/38 (36.84%), Postives = 25/38 (65.79%), Query Frame = -2
Query:  436 INILVGRYRIPLRSKKWYFRIFCHLIYIITINAWLLFR 549
            ++ ++ +YR+ +RSKKWY  +  ++I +   NAW L R
Sbjct:  742 MDQIISKYRVRIRSKKWYSILVSYMIDVAMNNAWQLHR 779          
BLAST of SMED30016562 vs. UniProt/SwissProt
Match: sp|Q6P3X8|PGBD2_HUMAN (PiggyBac transposable element-derived protein 2 OS=Homo sapiens OX=9606 GN=PGBD2 PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 4.422e-16
Identity = 91/381 (23.88%), Postives = 154/381 (40.42%), Query Frame = -1
Query:  533 KRERLIFHPKKVVHRNILWTKRNICIDKGDLNFKGS--SKLPSQILSLDTPYKYFAYFLDDEFLQIIYDETNLYGTQKYPNKATSYNINDIKRFIGICEYMSVVRLQRTRCYWR--EDIGIEDVSNSMSINKFEQI-NTLHFSDNTKMLDRGHHPIWQNLQIKTKFG---SIPQEDRLSIDEQICATKVRHQLKQYLPMKHNKWGFKLFVLCSTAGFAYNFEIYKGTKNHYTKRKDDEPELGASSNVVVHLARCIKNMKXXXXXXXXXXIY---------------MLETVRRNRIPNCKLMEESQMKKLPXXXXXXXLASIDGVDVTNVGWFDNKVVTLLFTKVRELPNGTVKRYDRKKKESIIID*PNIIKKYNKHIGG 1606
            KR++ +  P+++      WTKR+I  D G           L SQ LS   P   F  F D+  +  I +ETN Y  QK  N   S    ++K  +GI      +   R R +W    D     V++++  ++FE I + LHF+DN ++         + L I+         P E+  S  E +C        KQ    K  + G+K++   ++ G+   FE  +GT   +TK  D   +LG S  +V+     ++      +      ++                  TVR  R   C L +  ++KK+   S +  +   + + V    W D+ VV +    V   P     R+    K    +  P+++K Y + +GG
Sbjct:  100 KRQKAVVKPQRI------WTKRDIRPDFGSWTASDPHIEDLKSQELS---PVGLFELFFDEGTINFIVNETNRYAWQK--NVNLSLTAQELKCVLGILILSGYISYPRRRMFWETSPDSHHHLVADAIRRDRFELIFSYLHFADNNELDASDRFAKVRPLIIRMNCNFQKHAPLEEFYSFGESMCEYFGHRGSKQLHRGKPVRLGYKIWCGTTSRGYLVWFEPSQGTL--FTK-PDRSLDLGGS--MVIKFVDALQERGFLPYHIFFDKVFTSVKLMSILRKKGVKATGTVREYRTERCPLKDPKELKKMKRGSFDYKVDESEEIIVCR--WHDSSVVNICSNAVGIEPVRLTSRHSGAAKTRTQVHQPSLVKLYQEKVGG 462          

HSP 2 Score: 38.5058 bits (88), Expect = 4.422e-16
Identity = 29/117 (24.79%), Postives = 49/117 (41.88%), Query Frame = -2
Query:  187 VGRYRIPLRSKKWYFRIFCHLIYIITINAWLLFRRATFEKTGEQSRMMLWEFRVEIAKCMCRIGTQNGKRGRPNSIQQGLENKNHKGPTACVPPLDV*TDKIAHWVIYENPRQRCKL 537
            + +Y++ +R  KWY     ++I     NAW L R        + +++ L  FR  IA            +GR +   + LE ++               D I HW+I+++ R RC L
Sbjct:  470 IAKYKVKIRGMKWYSSFIGYVIDAALNNAWQLHRICC-----QDAQVDLLAFRRYIACVYLESNADTTSQGRRS---RRLETESR-------------FDMIGHWIIHQDKRTRCAL 565          
BLAST of SMED30016562 vs. UniProt/SwissProt
Match: sp|Q96DM1|PGBD4_HUMAN (PiggyBac transposable element-derived protein 4 OS=Homo sapiens OX=9606 GN=PGBD4 PE=2 SV=3)

HSP 1 Score: 56.9954 bits (136), Expect = 6.391e-7
Identity = 53/224 (23.66%), Postives = 98/224 (43.75%), Query Frame = -1
Query:  953 WTKRNICIDKGDLNFKGSSKLPSQILSLDTPYKYFAYFLDDEFLQIIYDETNLYGT---QKYP--------NKATSYNINDIKRFIGICEYMSVVRLQRTRCYW--REDIGIEDVSNSMSINKFEQI-NTLHFSDNTKMLDRGHHPIWQNLQ--------IKTKFGSIPQEDR-LSIDEQICATKVRHQLKQYLPMKHNKWGFKLFVLC-STAGFAYNFEIYKG 1552
            W+ R + I +   +F G+      +  +  P +YF  F  +E +  I  ETN        K P        +K    + +++K F  +     +V+      +W  R  +    +   M+  +F  +   LHF +N+  +  G      +LQ        +  KF ++   +R +++DE +   K    +KQYLP K  ++G KL+VLC S +G+ +N  ++ G
Sbjct:   75 WSARAM-IPRQRYDFTGTPGRKVDVSDITDPLQYFELFFTEELVSKITRETNAQAALLASKPPGPKGFSRMDKWKDTDNDELKVFFAVMLLQGIVQKPELEMFWSTRPLLDTPYLRQIMTGERFLLLFRCLHFVNNSS-ISAGQSKAQISLQKIKPVFDFLVNKFSTVYTPNRNIAVDESLMLFKGPLAMKQYLPTKRVRFGLKLYVLCESQSGYVWNALVHTG 296          
BLAST of SMED30016562 vs. TrEMBL
Match: A0A4Y2RTV0 (PiggyBac transposable element-derived protein 2 OS=Araneus ventricosus OX=182803 GN=PGBD2_6 PE=4 SV=1)

HSP 1 Score: 289.656 bits (740), Expect = 3.716e-104
Identity = 172/396 (43.43%), Postives = 243/396 (61.36%), Query Frame = -1
Query:  533 NKKMNKTSQSVFNLSKRERLIFHPKKVVHRNILWTKRNICIDKGDLNFKGSSKLPSQILSLDTPYKYFAYFLDDEFLQIIYDETNLYGTQKYPNKATSYNINDIKRFIGICEYMSVVRLQRTRCYWREDIGIEDVSNSMSINKFEQINT-LHFSDNTKMLDRGH---------HPIWQNLQIKTKFGSIPQEDRLSIDEQICATKVRHQLKQYLPMKHNKWGFKLFVLCSTAGFAYNFEIYKGTKNHYTKRKDDEPELGASSNVVVHLARCI-KNMKXXX-----XXXXXXXIYM-------LETVRRNRIPNCKLMEESQMKKLPXXXXXXXLASIDGVDVTNVGWFDNKVVTLLFTKVRELPNGTVKRYDRKKKESIIID*PNIIKKYNKHIGG 1651
            NKK  K S +V N+S +  +   PK        W KRN+ I + D  FKG+ + P +I++L+TP+++  YFL DE  Q I DE+ LY  QK PN A      D+++++GIC   SV +    R +W + +G+E V N+MS+N FE+  + LHF++N K + RG           P+  +L ++T F S+  E+ LSIDEQ+CATKV+H L+QY+  K +KWG+KLFVLCST+GFAYNFEIY G +N    R   EP+LGASSNVVV L R I K+M   L     +  +  ++Y+       L T RRNRIPNCKL  E ++KK P  SS+E + ++DGVDV++V W DN+ V  L T   ++P   VKR++R  K    +D P ++  YNKH+GG
Sbjct:   97 NKKKTKRSTNVTNVSSKPEV---PK------YTWKKRNLFISENDKKFKGNLEYPDKIINLETPFQFVKYFLTDELFQKILDESMLYAFQKDPNSAFQITKTDLQKYLGICLLTSVTQNSNVRDFWNDVVGMELVKNTMSLNNFEKFRSNLHFNNNEKEVRRGEPGHDKLFKIRPVINSL-LET-FSSVRFEESLSIDEQMCATKVKHHLRQYMKNKPHKWGYKLFVLCSTSGFAYNFEIYSGQENSPESRLPTEPDLGASSNVVVRLTRDIPKHMNHKLYFDNYYSCVPLLVYLHKQGILSLGTARRNRIPNCKLPTEKELKKFPRGSSDEFVTNVDGVDVSSVIWKDNRCVVFLSTFTAKMPEKKVKRFERSTKTHKEVDCPEVVTVYNKHMGG 481          

HSP 2 Score: 120.939 bits (302), Expect = 3.716e-104
Identity = 62/156 (39.74%), Postives = 92/156 (58.97%), Query Frame = -2
Query:  127 NIINILVGRYRIPLRSKKWYFRIFCHLIYIITINAWLLFRRATFEKTGEQSRMMLWEFRVEIAKCMCRIGTQNG-KRGRP-NSIQQGLENKNHKGPTACVPPLDV*TDKIAHWVIYENPRQRCKLLGCK-----------VHLCLTKDKNCFLNFH 555
            ++++  +GR+RI +++KKWYFR+F HLI +  INAW+L++  + +K  +   +    FR E+A+  C++G     KRGRP N +Q+ LE K  K P   VPP D+  D + HW  + + R RCK+ GC            V LC  KDKNC+ NFH
Sbjct:  483 DLLDSHLGRHRIRMKAKKWYFRLFYHLIDLAIINAWILYKEVSLQKDPKAKVLNQKLFRTEVAEIFCKMGKSGALKRGRPSNEVQRQLETK-KKCPRVVVPPKDLRQDAVDHWPNWNSKRNRCKMPGCNGFTYVSCTKCLVFLCFNKDKNCYQNFH 637          
BLAST of SMED30016562 vs. TrEMBL
Match: A0A4Y2V1V6 (PiggyBac transposable element-derived protein 2 OS=Araneus ventricosus OX=182803 GN=PGBD2_9 PE=4 SV=1)

HSP 1 Score: 285.419 bits (729), Expect = 1.896e-102
Identity = 163/363 (44.90%), Postives = 228/363 (62.81%), Query Frame = -1
Query:  533 WTKRNICIDKGDLNFKGSSKLPSQILSLDTPYKYFAYFLDDEFLQIIYDETNLYGTQKYPNKATSYNINDIKRFIGICEYMSVVRLQRTRCYWREDIGIEDVSNSMSINKFEQINT-LHFSDNTKMLDRGH---------HPIWQNLQIKTKFGSIPQEDRLSIDEQICATKVRHQLKQYLPMKHNKWGFKLFVLCSTAGFAYNFEIYKGTKNHYTKRKDDEPELGASSNVVVHLARCI-KNMKXXX-----XXXXXXXIYM-------LETVRRNRIPNCKLMEESQMKKLPXXXXXXXLASIDGVDVTNVGWFDNKVVTLLFTKVRELPNGTVKRYDRKKKESIIID*PNIIKKYNKHIGG 1552
            W KRN+ I + D  FKG+ + P +I++L+TP+++  YFL DE  Q I DE+ LY  QK PN        D+++++GIC   SV +    R +W + +G+E V N+MS+N FE+  + LHF++N K + RG           P+  +L ++T F S+  E+ LSIDEQ+CATKV+H L+QY+  K +KWG+KLFVLCST+GFAYNFEIY G +N    R   EP+LGASSNVVV L R I KNM   L     +  +  ++Y+       L T RRNRIPNCKL  E ++KK P  SS+E + ++DGVDV++V W DN+ V  L T   +LP   VKR++R  K    +D P ++  YNKH+GG
Sbjct:    5 WKKRNLFISENDKKFKGNLEYPDKIINLETPFQFVKYFLTDELFQKILDESMLYAFQKDPNSVFQITKTDLQKYLGICLLTSVTQNSNVRDFWNDVVGMELVKNTMSLNNFEKFRSNLHFNNNEKEIRRGEPGHDKLFKIRPVINSL-LET-FSSVRFEESLSIDEQMCATKVKHHLRQYMKNKPHKWGYKLFVLCSTSGFAYNFEIYSGQENSPESRLPTEPDLGASSNVVVKLTRDIPKNMNHKLYFDNYYSCVPLLVYLHKQGILSLGTARRNRIPNCKLPTEKELKKFPRGSSDEFVTNVDGVDVSSVIWKDNRCVVFLSTFTAKLPEKKVKRFERSTKTHKEVDCPEVVTVYNKHMGG 365          

HSP 2 Score: 119.783 bits (299), Expect = 1.896e-102
Identity = 62/156 (39.74%), Postives = 91/156 (58.33%), Query Frame = -2
Query:  127 NIINILVGRYRIPLRSKKWYFRIFCHLIYIITINAWLLFRRATFEKTGEQSRMMLWEFRVEIAKCMCRIGTQNG-KRGRP-NSIQQGLENKNHKGPTACVPPLDV*TDKIAHWVIYENPRQRCKLLGCK-----------VHLCLTKDKNCFLNFH 555
            ++++  +GR+RI +++KKWYFR+F HLI +  INAW+L++  + +K  +   +    FR E+A+  C++G     KRGRP N +Q+ LE K  K P   VPP D+  D + HW  +   R RCK+ GC            V LC  KDKNC+ NFH
Sbjct:  367 DLLDSHLGRHRIRMKAKKWYFRLFYHLIDLAIINAWILYKEVSLQKDPKAKVLNQKLFRTEVAEIFCKMGKSGALKRGRPSNEVQRQLETKK-KCPRVVVPPKDLRQDAVDHWPNWNGKRNRCKMPGCNGFTYVSCTKCLVFLCFNKDKNCYQNFH 521          
BLAST of SMED30016562 vs. TrEMBL
Match: A0A4Y2PAH3 (PiggyBac transposable element-derived protein 2 OS=Araneus ventricosus OX=182803 GN=PGBD2_7 PE=4 SV=1)

HSP 1 Score: 284.648 bits (727), Expect = 2.623e-102
Identity = 162/363 (44.63%), Postives = 229/363 (63.09%), Query Frame = -1
Query:  533 WTKRNICIDKGDLNFKGSSKLPSQILSLDTPYKYFAYFLDDEFLQIIYDETNLYGTQKYPNKATSYNINDIKRFIGICEYMSVVRLQRTRCYWREDIGIEDVSNSMSINKFEQINT-LHFSDNTKMLDRGH---------HPIWQNLQIKTKFGSIPQEDRLSIDEQICATKVRHQLKQYLPMKHNKWGFKLFVLCSTAGFAYNFEIYKGTKNHYTKRKDDEPELGASSNVVVHLARCI-KNMKXXX-----XXXXXXXIYM-------LETVRRNRIPNCKLMEESQMKKLPXXXXXXXLASIDGVDVTNVGWFDNKVVTLLFTKVRELPNGTVKRYDRKKKESIIID*PNIIKKYNKHIGG 1552
            W KRN+ I + D  FKG+ + P +I++L+TP+++  YFL DE  Q I DE+ LY  QK PN A      D+++++GIC   SV +    R +W + +G+E V N+MS+N FE+  + LHF++N K + RG           P+  +L ++T F S+  E+ LSIDEQ+CATKV+H L+QY+  K +KWG+KLFVLCST+GFAYNFEIY G +N    R   EP+LGASSNVVV L R I K+M   L     +  +  ++Y+       L T RRNRIPNCKL  E ++KK P  SS+E + ++DGVDV++V W DN+ V  L T   ++P   VKR++R  K    +D P ++  YNKH+GG
Sbjct:    5 WKKRNLFISENDKKFKGNLEYPDKIINLETPFQFVKYFLTDELFQKILDESMLYAFQKDPNSAFQITKTDLQKYLGICLLTSVTQNSNVRDFWNDVVGMELVKNTMSLNNFEKFRSNLHFNNNEKEVRRGEPGHDKLFKIRPVINSL-LET-FSSVRFEESLSIDEQMCATKVKHHLRQYMKNKPHKWGYKLFVLCSTSGFAYNFEIYSGQENSPESRLPTEPDLGASSNVVVRLTRDIPKHMNHKLYFDNYYSCVPLLVYLHKQGILSLGTARRNRIPNCKLPTEKELKKFPRGSSDEFVTNVDGVDVSSVIWKDNRCVVFLSTFTAKMPEKKVKRFERSTKTHKEVDCPEVVTVYNKHMGG 365          

HSP 2 Score: 119.783 bits (299), Expect = 2.623e-102
Identity = 62/156 (39.74%), Postives = 91/156 (58.33%), Query Frame = -2
Query:  127 NIINILVGRYRIPLRSKKWYFRIFCHLIYIITINAWLLFRRATFEKTGEQSRMMLWEFRVEIAKCMCRIGTQNG-KRGRP-NSIQQGLENKNHKGPTACVPPLDV*TDKIAHWVIYENPRQRCKLLGCK-----------VHLCLTKDKNCFLNFH 555
            ++++  +GR+RI +++KKWYFR+F HLI +  INAW+L++  + +K  +   +    FR E+A+  C++G     KRGRP N +Q+ LE K  K P   VPP D+  D + HW  +   R RCK+ GC            V LC  KDKNC+ NFH
Sbjct:  367 DLLDSHLGRHRIRMKAKKWYFRLFYHLIDLAIINAWILYKEVSLQKDPKAKVLNQKLFRTEVAEIFCKMGKSGALKRGRPSNEVQRQLETKK-KCPRVVVPPKDLRQDAVDHWPNWNGKRNRCKMPGCNGFTYVSCTKCLVFLCFNKDKNCYQNFH 521          
BLAST of SMED30016562 vs. TrEMBL
Match: J9LW60 (DDE_Tnp_1_7 domain-containing protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=2)

HSP 1 Score: 256.529 bits (654), Expect = 4.652e-92
Identity = 150/365 (41.10%), Postives = 217/365 (59.45%), Query Frame = -1
Query:  533 RNILWTKRNICIDKGDLNFKGSSKLPSQILSLDTPYKYFAYFLDDEFLQIIYDETNLYGTQKYPNKATSYNINDIKRFIGICEYMSVVRLQRTRCYWREDIGIEDVSNSMSINKFEQINT-LHFSDN---TKMLDRGH----HPIWQNLQIKTKFGSIPQEDRLSIDEQICATKVRHQLKQYLPMKHNKWGFKLFVLCSTAGFAYNFEIYKGTKNHYTKRKDDEPELGASSNVVVHLARCI---KNMKXXXXXXXXXXIYM----------LETVRRNRIPNCKLMEESQMKKLPXXXXXXXLASIDGVDVTNVGWFDNKVVTLLFTKVRELPNGTVKRYDRKKKESIIID*PNIIKKYNKHIGG 1564
            +N++WT+ N  +   D NF G+S LP+ IL L+TP++ F YF  ++ +  I  ET  YG QK  +     N  D++++IG+   MSVV     R YW   +G + + N+MS+N FE+I   LHF+DN   +   DR       P+ + L IK +F SIP E+ L++DEQIC+TK R+  K Y+P K +KWG+K FVL   +GFAYNFE + G +N+   RK  EP+LGAS+NVVV L+R I   +N K+        +  +          L TVRRNR+ N KL ++S + K P  ++   L+++ G D+  V W D K+V+LL T     P   V R+DRK+K+ I +D PNII+ YNKH+GG
Sbjct:  159 KNVIWTEGNFPVI--DTNFLGNSDLPNDILELETPFQIFKYFFTNDLMDHICSETYKYGVQKNSSNPLKINNEDLQKYIGVLTIMSVVTTSNIRNYWSSVLGNDQIKNTMSVNVFEKIRANLHFNDNLLASTGPDRDKIYKIRPLIETL-IK-RFSSIPIEENLAVDEQICSTKARNSYKVYMPNKPHKWGYKFFVLSGASGFAYNFEFFAGQENNSEGRKASEPDLGASANVVVRLSRAIPKNQNFKLFFDNYYTTLPLLVYLKKNNILSLGTVRRNRLKNVKLPDDSVLMKQPRGTTAHCLSNVLGTDIVAVTWKDTKIVSLLSTFAAVEPVVKVSRFDRKQKKRIEVDCPNIIQVYNKHMGG 519          

HSP 2 Score: 113.62 bits (283), Expect = 4.652e-92
Identity = 62/157 (39.49%), Postives = 91/157 (57.96%), Query Frame = -2
Query:  127 NIINILVGRYRIPLRSKKWYFRIFCHLIYIITINAWLLFRRATFEKTGEQSRMMLWEFRVEIAKCMCRIGTQNGKRGRP-NSIQQGLENKNHKGPTAC--VPPLDV*TDKIAHWVIYENPRQRCKLLGCK-----------VHLCLTKDKNCFLNFH 555
            ++++ L+GR++I +RS+KWY R+F HL+ +  +N+WLL +R   +K G  + + L +FR E+A  +C+IGT   KRGRP N +Q+G+  K   G       PP DV TD+I HW +  + R RCK  GCK           V LC  K   CF  +H
Sbjct:  521 DLLDGLLGRHKIKMRSRKWYIRVFYHLLDVTIVNSWLLHKRIQKQK-GNNTVLPLVKFREELAVSLCKIGTYTPKRGRPTNDVQEGITKKAKMGTKIGQHAPPKDVRTDRIDHWPVDNSKRTRCKKPGCKGITYMMCGKCQVSLCCGKGLTCFTKWH 676          
BLAST of SMED30016562 vs. TrEMBL
Match: A0A4Y2IS59 (Chimeric ERCC6-PGBD3 protein OS=Araneus ventricosus OX=182803 GN=CSB-PGBD3_9 PE=4 SV=1)

HSP 1 Score: 258.07 bits (658), Expect = 4.891e-92
Identity = 148/362 (40.88%), Postives = 211/362 (58.29%), Query Frame = -1
Query:  536 ILWTKRNICIDKGDLNFKGSSKLPSQILSLDTPYKYFAYFLDDEFLQIIYDETNLYGTQKYPNKATSYNINDIKRFIGICEYMSVVRLQRTRCYWREDIGIEDVSNSMSINKFEQI-NTLHFSDNTKMLDR---GHHPIWQNLQI----KTKFGSIPQEDRLSIDEQICATKVRHQLKQYLPMKHNKWGFKLFVLCSTAGFAYNFEIYKGTKNHYTKRKDDEPELGASSNVVVHLARCI---KNMKX---XXXXXXXXXIYMLE-------TVRRNRIPNCKLMEESQMKKLPXXXXXXXLASIDGVDVTNVGWFDNKVVTLLFTKVRELPNGTVKRYDRKKKESIIID*PNIIKKYNKHIG 1558
            ILW K++         F G + LP  IL L TPY++F YF  DE +  I DETNLY TQK PNK     + DI +FIGIC   S+      R  W +  GI+ V  +MS   FE++ ++LHF+DN K  D     H  +++   I      +  S+P  +RLSIDEQ+CATK RH +K Y+  K +KWG+KL+VLC   GFA+ FEIY G +N    R+D EP++GAS NVV+ L+R I   +N K+     + ++   +Y+ +       T++RNRIPNCK   + ++KK P   SEE   + + VD++ V + DN  V  L T V E+P   V+R+DRKKK+ I++  P ++  YN H+G
Sbjct:  117 ILWKKQSTKFSGEPFLFTGHNALPQSILQLSTPYQFFKYFFTDEIVSKIADETNLYSTQKNPNKPVDCTVYDIHKFIGICILSSLAPPTCVRDLWNDVYGIDLVKETMSQTHFEKLHSSLHFNDNAKTPDHQSPDHDKLYKIRPILDYLNQRCLSVPMSERLSIDEQMCATKARHHMKMYMKDKPHKWGYKLYVLCGDMGFAHKFEIYSGQENDPKFRRDGEPDIGASGNVVIRLSREIPRNQNYKLYFDRYYSSLNLSVYLFQQGIQCVGTIQRNRIPNCKFRNDQELKKEPRGFSEEFSTNFESVDISTVLYKDNSNVAFLSTFVGEMPKSEVRRFDRKKKQHIMVPCPAVVSVYNSHMG 478          

HSP 2 Score: 112.079 bits (279), Expect = 4.891e-92
Identity = 61/154 (39.61%), Postives = 85/154 (55.19%), Query Frame = -2
Query:  127 NIINILVGRYRIPLRSKKWYFRIFCHLIYIITINAWLLFRRATFEKTGEQSRMMLWEFRVEIAKCMCRIGTQNGKRGRPNSIQQGLENKNHKGPTACVPPLDV*TDKIAHWVIYENPRQRCKLLG-----------CKVHLCLTKDKNCFLNFH 555
            ++++  +GR+ I +RSK+WY R+F HL+  I INAW+L+RR   E       M    FR  +A+ +CR+G +  KRGRP S    +E K  K   + +P  DV  D + HW I+   R  CK              CKV+LCL KDKNCF +FH
Sbjct:  481 DLLDSNIGRHHIKVRSKRWYMRLFFHLVDTIVINAWILYRRMLKETDRTDPSMTQKMFRNILAETLCRVGPELKKRGRP-STSDPIETKRIKHKGSSLPTKDVRLDPLNHWPIWNAKRTTCKHPNCKGYTYVMCEKCKVNLCLNKDKNCFRSFH 633          
BLAST of SMED30016562 vs. Ensembl Cavefish
Match: ENSAMXT00000050536.1 (pep primary_assembly:Astyanax_mexicanus-2.0:13:5592952:5596608:-1 gene:ENSAMXG00000038142.1 transcript:ENSAMXT00000050536.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 166.007 bits (419), Expect = 2.014e-61
Identity = 110/347 (31.70%), Postives = 184/347 (53.03%), Query Frame = -1
Query:  533 KGSSKLPSQILSLDTPYKYFAYFLDDEFLQIIYDETNLYGTQKYPNKATSYNINDIKRFIGICEYMSVVRLQRTRCYWREDIGIEDVSNSMSINKFEQINT-LHFSDNTKML---DRGHHPIWQ-----NLQIKTKFGSIPQEDRLSIDEQICATKVRHQLKQYLPMKHNKWGFKLFVLCSTAGFAYNFEIYKGTKNHYTKRKDDEPELGASSNVVVHLARCI---KNMKX----------XXXXXXXXXIYMLETVRRNRIPNCKLMEESQMKKLPXXXXXXXLASIDGVDVTNVGWFDNKVVTLLFTKVRELPNGTVKRYDRKKKESIIID*PNIIKKYNKHIGG 1507
            K + +LPS +  + TP +YF      E L+ I +++NLY  QK  N   + +  ++++FIG+  +MS+  +  TR  W+    I+ +++ M + ++EQI   +HF+DN+  L   +    P+++     N  + T   +IP ++ LS+DEQI   K + +LK Y P K +KWG+K+++LC + G AYNFE + G            P+LGASSN+V+ +A  +   +N K+                   IY L TVR NR+  C L  +  +K +   + +E +A+ +G  +    W DN+ VT+L T     P   VKR+DRK  +   +  P+ +  YNK++GG
Sbjct:    1 KLTGQLPS-VSEVLTPTEYFRQMFTPECLRHIVEQSNLYSVQKDVNSPLNCSEKELEQFIGVAFHMSIYGIPATRMCWQAGTRIDKIADVMPMRRWEQIKANIHFNDNSLDLSPTNPCRDPLFKLRPLLNFALDT-MNNIPMDEHLSVDEQIIPYKGKSRLKLYNPSKPHKWGYKVYLLCDSKGIAYNFEFHTGKIQPLI----GMPDLGASSNIVLRVASIVPQGQNFKLYHDNWFTSTGLEMEMAKKKIYCLGTVRANRLKGCSLKSDKDLKTIGRGAFDEKVATFEGGQLIACKWQDNRTVTMLSTFAGAYPTCKVKRWDRKLSKVTDVQCPSSVVTYNKNMGG 341          

HSP 2 Score: 91.2781 bits (225), Expect = 2.014e-61
Identity = 54/145 (37.24%), Postives = 79/145 (54.48%), Query Frame = -2
Query:  127 LRSKKWYFRIFCHLIYIITINAWLLFRR---ATFEKTGEQSRMMLWEFRVEIAKCMCRIGTQNG-KRGRPNSIQQGLENKNHKGPTACVPPLDV*TDKIAHWVIYENPRQRCKLLGCK-----------VHLCLTKDKNCFLNFH 516
            +RS+KWY RIF HL+ ++ +NAWLL+RR   A  +K  E+  + L EF+  +A+ +C+ G+ +  KRGRP+S    +  +  +      P  +V  D +AHW  Y + + RCK  GC            VHLC T  KNC   FH
Sbjct:  342 IRSRKWYLRIFFHLMDMLCVNAWLLYRRDYHACVQKGKEE--LGLREFKSSVAEVLCKQGSSSQLKRGRPSSESSDMRRQKKR---ETKPQQEVRKDGMAHWPYYSDKQGRCKKHGCTGQTRVMCEKCGVHLCFTPKKNCLRYFH 481          
BLAST of SMED30016562 vs. Ensembl Cavefish
Match: ENSAMXT00000030257.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002315.1:108284:112926:-1 gene:ENSAMXG00000035691.1 transcript:ENSAMXT00000030257.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 166.777 bits (421), Expect = 1.658e-58
Identity = 104/313 (33.23%), Postives = 161/313 (51.44%), Query Frame = -1
Query:  584 PYKYFAYFLDDEFLQIIYDETNLYGTQKYPNKATSYNINDIKRFIGICEYMSVVRLQRTRCYWREDIGIEDVSNSMSINKFEQI-NTLHFSDNTKMLDRGHHPIWQNLQIKT-------KFGSIPQEDRLSIDEQICATKVRHQLKQYLPMKHNKWGFKLFVLCSTAGFAYNFEIYKGTKNHYTKRKDDEPELGASSNVVVHLARCIKNMKXX------------XXXXXXXXIYMLETVRRNRIPNCKLMEESQMKKLPXXXXXXXLASIDGVDVTNVGWFDNKVVTLLFTKVRELPNGTVKRYDRKKKESI 1462
            P +YF   L    +Q + ++TNLY  Q  PNK       +I++F  IC YMS+  L  TR YW+    ++ V+++MS++++E I + LH SDN+     G    ++  +++        KF  IP E+ L +DEQI   K +H +KQY P K  +WG+K+FVL  + G  YNFEIY G         D  P++GAS N++   +    N+                 I     I+ + TVR NR+P      +++ KK    + EE    ++GV +  V WFDN+ VTLL +     P   V+R+D+KKK ++
Sbjct:  146 PVQYFQGLLSRSCIQNMIEQTNLYAIQLDPNKPLKVTAAEIEQFFAICFYMSIFGLPGTRMYWKFATRVDCVADTMSMHRWEAIKHYLHLSDNSIQPPVGDPAYYKLYKVRPLLTSLLEKFNEIPMEEHLCVDEQIVPFKGKHPMKQYNPKKPKRWGYKVFVLSDSRGLVYNFEIYTGK----IPPCDGLPDIGASRNMLSFTSIIPGNISHKLYCDNWFTSVDLQVIEAKHKIHCVGTVRANRLPGLNFATDNEFKKRGRGAFEERETLVNGVSLRAVKWFDNRPVTLLSSFASANPTTAVERWDKKKKTTV 454          

HSP 2 Score: 80.8777 bits (198), Expect = 1.658e-58
Identity = 44/145 (30.34%), Postives = 73/145 (50.34%), Query Frame = -2
Query:  124 NIINILVGRYRIPLRSKKWYFRIFCHLIYIITINAWLLFRRATFE-KTGEQSRMMLWEFRVEIAKCMCRIGTQNGKRGRPNSIQQGLENKNHKGPTACVPPLDV*TDKIAHWVIYENPRQRCKLLGCKVHLCLTKDKNCFLNFHQ 555
            ++++ L+  YR  +RS+KWY R+  H++ +  + AWLL+RR   +     +  + L EF+ E+A C+C  G    KR               KG  +  P   +  D+  HW ++   + RCK   C   + +  D+NCFLNFH+
Sbjct:  466 DLLDSLIALYRTKIRSRKWYHRLVFHMLNLTVVEAWLLYRRDCRDCSILLKDVLSLAEFKAEVASCLCMEGKATLKR---------------KGRLSLGPCGIIRYDQTGHWPVWVEKKGRCKFPNCSGIVKVHADRNCFLNFHK 595          
BLAST of SMED30016562 vs. Ensembl Cavefish
Match: ENSAMXT00000044689.1 (piggyBac transposable element-derived protein 3-like [Source:NCBI gene;Acc:111192949])

HSP 1 Score: 196.052 bits (497), Expect = 3.021e-54
Identity = 120/332 (36.14%), Postives = 182/332 (54.82%), Query Frame = -1
Query:  533 SLDTPYKYFAYFLDDEFLQIIYDETNLYGTQKYPNKATSYNINDIKRFIGICEYMSVVRLQRTRCYWREDIGIEDVSNSMSINKFEQI-NTLHFSDNTKMLDRGH----HPIWQNLQIKTKFGSIPQEDRLSIDEQICATKVRHQLKQYLPMKHNKWGFKLFVLCSTAGFAYNFEIYKGTKNHYTKRKDDEPELGASSNVVVHLARCIK-------------NMKXXXXXXXXXXIYMLETVRRNRIPNCKLMEESQMKKLPXXXXXXXLASIDGVDVTNVGWFDNKVVTLLFTKVRELPNGTVKRYDRKKKESIIID*PNIIKKYNKHIGG 1474
            S+  P +YF  F D E L +I +++NLY TQ+ PN A    ++  ++FIG   YMSV+RL R+R YW     ++ V++ M  +++E+I + +HF+DNT   +        P+  +L    KF ++PQE  +SIDEQ+   K R  LKQY+P K  KWG+K+FVLC T G  ++F++Y G  +     +D    +GAS NVV+ LA+ I+             +            I  L TVR+NR+ +C   ++  +KK    + EE  A ID V+V  V WFDN+ V +  T     P    +R+DRK+K  + +  P+II  YNK +GG
Sbjct:  123 SIRLPVEYFRQFFDTELLTLIVNQSNLYSTQENPNHA--LKLDQKEQFIGTVLYMSVIRLPRSRIYWSNACRVDQVADVMPRDRWEEIKHCIHFTDNTAPNNSDRLFKIRPLIDSLL--PKFQALPQEQMMSIDEQMVPFKGRSVLKQYIPKKPYKWGYKIFVLCDTKGLVHSFDVYAGKSDPPPGSQD----IGASGNVVLKLAQVIEGSVNHLLYFDNWFSSLNLFVALAKRGIPALGTVRQNRLQDCSFSKDDTLKKKGRGTFEEQQAVIDSVEVRAVKWFDNRGVIVASTFASAQPVSFTERWDRKQKRKVSVQCPSIITLYNKFMGG 446          
BLAST of SMED30016562 vs. Ensembl Cavefish
Match: ENSAMXT00000029839.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000180.1:82354:86597:-1 gene:ENSAMXG00000035772.1 transcript:ENSAMXT00000029839.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 130.183 bits (326), Expect = 6.875e-39
Identity = 115/369 (31.17%), Postives = 174/369 (47.15%), Query Frame = -1
Query:  533 RNILWTKRNICIDKGDLN-FKGSSKLPSQILSLDTPYKYFAYFLDDEFLQIIYDETNLYGTQKYPNKATSYNINDIKRFIGICEYMSVVRLQRTRCYWREDIGI--EDVSNSMSINKFEQI-NTLHFSDN----TKMLDR--GHHPIWQNLQIKTKFGSIPQEDRL-SIDEQICATKVRHQLKQYLPMKHNKWGFKLFVLCSTAGFAYNFEIYKGTKNHYTKRKDDEPELGASSNVVVHLARCI--KNMKX----------XXXXXXXXXIYMLETVRRNRIPNC--KLMEESQMKKLPXXXXXXXLASIDGVDVTNVGWFDNKVVTLLFTKVRELPNGTVKRYDRKKKESIIID*PNIIKKYNKHIGG 1564
            RNI   K N    +GDL  F G SK+   +   D P  +F +    + +  I   TNLY  QK  +K  +    + K F+GI   MS VR  R+R YW  + G+  E ++++M +N+FEQI   +HF DN     K  DR     P+   L  K  F S    D   S+DE +   K R  +KQY+P K   WG K++V   ++G+ YNFE Y+G        + +  +LG + +VV+ L + I  KN K+           L       IY   T R NR+     KL +E QMK+        +    +  ++T   W D+ V+ +  +     P    +R+ +K+K  + I  P  +K YN+H+GG
Sbjct:   68 RNIWRAKDN----QGDLPPFLGESKM--NVEGAD-PIDFFMHLFTQDMINDIVHNTNLYAVQKGKDK-LALTSEEFKTFLGINMVMSYVRYPRSRMYWSSETGLRLELIADAMPVNRFEQILRYMHFVDNYSLDPKNADRFVKIRPVLDAL--KETFQSALDPDEFQSVDEMMIPYKGRLSIKQYVPKKPKPWGIKVWVRAGSSGYMYNFEPYQGPAGG----RGEISQLGMAGDVVMRLCQDIQDKNHKVFFDNFFCTIPLLQALEHQGIYGTGTCRSNRLHGAQEKLKKEKQMKQ---EGRGSVSVVTNAQNITITRWLDSSVIHMASSCTGLSPTDVAQRWSKKEKRMLNIQRPFSVKLYNQHMGG 419          

HSP 2 Score: 51.9878 bits (123), Expect = 6.875e-39
Identity = 39/157 (24.84%), Postives = 69/157 (43.95%), Query Frame = -2
Query:  127 NIINILVGRYRIPLRSKKWYFRIFCHLIYIITINAWLLFRRATFEKTGEQSRMMLWEFRVEIAKCMCRIGTQN-GKRGRPNSIQQGLENKNHKGPTACVPPLDV*TDKIAHWVIYENPR--QRCKLLGCK-----------VHLCLTKDKNCFLNFH 555
            ++++  V  Y    R+K+WY R+F H + + T+NAWLL+R      +G +++ +L  F+  IA+ +   G+     RGRP++     + +          P ++      HW   +  +   RC+   C            V LC      CF N+H
Sbjct:  421 DLMDQCVAMYPHRHRNKRWYIRVFFHFLDVTTVNAWLLYRM-----SGNEAKDLL-HFKASIARALINAGSVKIHTRGRPSATPPPAKRR-----AVSKAPPEIRYAHGNHWPQLKETKNASRCQDAACTRRTKYICMQCLVALC----PGCFGNYH 562          
BLAST of SMED30016562 vs. Ensembl Cavefish
Match: ENSAMXT00000030708.1 (pep primary_assembly:Astyanax_mexicanus-2.0:14:30675304:30677836:1 gene:ENSAMXG00000043231.1 transcript:ENSAMXT00000030708.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 118.242 bits (295), Expect = 2.875e-33
Identity = 91/331 (27.49%), Postives = 157/331 (47.43%), Query Frame = -1
Query:  533 PYKYFAYFLDDEFLQIIYDETNLYGTQKYPNKATSYNINDIKRFIGICEYMSVVRLQRTRCYWREDIGI--EDVSNSMSINKFEQI-NTLHFSDNTKMLDRGH------HPIWQNLQIKTKFGSIPQEDRLSIDEQICATKVRHQLKQYLPMKHNKWGFKLFVLCSTAGFAYNFEIYKGTKNHYTKRKDDEPELGASSNVVVHLARCI--KNMKX----------XXXXXXXXXIYMLETVRRNRIPNCKLMEESQMKKLPXXXXXXXLASIDGVDVTNVGWFDNKVVTLLFTKVRELPNGTVKRYDRKKKESIIID*PNIIKKYNKHIGG 1462
            P  +F +    + +  I   TNLY  QK  +K  +    + K F+GI   MS VR  R+R YW  + G+  E ++++M +N+FEQI   +HF DN  +  +         P+   L+ +T   ++  E+  S+DE +   K R  +KQY+P K   WG K++V   ++G+ YNFE Y+G        + +  +LG + +VV+ L + I  KN K+           L       IY   T R NR+   +   + + +          + + +  ++T   W D+ V+ +  +     P    +R+ +K+K  + I  P  +K YN+H+GG
Sbjct:   79 PIDFFMHLFTQDMINDIVHNTNLYAVQKGKDK-LALTSEEFKTFLGINMVMSYVRYPRSRMYWSSETGLRLELIADAMPVNRFEQILRYMHFVDNYSLDPKNADRFVKIRPVLDALK-ETFQSALDPEEFQSVDEMMIPYKGRLSIKQYVPKKPKPWGIKVWVRAGSSGYMYNFEPYQGPAGG----RGEISQLGMAGDVVMRLCQDIQDKNHKVFFDNFFCTIPLLQALEHQGIYGTGTCRSNRLHGAQKKLKKEKQMKQEGRGSVSVVT-NAQNITITRWLDSSVIHMASSCTGLSPTDVAQRWSKKEKRMLNIQRPFSVKLYNQHMGG 402          

HSP 2 Score: 44.669 bits (104), Expect = 2.875e-33
Identity = 21/65 (32.31%), Postives = 39/65 (60.00%), Query Frame = -2
Query:  361 NIINILVGRYRIPLRSKKWYFRIFCHLIYIITINAWLLFRRATFEKTGEQSRMMLWEFRVEIAKC 555
            ++++  V  Y    R+K+WY R+F H + + T+NAWLL+R      +G +++ +L  F+  IA+ 
Sbjct:  404 DLMDQCVAMYPHRRRNKRWYIRVFFHFLDVTTVNAWLLYRM-----SGNEAKDLL-HFKASIARS 462          
BLAST of SMED30016562 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002004.1 (pep scaffold:Pmarinus_7.0:GL490362:1254:2954:1 gene:ENSPMAG00000001819.1 transcript:ENSPMAT00000002004.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.2402 bits (160), Expect = 1.488e-11
Identity = 52/189 (27.51%), Postives = 82/189 (43.39%), Query Frame = -1
Query:  953 TPYKYFAYFLDDEFLQIIYDETNLYGTQKYPNKAT-------SYNINDIKRFIGICEYMSVVRLQRTRCYWR--EDIGIEDVSNSMSINKFEQINTLHFSDNTKMLDRGHHPIWQNLQIKT-------KFGSIPQEDR-LSIDEQICATKVRHQLKQYLPMKHNKWGFKLFVLC-STAGFAYNFEIYKG 1465
            TP  +   F+  E L    +ETN Y      NK+          N+ DI  ++G+   M V  L     YW   +   +     +MS  +F+ I       N+  + R +    + LQ++T       KF ++   +R LS+DE     K R   K Y P K  K+G K ++L  +  G+ +NF+IY G
Sbjct:   15 TPLGFIQLFITRELLMFFTNETNSYANCALANKSAEERAGWEGVNLMDIANYLGLTMAMGVASLPEIPMYWSTGKPYSMPAFRETMSCKRFKSIGRFFNCHNSCAVPRDNTD--RLLQVRTVMEYFQSKFKALYAPNRELSLDEATLEWKGRLPFKVYNPQKPEKYGIKFYILAEAQTGYVFNFDIYVG 201          
BLAST of SMED30016562 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007705.1 (pep scaffold:Pmarinus_7.0:GL484572:34:4229:-1 gene:ENSPMAG00000006959.1 transcript:ENSPMAT00000007705.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.0846 bits (157), Expect = 1.804e-11
Identity = 44/143 (30.77%), Postives = 74/143 (51.75%), Query Frame = -1
Query:  953 DIKRFIGICEYMSVVRLQRTRCYWREDIGI--EDVSNSMSINKFEQINT-LHFSDNTKML---DRGHHPIW--QNL--QIKTKFGSIPQEDR-LSIDEQICATKVRHQLKQYLPMKHNKWGFKLFVLC-STAGFAYNFEIYKG 1345
            ++K F  +   M +  L R  CYW  +  +  E VS +M+  ++ +++  LH  +N        RG+ PI+  +N+  +++  F       R LS+DE +   K R   KQ++P K  KWG K++ LC +  G+  NF+IY G
Sbjct:    8 EMKAFFAVAIMMGIKDLPRVWCYWSGNPALRCEWVSGTMTHTRYSKVSQYLHARNNVGTPARGQRGYDPIYKVRNVVEEVRANFSRHYSPRRELSVDEGMIPFKGRLFFKQHMPAKPTKWGVKVWELCEAQTGYCLNFDIYTG 150          
BLAST of SMED30016562 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001816.1 (pep scaffold:Pmarinus_7.0:GL492440:267714:269431:-1 gene:ENSPMAG00000001650.1 transcript:ENSPMAT00000001816.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.225 bits (134), Expect = 2.131e-8
Identity = 49/212 (23.11%), Postives = 85/212 (40.09%), Query Frame = -1
Query:  953 FKGSSKLPSQILSLDTPYKYFAYFLDDEFLQIIYDETNLY-------------GTQKYPNKATSYNINDIKRFIGICEYMSVVRLQRTRCYWRED--IGIEDVSNSMSINKFEQINT-LHFSDNTKMLDRGH---------HPIWQNLQIKTKFGSIPQEDRLSIDEQICATKVRHQLKQYLPMKHNKWGFKLFVL-CSTAGFAYNFEIYKG 1510
            F+GS      + +   P  YF  FL DE L  I  ETN +             G      +      + +  F+G+   M +  L     +W +D  +G + +  S+S  +F  +   LH SD+ K   RG           P+  +L        +P  D + +DE +   K RH     +P    + G K+F+  C++ G+ ++  ++ G
Sbjct:    5 FQGSPGPVHALPAGSQPLDYFKLFLTDEMLDRIVTETNRHAARCGANMHLTGPGPGSVSGEGRPVTRSSLSTFLGVVLIMGINMLPALPYHWADDDSLGNQFIRRSISHKRFSFLQRYLHISDDEKAPSRGRIGYDPLHKIRPLLDHLLGAFSRHFVPFRD-MRLDEVLSKFKDRHDALPCVPANPIRCGVKVFICSCASTGYVHSLLVHAG 215          
BLAST of SMED30016562 vs. Ensembl Medaka
Match: ENSORLT00000027873.1 (piggyBac transposable element-derived protein 3 [Source:NCBI gene;Acc:101162175])

HSP 1 Score: 169.088 bits (427), Expect = 3.938e-68
Identity = 104/329 (31.61%), Postives = 171/329 (51.98%), Query Frame = -1
Query:  533 SLDTPYKYFAYFLDDEFLQIIYDETNLYGTQKYPNKATSYNINDIKRFIGICEYMSVVRLQRTRCYWREDIGIEDVSNSMSINKFEQINT-LHFSDNTKMLDRGHHPIWQNL-QIKTKFGSIPQEDRLSIDEQICATKVRHQLKQYLPMKHNKWGFKLFVLCSTAGFAYNFEIYKGTKNHYTKRKDDEPELGASSNVVVHLARCIKNMKXXXXXXXXXXIYM-------------LETVRRNRIPNCKLMEESQMKKLPXXXXXXXLASIDGVDVTNVGWFDNKVVTLLFTKVRELPNGTVKRYDRKKKESIIID*PNIIKKYNKHIGG 1474
            S+ +P +YF +F D++ L  I +++N+Y  Q+ PN     +   +++FIG   YMS   L ++R YW     ++ V++ +S +++E+I   +HFSDNT   D     I   +  +  KF ++PQ+  L + EQ      R  LKQ       KW +K+FVLC+T G  ++F+IY G     T    D+P++GA  N+V+ LA+ I++    L         +             L TV++  +P C    +S+MKK    + EE  A ++ VD+  V WFD++ V +  T     P  T +R+DRK K ++ ++ P+II  Y K  GG
Sbjct:  112 SVRSPIEYFRHFFDEQLLDSIVEQSNVYCRQQNPNHDLRLDQTSLEQFIGTAVYMSFFHLPQSRMYWSSACRVQQVADVLSRDRWEEIKQFIHFSDNTAPNDDRLFKIRLIVDSLLPKFQALPQDQMLCVHEQTVPIPDRSALKQQC-----KWAYKIFVLCNTKGLVHSFDIYTGN----TDPAPDQPDIGAGGNIVLKLAQAIQDHVNHLLYFDEQFSSLDLFVALEKRGIPALGTVQQAALPGCSFSTDSEMKKKGRGAFEEQQAEVENVDIRAVKWFDSRAVIVASTFAGAQPVSTKQRWDRKLKRNVSVEHPSIISLYKKFKGG 431          

HSP 2 Score: 110.538 bits (275), Expect = 3.938e-68
Identity = 59/159 (37.11%), Postives = 88/159 (55.35%), Query Frame = -2
Query:  127 NIINILVGRYRIPLRSKKWYFRIFCHLIYIITINAWLLFRRATFEKTGEQSR--MMLWEFRVEIAKCMCRIGTQ--NGKRGRPN-SIQQGLENKNHKGPTACVPPLDV*TDKIAHWVIYENPRQRCKLLGCK-----------VHLCLTKDKNCFLNFH 555
            + ++ L+  Y I +RSKK+Y R+F H + ++ +N+WLL+RR   E  G  S+  M L  FR  IA+ +C  G      +RG P+  ++   + K  +GP   +P  +V TD + HW + EN RQRCK   CK           +HLCL ++ NCFL FH
Sbjct:  433 DALDALINHYPIHIRSKKYYHRLFFHFVDMVIVNSWLLYRRDC-ESLGLHSKKQMDLLAFRSSIAQALCMEGKNLMEKRRGWPSPDVELEFQKKKRRGPAKAIPAQEVRTDAVGHWPVVENGRQRCKFPQCKGQTVIKCGKCNIHLCLKRNSNCFLEFH 590          
BLAST of SMED30016562 vs. Ensembl Medaka
Match: ENSORLT00000031528.1 (piggyBac transposable element-derived protein 3 [Source:NCBI gene;Acc:101162175])

HSP 1 Score: 169.088 bits (427), Expect = 3.938e-68
Identity = 104/329 (31.61%), Postives = 171/329 (51.98%), Query Frame = -1
Query:  533 SLDTPYKYFAYFLDDEFLQIIYDETNLYGTQKYPNKATSYNINDIKRFIGICEYMSVVRLQRTRCYWREDIGIEDVSNSMSINKFEQINT-LHFSDNTKMLDRGHHPIWQNL-QIKTKFGSIPQEDRLSIDEQICATKVRHQLKQYLPMKHNKWGFKLFVLCSTAGFAYNFEIYKGTKNHYTKRKDDEPELGASSNVVVHLARCIKNMKXXXXXXXXXXIYM-------------LETVRRNRIPNCKLMEESQMKKLPXXXXXXXLASIDGVDVTNVGWFDNKVVTLLFTKVRELPNGTVKRYDRKKKESIIID*PNIIKKYNKHIGG 1474
            S+ +P +YF +F D++ L  I +++N+Y  Q+ PN     +   +++FIG   YMS   L ++R YW     ++ V++ +S +++E+I   +HFSDNT   D     I   +  +  KF ++PQ+  L + EQ      R  LKQ       KW +K+FVLC+T G  ++F+IY G     T    D+P++GA  N+V+ LA+ I++    L         +             L TV++  +P C    +S+MKK    + EE  A ++ VD+  V WFD++ V +  T     P  T +R+DRK K ++ ++ P+II  Y K  GG
Sbjct:  112 SVRSPIEYFRHFFDEQLLDSIVEQSNVYCRQQNPNHDLRLDQTSLEQFIGTAVYMSFFHLPQSRMYWSSACRVQQVADVLSRDRWEEIKQFIHFSDNTAPNDDRLFKIRLIVDSLLPKFQALPQDQMLCVHEQTVPIPDRSALKQQC-----KWAYKIFVLCNTKGLVHSFDIYTGN----TDPAPDQPDIGAGGNIVLKLAQAIQDHVNHLLYFDEQFSSLDLFVALEKRGIPALGTVQQAALPGCSFSTDSEMKKKGRGAFEEQQAEVENVDIRAVKWFDSRAVIVASTFAGAQPVSTKQRWDRKLKRNVSVEHPSIISLYKKFKGG 431          

HSP 2 Score: 110.538 bits (275), Expect = 3.938e-68
Identity = 59/159 (37.11%), Postives = 88/159 (55.35%), Query Frame = -2
Query:  127 NIINILVGRYRIPLRSKKWYFRIFCHLIYIITINAWLLFRRATFEKTGEQSR--MMLWEFRVEIAKCMCRIGTQ--NGKRGRPN-SIQQGLENKNHKGPTACVPPLDV*TDKIAHWVIYENPRQRCKLLGCK-----------VHLCLTKDKNCFLNFH 555
            + ++ L+  Y I +RSKK+Y R+F H + ++ +N+WLL+RR   E  G  S+  M L  FR  IA+ +C  G      +RG P+  ++   + K  +GP   +P  +V TD + HW + EN RQRCK   CK           +HLCL ++ NCFL FH
Sbjct:  433 DALDALINHYPIHIRSKKYYHRLFFHFVDMVIVNSWLLYRRDC-ESLGLHSKKQMDLLAFRSSIAQALCMEGKNLMEKRRGWPSPDVELEFQKKKRRGPAKAIPAQEVRTDAVGHWPVVENGRQRCKFPQCKGQTVIKCGKCNIHLCLKRNSNCFLEFH 590          
BLAST of SMED30016562 vs. Ensembl Medaka
Match: ENSORLT00000047092.1 (piggyBac transposable element-derived protein 2-like [Source:NCBI gene;Acc:111948922])

HSP 1 Score: 179.489 bits (454), Expect = 2.484e-67
Identity = 102/331 (30.82%), Postives = 180/331 (54.38%), Query Frame = -1
Query:  533 LDTPYKYFAYFLDDEFLQIIYDETNLYGTQKYPNKATSYNINDIKRFIGICEYMSVVRLQRTRCYWREDIGIEDVSNSMSINKFEQI-NTLHFSDNTKMLDRGHHPIWQ----NLQIKTKFGSIPQEDRLSIDEQICATKVRHQLKQYLPMKHNKWGFKLFVLCSTAGFAYNFEIYKGTKNHYTKRKDDEPELGASSNVVVHLARCIKNMKXXX-------------XXXXXXXIYMLETVRRNRIPNCKLMEESQMKKLPXXXXXXXLASIDGVDVTNVGWFDNKVVTLLFTKVRELPNGTVKRYDRKKKESIIID*PNIIKKYNKHIGG 1471
            + +PY+YF  F  ++ L+++ +++NLY  Q   NK  +    ++++F+G   YMS+  L  TR +W +   +  V+++MS+N++E I   LHF++N         P+ +       + +K  +IP  ++L++DEQ+   K R++LKQYLP K  KWG+K+ VL  + G  +NFEIY G       +  + P++GAS NVV+ LA+ I   +                       I+   TVR NR+P   +M ++++K+    S ++  A +    +  V W+DN+ V+LL   +   P   V R+D K+K+ I +  P ++++YNK++GG
Sbjct:   99 IKSPYEYFKLFFSEDILEVVVEQSNLYAIQCNTNKPLNLTTKELEQFMGTAVYMSLFGLPGTRMFWNKATRVSQVADTMSLNRWEFIKKCLHFNNNEVRQGENVDPLHKIRPLVTHLTSKLQTIPMGEKLAVDEQMVPFKGRNRLKQYLPAKPKKWGYKILVLAGSDGVQHNFEIYTGR----VVQPPELPDVGASGNVVLRLAQPIPKHQKHKLFFDNWYTSVPLILTLAQQGIHCAGTVRSNRLPGVSMMCDAELKRTGRGSFDQKTAMVGETTLHAVKWYDNRPVSLLSDYIGAHPVTDVDRWDGKQKKVIRVPCPAVVREYNKNMGG 425          

HSP 2 Score: 97.8265 bits (242), Expect = 2.484e-67
Identity = 52/156 (33.33%), Postives = 81/156 (51.92%), Query Frame = -2
Query:  127 NIINILVGRYRIPLRSKKWYFRIFCHLIYIITINAWLLFRRA-TFEKTGEQSRMMLWEFRVEIAKCMCRIGTQ-NGKRGRPNSIQQGLENKNHKGPTACVPPLDV*TDKIAHWVIYENPRQRCKLLGCK-----------VHLCLTKDKNCFLNFH 555
            ++++ L+  YR  +RSKKWY R+  H I + T+ AWLL++R  +     ++ ++ L+ F+  I + +C+ G     KRG+          K  +GP   +P  DV  D  AHW++ +  + RCK+ GCK           V LC T   NCFL FH
Sbjct:  427 DLLDSLIALYRTKIRSKKWYHRLMFHFIDMTTVTAWLLYKRDCSSTGMSKEEQIRLYTFKSYIGESLCKSGKNLEHKRGQ----------KRRRGPATPIPVPDVRLDATAHWMVMDEKKGRCKVPGCKGTPKAKCQKCDVRLCFTSTSNCFLRFH 572          
BLAST of SMED30016562 vs. Ensembl Medaka
Match: ENSORLT00000042135.1 (pep primary_assembly:ASM223467v1:1:6921929:6923917:1 gene:ENSORLG00000030303.1 transcript:ENSORLT00000042135.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 175.252 bits (443), Expect = 7.003e-67
Identity = 101/331 (30.51%), Postives = 178/331 (53.78%), Query Frame = -1
Query:  533 LDTPYKYFAYFLDDEFLQIIYDETNLYGTQKYPNKATSYNINDIKRFIGICEYMSVVRLQRTRCYWREDIGIEDVSNSMSINKFEQI-NTLHFSDNTKMLDRGHHPIWQ----NLQIKTKFGSIPQEDRLSIDEQICATKVRHQLKQYLPMKHNKWGFKLFVLCSTAGFAYNFEIYKGTKNHYTKRKDDEPELGASSNVVVHLARCIKNMKXXX-------------XXXXXXXIYMLETVRRNRIPNCKLMEESQMKKLPXXXXXXXLASIDGVDVTNVGWFDNKVVTLLFTKVRELPNGTVKRYDRKKKESIIID*PNIIKKYNKHIGG 1471
            + +PY+YF  F  ++ L+++ +++NLY  Q   NK  +    ++++F+G   YMS+  L  TR +W +   +  V+++M++N++E I   LHF++N         P+ +       + +K  +IP  ++L++DEQ+   K R++LKQYLP K  KW +K+ VL    G  +NFEIY G       +  + P++GAS NVV+ LA+ I   +                       I+   TVR NR+P   LM ++++K+    S ++  A +    +  V W+DN+ V+LL   +   P   V R+D K+K+ I +  P ++++YNK++GG
Sbjct:   99 IKSPYEYFKMFFSEDILEVVVEQSNLYAIQCNTNKPLNLTTKELEQFMGTAVYMSLFGLPGTRMFWNKATRVSQVADTMALNRWEFIKKCLHFNNNEVRQGENVDPLHKIRPLVTHLTSKLQTIPMGEKLAVDEQMVPFKGRNRLKQYLPAKPKKWVYKILVLAGCDGVPHNFEIYTGR----VVQPPELPDVGASGNVVLRLAQPIPKHQKHKLFFDNWFTSVPLILTLAQQGIHCAGTVRSNRLPGVSLMCDAELKRTGRGSFDQKTAMVGETTLHAVKWYDNRSVSLLSDYIGAHPVTDVDRWDGKQKKVIRVPCPAVVREYNKNMGG 425          

HSP 2 Score: 100.138 bits (248), Expect = 7.003e-67
Identity = 55/162 (33.95%), Postives = 83/162 (51.23%), Query Frame = -2
Query:  109 NIINILVGRYRIPLRSKKWYFRIFCHLIYIITINAWLLFRRA-TFEKTGEQSRMMLWEFRVEIAKCMCRIGTQ-NGKRGRPNSIQQGLENKNHKGPTACVPPLDV*TDKIAHWVIYENPRQRCKLLGCK-----------VHLCLTKDKNCFLNFHQ*IFMF 555
            ++++ L+  YR  +RSKKWY R+  H I I T+ AWLL++R  +     ++ ++ L+ F+  I + +C+ G     KRG+          K  +GP   +P  DV  D  AHW++ +  + RCK+ GCK           V LC T   NCFL FH   F F
Sbjct:  427 DLLDSLIALYRTKIRSKKWYHRLMFHFIDITTVTAWLLYKRDCSSTGMSKEEQIRLYTFKSYIGESLCKSGKNLEHKRGQ----------KRRRGPATPIPVPDVRLDATAHWMVMDKKKGRCKVPGCKGTPKAKCQKCDVRLCFTSTSNCFLRFHTIQFQF 578          
BLAST of SMED30016562 vs. Ensembl Medaka
Match: ENSORLT00000036570.1 (pep primary_assembly:ASM223467v1:15:4424179:4426102:1 gene:ENSORLG00000027498.1 transcript:ENSORLT00000036570.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 181.8 bits (460), Expect = 1.483e-65
Identity = 102/331 (30.82%), Postives = 181/331 (54.68%), Query Frame = -1
Query:  533 LDTPYKYFAYFLDDEFLQIIYDETNLYGTQKYPNKATSYNINDIKRFIGICEYMSVVRLQRTRCYWREDIGIEDVSNSMSINKFEQI-NTLHFSDNTKMLDRGHHPIWQ----NLQIKTKFGSIPQEDRLSIDEQICATKVRHQLKQYLPMKHNKWGFKLFVLCSTAGFAYNFEIYKGTKNHYTKRKDDEPELGASSNVVVHLARCIKNMKXXX-------------XXXXXXXIYMLETVRRNRIPNCKLMEESQMKKLPXXXXXXXLASIDGVDVTNVGWFDNKVVTLLFTKVRELPNGTVKRYDRKKKESIIID*PNIIKKYNKHIGG 1471
            + +PY+YF  F  ++ L+++ +++NLY  Q   NK  +    ++++F+G   YMS+  L  TR +W +   +  V+++M++N++E I   LHF++N         P+ +       + +K  +IP  ++L++DEQ+   K R++LKQYLP K  KWG+K+ VL  + G  +NFEIY G       +  + P++GAS NVV+HLA+ I   +                       I+   TVR NR+P   +M ++++K+    S ++  A +    +  V W+DN+ V+LL   +   P   V R+D K+K+ I +  P ++++YNK++GG
Sbjct:   99 IKSPYEYFKMFFSEDILEVVVEQSNLYAIQCNTNKPLNLTTKELEQFMGTAVYMSLFGLPGTRMFWNKATLVSQVADTMALNRWEFIKRCLHFNNNKVRQGENVDPLHKIRPLVTHLTSKLQTIPMGEKLAVDEQMVTFKGRNRLKQYLPAKPKKWGYKILVLAGSDGVPHNFEIYTGR----VVQPPELPDVGASGNVVLHLAQPIPKHQKHKLFFDNWFTSVPLILTLAQQGIHCAGTVRSNRLPGVSMMCDAELKRTGRGSFDQKTAMVGETTLHAVKWYDNRSVSLLSDYIGAHPVTDVDRWDGKQKKVIRVPCPAVVREYNKNMGG 425          

HSP 2 Score: 89.3521 bits (220), Expect = 1.483e-65
Identity = 48/155 (30.97%), Postives = 75/155 (48.39%), Query Frame = -2
Query:  127 NIINILVGRYRIPLRSKKWYFRIFCHLIYIITINAWLLFRRA-TFEKTGEQSRMMLWEFRVEIAKCMCRIGTQNGKRGRPNSIQQGLENKNHKGPTACVPPLDV*TDKIAHWVIYENPRQRCKLLGCK-----------VHLCLTKDKNCFLNFH 555
            ++++ L+  YR  +RSKKWY R+  H I + T+ AWLL++R  +     ++ ++ L  F+  I + +C+                    K  +GP   +P  DV  D  AHW++ +  + RCK+ GCK           V LC T   NCFL FH
Sbjct:  427 DLLDSLIAPYRTKIRSKKWYHRLMFHFIDMTTVTAWLLYKRDCSSTGMSKEEQIRLCTFKSYIGESLCK-------------------KKRRRGPATPIPVPDVRLDATAHWMVMDKKKGRCKVPGCKGTPKAKCQKCDVRLCFTSTSNCFLRFH 562          
BLAST of SMED30016562 vs. Planmine SMEST
Match: SMESG000071608.1 (SMESG000071608.1)

HSP 1 Score: 88.5817 bits (218), Expect = 6.130e-18
Identity = 66/204 (32.35%), Postives = 103/204 (50.49%), Query Frame = -1
Query:  932 LPSQILSLDTPYKYFAYFLDDEFLQIIYDETNLYGTQKYPNKATS----------YNINDIKRFIGICEYMSVVRLQRTRCYWR-EDIGIEDVSNS-MSINKFE-QINTLHFSDNTKML--DRGHH--PIWQNLQIKTKFGSIPQEDRLSIDEQICATKVRHQLKQYLPMKHNKWGFKLFVLCSTAGFAYNFEIYKGTKNHYTK 1492
            LP  I + DT    F  F D+E + +I  ETN+Y  Q      TS           N  +I++F G+  +M +VR+ +   YW  +DI     + S MS ++FE  +  LHFS+N   +  DR     P+   L+ K K   +P E+ + IDE +   + R   +QY+P K +K+G KLF LC++ G+ +  ++Y G    Y K
Sbjct:  107 LPKNISAFDT----FMLFFDEEVINLIVIETNIYAEQTIERTRTSRHNRLNKWHPANSEEIRKFFGLFMWMGLVRMGKITSYWSNKDIYKNSTALSIMSRSRFEILLRLLHFSNNENAIPGDRLAKIKPLLDLLEAKYKKVFVPGENHV-IDETLVPWRGRLVFRQYIPNKAHKYGIKLFKLCTSEGYTWASKMYSGKSEIYDK 305          
BLAST of SMED30016562 vs. Planmine SMEST
Match: SMESG000067117.1 (SMESG000067117.1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.364e-13
Identity = 64/210 (30.48%), Postives = 98/210 (46.67%), Query Frame = -1
Query:  878 DTPYKYFAYFLDDEFLQIIYDETNLY------GTQKYPNKATSYNINDIKRFIGICEYMSVVRLQRTRCYWRED--IGIEDVSNSMSINKFEQI-NTLHFSDNTKMLDRGHHPIWQNLQ-IKTKFGSIPQEDRL-SIDEQICATKVRHQLKQYLPMKHNKWGFKLF--VLCSTAGFAYNFEIYKGTKNHYTKRKDDEPELGASSNVVVHL 1468
            + P  YF +F+D EF+  +  ETNLY       +QK   K      N++  F  I     +V     + YW  D  +       + + N+F QI   LHF++N +  +     I   +  +K KF ++   DRL  IDE +   K R   KQY+P+K +++G KLF  V C+T     NF IY G    +   +     LG S ++V+ L
Sbjct:   66 EQPIDYFEWFIDSEFMDYVVKETNLYQQQHPLPSQKKMAKWFDVTSNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTPIFPKTFTRNRFLQIMRFLHFANNEQKTNDKLFKIGNVVNMVKEKFKNVIIPDRLICIDESLMLWKGRLSFKQYIPLKRHRFGIKLFEMVDCTTQCI-LNFIIYTGKSTKFRFHE----LLGISGSIVMEL 270          
BLAST of SMED30016562 vs. Planmine SMEST
Match: SMESG000081799.1 (SMESG000081799.1)

HSP 1 Score: 59.6918 bits (143), Expect = 3.569e-11
Identity = 30/57 (52.63%), Postives = 43/57 (75.44%), Query Frame = -1
Query:  578 LPXXXXXXXLASIDGVDVTNVGWFDNKVVTLLFTKVRELPNGTVKRYDRKKKESIII 748
            +P  +SEE +AS++ VD++NVGW DNKV T L TK  E+P  TVKR+D+K K+ +I+
Sbjct:    1 MPRGTSEEYVASVNEVDISNVGWLDNKVETFLSTKTDEMPKETVKRFDKKTKKLLIL 57          
BLAST of SMED30016562 vs. Planmine SMEST
Match: SMESG000003729.1 (SMESG000003729.1)

HSP 1 Score: 57.3806 bits (137), Expect = 7.963e-9
Identity = 44/136 (32.35%), Postives = 66/136 (48.53%), Query Frame = -1
Query: 1175 RNICIDKGDLNFKGSSKLPSQILSLDTPYKYFAYFLDDEFLQIIYDETNLYGTQKYPNKATS----------YNINDIKRFIGICEYMSVVRLQRTRCYW-REDIGIEDVSNS-MSINKFE-QINTLHFSDNTKML 1543
            R+ C D     F G S L   +  + + +  F  F D+E + +I  ETN+Y  Q      TS           N  +I++FIG+  +M +VR+     YW  +DI    +S+S MS NKFE  +  LHFS+N   +
Sbjct:   91 RSKCFD-----FIGKSGLQLDLPKIISAFDTFMLFFDEEVINLIVTETNIYAEQTIQRTRTSRHNSLNKWHLTNSEEIRQFIGLFMWMGLVRMGNITSYWSNKDIYKNSISSSIMSRNKFEILLRLLHFSNNENAI 221          
BLAST of SMED30016562 vs. Planmine SMEST
Match: SMESG000056413.1 (SMESG000056413.1)

HSP 1 Score: 56.9954 bits (136), Expect = 8.862e-9
Identity = 31/94 (32.98%), Postives = 52/94 (55.32%), Query Frame = -1
Query: 1274 KGDLNFKGSSKL---PSQILSLDTPYKYFAYFLDDEFLQIIYDETNLYGTQKYPNKAT-------SYNINDIKRFIGICEYMSVVRLQRTRCYW 1525
            K ++ F  SS +    S+I +   P+ +++ F++DE  +II  +TN+Y TQK   + +         N N+IKRF G+  +M +VRL +   YW
Sbjct:  104 KTNITFSDSSGINTCQSEIFACMEPHNFYSLFVNDEIFEIIAKQTNIYVTQKKSGQQSHRLDEWYQTNPNEIKRFFGLIIWMGLVRLPKIELYW 197          
The following BLAST results are available for this feature:
BLAST of SMED30016562 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ERCC66.459e-2227.08ERCC excision repair 6, chromatin remodeling facto... [more]
ERCC65.920e-2126.49ERCC excision repair 6, chromatin remodeling facto... [more]
ERCC65.920e-2126.49ERCC excision repair 6, chromatin remodeling facto... [more]
PGBD12.022e-2024.65piggyBac transposable element derived 1 [Source:HG... [more]
PGBD21.002e-1623.88piggyBac transposable element derived 2 [Source:HG... [more]
back to top
BLAST of SMED30016562 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016562 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016562 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-255f4.71.645e-3124.63si:ch211-255f4.7 [Source:ZFIN;Acc:ZDB-GENE-050208-... [more]
CABZ01069162.11.715e-1625.07pep scaffold:GRCz11:KN149950.1:74:5493:1 gene:ENSD... [more]
pgbd41.628e-1429.77piggyBac transposable element derived 4 [Source:ZF... [more]
pgbd41.856e-1429.77piggyBac transposable element derived 4 [Source:ZF... [more]
si:dkey-19f4.21.787e-1134.67si:dkey-19f4.2 [Source:ZFIN;Acc:ZDB-GENE-121214-26... [more]
back to top
BLAST of SMED30016562 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
otud7b2.302e-1327.52OTU deubiquitinase 7B [Source:Xenbase;Acc:XB-GENE-... [more]
cldn53.523e-1327.52claudin 5 (transmembrane protein deleted in veloca... [more]
ENSXETT00000039631.11.097e-1127.85pep primary_assembly:Xenopus_tropicalis_v9.1:1:681... [more]
fibcd14.065e-1127.37fibrinogen C domain containing 1 [Source:Xenbase;A... [more]
epc15.064e-1127.72enhancer of polycomb homolog 1 [Source:Xenbase;Acc... [more]
back to top
BLAST of SMED30016562 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Pgbd14.152e-829.56piggyBac transposable element derived 1 [Source:MG... [more]
Pgbd15.209e-829.56piggyBac transposable element derived 1 [Source:MG... [more]
Pgbd15.209e-829.56piggyBac transposable element derived 1 [Source:MG... [more]
back to top
BLAST of SMED30016562 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8N328|PGBD3_HUMAN2.850e-2127.08PiggyBac transposable element-derived protein 3 OS... [more]
sp|P0DP91|ERPG3_HUMAN2.611e-2026.49Chimeric ERCC6-PGBD3 protein OS=Homo sapiens OX=96... [more]
sp|Q96JS3|PGBD1_HUMAN8.918e-2024.65PiggyBac transposable element-derived protein 1 OS... [more]
sp|Q6P3X8|PGBD2_HUMAN4.422e-1623.88PiggyBac transposable element-derived protein 2 OS... [more]
sp|Q96DM1|PGBD4_HUMAN6.391e-723.66PiggyBac transposable element-derived protein 4 OS... [more]
back to top
BLAST of SMED30016562 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Y2RTV03.716e-10443.43PiggyBac transposable element-derived protein 2 OS... [more]
A0A4Y2V1V61.896e-10244.90PiggyBac transposable element-derived protein 2 OS... [more]
A0A4Y2PAH32.623e-10244.63PiggyBac transposable element-derived protein 2 OS... [more]
J9LW604.652e-9241.10DDE_Tnp_1_7 domain-containing protein OS=Acyrthosi... [more]
A0A4Y2IS594.891e-9240.88Chimeric ERCC6-PGBD3 protein OS=Araneus ventricosu... [more]
back to top
BLAST of SMED30016562 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000050536.12.014e-6131.70pep primary_assembly:Astyanax_mexicanus-2.0:13:559... [more]
ENSAMXT00000030257.11.658e-5833.23pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000044689.13.021e-5436.14piggyBac transposable element-derived protein 3-li... [more]
ENSAMXT00000029839.16.875e-3931.17pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000030708.12.875e-3327.49pep primary_assembly:Astyanax_mexicanus-2.0:14:306... [more]
back to top
BLAST of SMED30016562 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000002004.11.488e-1127.51pep scaffold:Pmarinus_7.0:GL490362:1254:2954:1 gen... [more]
ENSPMAT00000007705.11.804e-1130.77pep scaffold:Pmarinus_7.0:GL484572:34:4229:-1 gene... [more]
ENSPMAT00000001816.12.131e-823.11pep scaffold:Pmarinus_7.0:GL492440:267714:269431:-... [more]
back to top
BLAST of SMED30016562 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016562 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016562 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000027873.13.938e-6831.61piggyBac transposable element-derived protein 3 [S... [more]
ENSORLT00000031528.13.938e-6831.61piggyBac transposable element-derived protein 3 [S... [more]
ENSORLT00000047092.12.484e-6730.82piggyBac transposable element-derived protein 2-li... [more]
ENSORLT00000042135.17.003e-6730.51pep primary_assembly:ASM223467v1:1:6921929:6923917... [more]
ENSORLT00000036570.11.483e-6530.82pep primary_assembly:ASM223467v1:15:4424179:442610... [more]
back to top
BLAST of SMED30016562 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000071608.16.130e-1832.35SMESG000071608.1[more]
SMESG000067117.11.364e-1330.48SMESG000067117.1[more]
SMESG000081799.13.569e-1152.63SMESG000081799.1[more]
SMESG000003729.17.963e-932.35SMESG000003729.1[more]
SMESG000056413.18.862e-932.98SMESG000056413.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016562 ID=SMED30016562|Name=SMED30016562|organism=Schmidtea mediterranea sexual|type=transcript|length=2548bp
TAAATATAAATAAAATCATTAGACATTTTACATACATTTATTAATAAAAA
ACAACACAAAAATTAAAAGAAACATTCTACATACTTATCATATATTTACA
AATAATTAAAACATAAATATTTACTGGTGGAAATTTAAAAAGCAATTTTT
ATCCTTAGTTAGACAAAGATGTACCTTGCATCCGAGTAATTTACATCTTT
GGCGTGGGTTTTCATATATTACCCAATGAGCAATTTTGTCTGTTCAAACA
TCCAACGGTGGAACACAAGCAGTTGGTCCTTTGTGATTTTTGTTTTCAAG
ACCCTGTTGAATACTATTTGGTCTTCCTCTTTTGCCATTTTGTGTACCAA
TGCGGCACATACATTTGGCAATTTCTACTCTAAATTCCCAGAGCATCATT
CGACTTTGTTCGCCCGTTTTTTCAAAAGTGGCACGGCGGAACAGCAACCA
TGCATTAATGGTTATAATATAAATCAAGTGGCAAAATATCCTGAAGTACC
ACTTTTTTGATCTTAGTGGAATCCGGTATCTTCCCACCAATATGTTTATT
ATATTTTTTGATTATATTAGGTCAATCTATTATTATGCTTTCTTTCTTTT
TTCTGTCGTATCTTTTTACAGTGCCATTAGGAAGTTCTCTCACCTTTGTG
AACAATAGAGTTACAACTTTGTTATCAAACCACCCCACATTGGTTACATC
AACCCCATCAATAGATGCCAATAATTCTTCGGAGCTTCATCAAGGAAGTT
TCTTCATTTGGGATTCTTCCATCAATTTGCAATTAGGAATTCTATTTCTC
CGTACAGTTTCCAGCATATAAATTATAAAAATTATCGCAATAAAGAGTGA
AATTTTCATGTTTTTTATACACCTAGCAAGATGTACGACTACATTGGAAC
TTGCCCCAAGTTCAGGCTCGTCATCTTTTCTTTTTGTGTAGTGATTTTTG
GTCCCTTTGTAAATTTCAAAATTATAGGCAAAACCTGCAGTGCTACACAA
AACAAATAATTTAAAACCCCATTTATTGTGCTTCATAGGCAAATATTGTT
TTAATTGATGCCGTACTTTGGTCGCACAGATTTGCTCGTCAATTGAAAGA
CGGTCTTCTTGGGGGATAGAACCAAATTTTGTCTTAATTTGAAGATTTTG
CCAAATTGGGTGATGACCTCGATCCAGCATCTTAGTATTATCGCTAAAAT
GCAGAGTATTTATCTGCTCAAATTTATTTATCGACATGGAGTTGCTTACA
TCTTCTATGCCGATATCTTCCCTCCAGTAACATCTTGTTCTTTGTAATCT
TACCACTGACATGTATTCACAAATTCCTATGAATCTTTTAATATCATTGA
TGTTATAACTGGTTGCCTTATTAGGATATTTCTGTGTCCCATACAAATTT
GTTTCATCATAAATGATTTGCAGAAATTCATCGTCCAAAAAATATGCAAA
ATATTTATATGGTGTATCCAACGATAATATTTGTGATGGCAGCTTTGACG
ATCCTTTAAAATTTAGATCACCTTTATCGATACATATATTTCTCTTTGTC
CACAATATGTTCCTGTGAACAACTTTTTTTGGATGAAATATTAATCTCTC
CCTTTTCGATAGATTGAAAACTGATTGGCTGGTTTTATTCATCTTCTTGT
TGAATATCAACAGTGTCATTCACCGATTCCCTAGTTTCCAAATCTAAGAG
ATTTATTTCAATTTCAGTATCTGAACAAGATAAAGCATACAGCTCATCTT
TACTATCAACAAATGTCTCCATTATCTATTTTTCTGTTAGGGCTCATGCA
TACCTTTCTTTTTATAAGACATTCTAAAATGAAAATAAAAACATAAAACT
ATATTCTTGGATGGGAATAATGTATAAAAGGTAATGCTCCAAATTTAATA
TTTTAGCCACCGCTACACGATGTAGTAAATTTGCTACAAACATAAAATGA
ATGATTGCATTGAAGAAATCAATCATTATTCATTTAGGTTAAAAATGAAA
AAATACATACAAATACAGAATAATTTTATCACTGTCAAAATCAGGCGAAA
ACTTCTCAAAATTCAAATTACAACAGACTAAAACACACTCAACTGTCGAT
GTCGCCAAGAGTGAATTTAAGGTTAGTATATTGAGACTTGTGGCACATAT
AGCGGTCACTTTATGAACTAAATCCGTCAAACAGCTTTGTAACTCACAAG
CAACACTATGAAATGGTTAGTTCTTATTTATTTTAGGCGATCTAAACGTG
AAATTCCGGTAAGTAGCAAATTTGCTACACAATTTCTAATTATAAGACAC
CTCAAAGAAGTTAATTACCTCAATTATAGCCTTTTAAATTTTATGAATTA
CATTTTACGATCAGATTATATTACTAGAATAAAATTAAAATGATCTTACA
TAGTCAGTCAATCAGGCTGTTGTATAAAAATATTAGTCGTACAGTTTTTT
TCATTACAATTTCAAATTGTTTAATTAAACTTGATATTTTAATCTAAATT
CGTGACATCATGGCTATTGTTTTAGAGGTCAATTTCACATTGTTGTCG
back to top

protein sequence of SMED30016562-orf-1

>SMED30016562-orf-1 ID=SMED30016562-orf-1|Name=SMED30016562-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=310bp
MTLLIFNKKMNKTSQSVFNLSKRERLIFHPKKVVHRNILWTKRNICIDKG
DLNFKGSSKLPSQILSLDTPYKYFAYFLDDEFLQIIYDETNLYGTQKYPN
KATSYNINDIKRFIGICEYMSVVRLQRTRCYWREDIGIEDVSNSMSINKF
EQINTLHFSDNTKMLDRGHHPIWQNLQIKTKFGSIPQEDRLSIDEQICAT
KVRHQLKQYLPMKHNKWGFKLFVLCSTAGFAYNFEIYKGTKNHYTKRKDD
EPELGASSNVVVHLARCIKNMKISLFIAIIFIIYMLETVRRNRIPNCKLM
EESQMKKLP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR029526PGBD
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 17..39