Aquaporin

Overview
NameAquaporin
Smed IDSMED30016557
Length (bp)1176
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Aquaporin (SMED30016557) t-SNE clustered cells

Violin plots show distribution of expression levels for Aquaporin (SMED30016557) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Aquaporin (SMED30016557) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Aquaporin (SMED30016557) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016557

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30016557SMESG000023346.1 SmedASXL_002830SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30016557SMESG000023346.1 dd_Smed_v4_6111_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30016557SMESG000023346.1 dd_Smed_v4_6111_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal cellSMED30016557SMESG000023346.1 dd_Smed_v4_6111_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30016557SMESG000023346.1 OX_Smed_1.0.20376ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
GABAergic neuronSMED30016557SMESG000023346.1 dd_Smed_v6_6111_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Aquaporin vs. Ensembl Human
Match: AQP4 (aquaporin 4 [Source:HGNC Symbol;Acc:HGNC:637])

HSP 1 Score: 139.428 bits (350), Expect = 1.483e-37
Identity = 92/247 (37.25%), Postives = 137/247 (55.47%), Query Frame = 3
Query:   57 KCNTLVKQLRIWSSLQDVTKTSFWTALFAEFLGTFILVFIGLGACYENG--------DVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGIS--HAHAPWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSEL 767
            KC  L  +  I  + + V   +FW A+ AEFL   I V + LG+    G        D++ ++L FGL  A  +     +SGGHINPAV+V ++  R+IS  + + YI  Q +GA++ A  + L+T  +     G++  H +      L  E+II+F LVFT+   C  K R++V  G  AL IG S+ +G L   N +G SMNPARS GPA++  N +  WIY VGP+IG +LAG + +  F  ++
Sbjct:   12 KCGPLCTRENIMVAFKGVWTQAFWKAVTAEFLAMLIFVLLSLGSTINWGGTEKPLPVDMVLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRKISIAKSVFYIAAQCLGAIIGAGILYLVTPPSVVGGLGVTMVHGNLTAGHGLLVELIITFQLVFTIFASCDSK-RTDV-TGSIALAIGFSVAIGHLFAINYTGASMNPARSFGPAVIMGNWENHWIYWVGPIIGAVLAGGLYEYVFCPDV 256          
BLAST of Aquaporin vs. Ensembl Human
Match: AQP4 (aquaporin 4 [Source:HGNC Symbol;Acc:HGNC:637])

HSP 1 Score: 139.428 bits (350), Expect = 1.483e-37
Identity = 92/247 (37.25%), Postives = 137/247 (55.47%), Query Frame = 3
Query:   57 KCNTLVKQLRIWSSLQDVTKTSFWTALFAEFLGTFILVFIGLGACYENG--------DVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGIS--HAHAPWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSEL 767
            KC  L  +  I  + + V   +FW A+ AEFL   I V + LG+    G        D++ ++L FGL  A  +     +SGGHINPAV+V ++  R+IS  + + YI  Q +GA++ A  + L+T  +     G++  H +      L  E+II+F LVFT+   C  K R++V  G  AL IG S+ +G L   N +G SMNPARS GPA++  N +  WIY VGP+IG +LAG + +  F  ++
Sbjct:   12 KCGPLCTRENIMVAFKGVWTQAFWKAVTAEFLAMLIFVLLSLGSTINWGGTEKPLPVDMVLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRKISIAKSVFYIAAQCLGAIIGAGILYLVTPPSVVGGLGVTMVHGNLTAGHGLLVELIITFQLVFTIFASCDSK-RTDV-TGSIALAIGFSVAIGHLFAINYTGASMNPARSFGPAVIMGNWENHWIYWVGPIIGAVLAGGLYEYVFCPDV 256          
BLAST of Aquaporin vs. Ensembl Human
Match: AQP4 (aquaporin 4 [Source:HGNC Symbol;Acc:HGNC:637])

HSP 1 Score: 140.198 bits (352), Expect = 1.887e-37
Identity = 92/247 (37.25%), Postives = 137/247 (55.47%), Query Frame = 3
Query:   57 KCNTLVKQLRIWSSLQDVTKTSFWTALFAEFLGTFILVFIGLGACYENG--------DVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGIS--HAHAPWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSEL 767
            KC  L  +  I  + + V   +FW A+ AEFL   I V + LG+    G        D++ ++L FGL  A  +     +SGGHINPAV+V ++  R+IS  + + YI  Q +GA++ A  + L+T  +     G++  H +      L  E+II+F LVFT+   C  K R++V  G  AL IG S+ +G L   N +G SMNPARS GPA++  N +  WIY VGP+IG +LAG + +  F  ++
Sbjct:   12 KCGPLCTRENIMVAFKGVWTQAFWKAVTAEFLAMLIFVLLSLGSTINWGGTEKPLPVDMVLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRKISIAKSVFYIAAQCLGAIIGAGILYLVTPPSVVGGLGVTMVHGNLTAGHGLLVELIITFQLVFTIFASCDSK-RTDV-TGSIALAIGFSVAIGHLFAINYTGASMNPARSFGPAVIMGNWENHWIYWVGPIIGAVLAGGLYEYVFCPDV 256          
BLAST of Aquaporin vs. Ensembl Human
Match: AQP4 (aquaporin 4 [Source:HGNC Symbol;Acc:HGNC:637])

HSP 1 Score: 133.65 bits (335), Expect = 1.716e-35
Identity = 87/234 (37.18%), Postives = 132/234 (56.41%), Query Frame = 3
Query:   96 SLQDVTKTSFWTALFAEFLGTFILVFIGLGACYENG--------DVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGIS--HAHAPWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSEL 767
            + + V   +FW A+ AEFL   I V + LG+    G        D++ ++L FGL  A  +     +SGGHINPAV+V ++  R+IS  + + YI  Q +GA++ A  + L+T  +     G++  H +      L  E+II+F LVFT+   C +  R++V  G  AL IG S+ +G L   N +G SMNPARS GPA++  N +  WIY VGP+IG +LAG + +  F  ++
Sbjct:    3 AFKGVWTQAFWKAVTAEFLAMLIFVLLSLGSTINWGGTEKPLPVDMVLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRKISIAKSVFYIAAQCLGAIIGAGILYLVTPPSVVGGLGVTMVHGNLTAGHGLLVELIITFQLVFTIFASC-DSKRTDV-TGSIALAIGFSVAIGHLFAINYTGASMNPARSFGPAVIMGNWENHWIYWVGPIIGAVLAGGLYEYVFCPDV 234          
BLAST of Aquaporin vs. Ensembl Human
Match: AQP4 (aquaporin 4 [Source:HGNC Symbol;Acc:HGNC:637])

HSP 1 Score: 133.65 bits (335), Expect = 1.716e-35
Identity = 87/234 (37.18%), Postives = 132/234 (56.41%), Query Frame = 3
Query:   96 SLQDVTKTSFWTALFAEFLGTFILVFIGLGACYENG--------DVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGIS--HAHAPWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSEL 767
            + + V   +FW A+ AEFL   I V + LG+    G        D++ ++L FGL  A  +     +SGGHINPAV+V ++  R+IS  + + YI  Q +GA++ A  + L+T  +     G++  H +      L  E+II+F LVFT+   C +  R++V  G  AL IG S+ +G L   N +G SMNPARS GPA++  N +  WIY VGP+IG +LAG + +  F  ++
Sbjct:    3 AFKGVWTQAFWKAVTAEFLAMLIFVLLSLGSTINWGGTEKPLPVDMVLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRKISIAKSVFYIAAQCLGAIIGAGILYLVTPPSVVGGLGVTMVHGNLTAGHGLLVELIITFQLVFTIFASC-DSKRTDV-TGSIALAIGFSVAIGHLFAINYTGASMNPARSFGPAVIMGNWENHWIYWVGPIIGAVLAGGLYEYVFCPDV 234          
BLAST of Aquaporin vs. Ensembl Celegans
Match: aqp-6 (AQuaPorin or aquaglyceroporin related [Source:UniProtKB/TrEMBL;Acc:D5MCS1])

HSP 1 Score: 103.605 bits (257), Expect = 5.017e-25
Identity = 76/272 (27.94%), Postives = 136/272 (50.00%), Query Frame = 3
Query:   24 QTLSEVNMPESKCNTLVKQLRIWSSL-----QDVTKTSFWTALFAEFLGTFILVFIG---LGACYENGDVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISL-MTYETYNKTHG---ISHAHAPWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIV--------HSNMKLI-----WIYIVGPLIGGILAGLVQQLFFTSE 764
            ++ S+V +     N+ ++ L+  S +     +D    + ++   AEF+   + V+IG       + +  VL  A A G+   +       +SG HINPAV+ G+ +  +IS +  + Y++ Q++G++  A  + + + Y+ YN       +      W + L  EI+ +++LV TV+   V+  ++     LA L IG S+ + +L    ISG SMNPARS GP I+        H + + +     WIY +GP+IG  +A  V ++FF  +
Sbjct:   19 RSASDVILNSDPFNSTMENLKNSSDIVPKMVEDEKDYTIYSKCAAEFIAVLLFVYIGSMQAAGVFLHDGVLHAAFAHGVAIFVLAATFGGVSGAHINPAVTFGIALVGRISPIHAVCYVVSQLLGSVFGALLVRISLPYKMYNVISAGATLCGKGYNWQEGLTAEIVTTYILVQTVLLCAVDTDKNR----LAPLAIGFSLIIEILAAGAISGASMNPARSFGPNIMGQVFLKPEHLDAQYMYWNYHWIYYIGPIIGAFIAAGVYRMFFARD 286          
BLAST of Aquaporin vs. Ensembl Celegans
Match: aqp-6 (AQuaPorin or aquaglyceroporin related [Source:UniProtKB/TrEMBL;Acc:D5MCS1])

HSP 1 Score: 102.064 bits (253), Expect = 1.999e-24
Identity = 71/242 (29.34%), Postives = 123/242 (50.83%), Query Frame = 3
Query:   99 LQDVTKTSFWTALFAEFLGTFILVFIG---LGACYENGDVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISL-MTYETYNKTHG---ISHAHAPWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIV--------HSNMKLI-----WIYIVGPLIGGILAGLVQQLFFTSE 764
            ++D    + ++   AEF+   + V+IG       + +  VL  A A G+   +       +SG HINPAV+ G+ +  +IS +  + Y++ Q++G++  A  + + + Y+ YN       +      W + L  EI+ +++LV TV+   V+  ++     LA L IG S+ + +L    ISG SMNPARS GP I+        H + + +     WIY +GP+IG  +A  V ++FF  +
Sbjct:   47 VEDEKDYTIYSKCAAEFIAVLLFVYIGSMQAAGVFLHDGVLHAAFAHGVAIFVLAATFGGVSGAHINPAVTFGIALVGRISPIHAVCYVVSQLLGSVFGALLVRISLPYKMYNVISAGATLCGKGYNWQEGLTAEIVTTYILVQTVLLCAVDTDKNR----LAPLAIGFSLIIEILAAGAISGASMNPARSFGPNIMGQVFLKPEHLDAQYMYWNYHWIYYIGPIIGAFIAAGVYRMFFARD 284          
BLAST of Aquaporin vs. Ensembl Celegans
Match: aqp-6 (AQuaPorin or aquaglyceroporin related [Source:UniProtKB/TrEMBL;Acc:D5MCS1])

HSP 1 Score: 100.523 bits (249), Expect = 2.732e-24
Identity = 71/242 (29.34%), Postives = 123/242 (50.83%), Query Frame = 3
Query:   99 LQDVTKTSFWTALFAEFLGTFILVFIG---LGACYENGDVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISL-MTYETYNKTHG---ISHAHAPWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIV--------HSNMKLI-----WIYIVGPLIGGILAGLVQQLFFTSE 764
            ++D    + ++   AEF+   + V+IG       + +  VL  A A G+   +       +SG HINPAV+ G+ +  +IS +  + Y++ Q++G++  A  + + + Y+ YN       +      W + L  EI+ +++LV TV+   V+  ++     LA L IG S+ + +L    ISG SMNPARS GP I+        H + + +     WIY +GP+IG  +A  V ++FF  +
Sbjct:    2 VEDEKDYTIYSKCAAEFIAVLLFVYIGSMQAAGVFLHDGVLHAAFAHGVAIFVLAATFGGVSGAHINPAVTFGIALVGRISPIHAVCYVVSQLLGSVFGALLVRISLPYKMYNVISAGATLCGKGYNWQEGLTAEIVTTYILVQTVLLCAVDTDKNR----LAPLAIGFSLIIEILAAGAISGASMNPARSFGPNIMGQVFLKPEHLDAQYMYWNYHWIYYIGPIIGAFIAAGVYRMFFARD 239          
BLAST of Aquaporin vs. Ensembl Celegans
Match: aqp-4 (AQuaPorin or aquaglyceroporin related [Source:UniProtKB/TrEMBL;Acc:G5EEK0])

HSP 1 Score: 85.8853 bits (211), Expect = 7.162e-19
Identity = 69/231 (29.87%), Postives = 114/231 (49.35%), Query Frame = 3
Query:  120 SFWTALFAEFLGTFILVFIGL--GACYENGD-VLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAA-KSISLMTYETYNKTHGISHAHAP---WDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHS-----NMKLIW----IYIVGPLIGGILAGLVQQLFFTSE 764
            S  T   AEFLG    V++G    + ++  D +L  A A G    I +     +SGGH NPAVS  +  A ++       Y++ Q++G +  A  + ++++ E        +   +P   W + L  E +++F LV T++    +         LA L IG+++++ +L   +I+G SMNPARSLGP+I+ S          W    IY  GPL+G  +A  + +LF + E
Sbjct:   42 SLLTKCVAEFLGDLTFVYVGTMQASLFQYADGILHAAFAHGFTIFILVTAFGHISGGHFNPAVSWAIAGAGKMPIFHLPFYVVSQLLGGICGAFLTAAVLSQEQLTSCEAGATLLSPGSQWWQGLIAETVVTFFLVHTILITAADTDTVT----LAPLAIGLTLSIDILSTGSITGASMNPARSLGPSIIGSIFATQKTSFYWNNHYIYWAGPLLGSTIALCIYKLFESRE 268          
BLAST of Aquaporin vs. Ensembl Celegans
Match: aqp-2 (AQuaPorin or aquaglyceroporin related [Source:UniProtKB/TrEMBL;Acc:Q17571])

HSP 1 Score: 74.7146 bits (182), Expect = 7.205e-15
Identity = 70/234 (29.91%), Postives = 100/234 (42.74%), Query Frame = 3
Query:  132 ALFAEFLGTFILVFIGLGACYEN-------GDVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKT-----HGISHAHAPWDKA------------LYCEIIISFV--LVFTVMRMCVEKSRSEVEKGLAALLIGIS-ITVGVLCGANISGGSMNPARSLGPAIVHSNM-------KLIWIYIVGPLIGGILA 731
            A+ AEF GT++L  IGL    +         + + V + FG+    G+ +SA LSGGHINPAVS   L   QI+ V+ I Y + Q  GA   A ++    Y  YN        G+     P D A            L    +  FV   VF  +   +   R+     L  +L+G   + +G   G N  G  +NPAR   P +  S         K  W+ IVGP +G ++ 
Sbjct:   19 AVLAEFTGTYLLCLIGLSVVAQKVLPRPEVNEFIGVNVGFGIAIVFGVAVSAKLSGGHINPAVSFAFLSVGQITIVQFIAYFVAQFFGAFFGAATV----YAVYNDAINVFDGGVRTVGGPKDTAGIFASYPAPHLGLVNGFVDQFVATAVFVFLIAHIVDKRNSYPTWLQPILVGTGFVAIGAAFGYN-CGYPVNPARDFAPRLFTSIFYGGAVFTKWFWVPIVGPFVGAVVG 247          
BLAST of Aquaporin vs. Ensembl Fly
Match: Drip (gene:FBgn0015872 transcript:FBtr0331387)

HSP 1 Score: 136.346 bits (342), Expect = 1.535e-37
Identity = 90/250 (36.00%), Postives = 138/250 (55.20%), Query Frame = 3
Query:   69 LVKQLRIWSSLQDVTKTS-FWTALFAEFLGTFILVFIGLGACYENGDVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGISHAHAPWDKALYC------EIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSELSREHI--YDF 791
            +V ++  +  + D+T+    W  L  E +GTF L+F+G+G+   +G V ++A  FGL  A        LSG HINPAV++G L+  +IS ++   YI+ Q +GA+  A  I +          G+S     +D +L C      E +I+F+LVF V++   +  R ++ KG A L +G++I  G LC   +SG SMNPARS GPA+V       W+Y VGP+ GG+LAG++ +L F      +    YDF
Sbjct:    1 MVFEMSKFVGVADITENKKIWRMLLGELVGTFFLIFVGVGST-TSGSVPQIAFTFGLTVATIAQGLGHLSGCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVIKVALDGVAGGDLGVSS----FDPSLNCAQAVLIEALITFILVF-VVKAVSDPGRQDI-KGSAPLAVGLAIAAGHLCAIKLSGASMNPARSFGPAVVQGVWTYHWVYWVGPIAGGLLAGIIYRLIFKVRKGDDETDSYDF 243          
BLAST of Aquaporin vs. Ensembl Fly
Match: Drip (gene:FBgn0015872 transcript:FBtr0088141)

HSP 1 Score: 135.961 bits (341), Expect = 2.618e-37
Identity = 89/241 (36.93%), Postives = 133/241 (55.19%), Query Frame = 3
Query:   96 SLQDVTKTS-FWTALFAEFLGTFILVFIGLGACYENGDVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGISHAHAPWDKALYC------EIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSELSREHI--YDF 791
             + D+T+    W  L  E +GTF L+F+G+G+   +G V ++A  FGL  A        LSG HINPAV++G L+  +IS ++   YI+ Q +GA+  A  I +          G+S     +D +L C      E +I+F+LVF V++   +  R ++ KG A L +G++I  G LC   +SG SMNPARS GPA+V       W+Y VGP+ GG+LAG++ +L F      +    YDF
Sbjct:   12 GVADITENKKIWRMLLGELVGTFFLIFVGVGST-TSGSVPQIAFTFGLTVATIAQGLGHLSGCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVIKVALDGVAGGDLGVSS----FDPSLNCAQAVLIEALITFILVF-VVKAVSDPGRQDI-KGSAPLAVGLAIAAGHLCAIKLSGASMNPARSFGPAVVQGVWTYHWVYWVGPIAGGLLAGIIYRLIFKVRKGDDETDSYDF 245          
BLAST of Aquaporin vs. Ensembl Fly
Match: Drip (gene:FBgn0015872 transcript:FBtr0088142)

HSP 1 Score: 135.961 bits (341), Expect = 2.618e-37
Identity = 89/241 (36.93%), Postives = 133/241 (55.19%), Query Frame = 3
Query:   96 SLQDVTKTS-FWTALFAEFLGTFILVFIGLGACYENGDVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGISHAHAPWDKALYC------EIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSELSREHI--YDF 791
             + D+T+    W  L  E +GTF L+F+G+G+   +G V ++A  FGL  A        LSG HINPAV++G L+  +IS ++   YI+ Q +GA+  A  I +          G+S     +D +L C      E +I+F+LVF V++   +  R ++ KG A L +G++I  G LC   +SG SMNPARS GPA+V       W+Y VGP+ GG+LAG++ +L F      +    YDF
Sbjct:   12 GVADITENKKIWRMLLGELVGTFFLIFVGVGST-TSGSVPQIAFTFGLTVATIAQGLGHLSGCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVIKVALDGVAGGDLGVSS----FDPSLNCAQAVLIEALITFILVF-VVKAVSDPGRQDI-KGSAPLAVGLAIAAGHLCAIKLSGASMNPARSFGPAVVQGVWTYHWVYWVGPIAGGLLAGIIYRLIFKVRKGDDETDSYDF 245          
BLAST of Aquaporin vs. Ensembl Fly
Match: Drip (gene:FBgn0015872 transcript:FBtr0331388)

HSP 1 Score: 135.576 bits (340), Expect = 3.313e-37
Identity = 89/241 (36.93%), Postives = 133/241 (55.19%), Query Frame = 3
Query:   96 SLQDVTKTS-FWTALFAEFLGTFILVFIGLGACYENGDVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGISHAHAPWDKALYC------EIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSELSREHI--YDF 791
             + D+T+    W  L  E +GTF L+F+G+G+   +G V ++A  FGL  A        LSG HINPAV++G L+  +IS ++   YI+ Q +GA+  A  I +          G+S     +D +L C      E +I+F+LVF V++   +  R ++ KG A L +G++I  G LC   +SG SMNPARS GPA+V       W+Y VGP+ GG+LAG++ +L F      +    YDF
Sbjct:    9 GVADITENKKIWRMLLGELVGTFFLIFVGVGST-TSGSVPQIAFTFGLTVATIAQGLGHLSGCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVIKVALDGVAGGDLGVSS----FDPSLNCAQAVLIEALITFILVF-VVKAVSDPGRQDI-KGSAPLAVGLAIAAGHLCAIKLSGASMNPARSFGPAVVQGVWTYHWVYWVGPIAGGLLAGIIYRLIFKVRKGDDETDSYDF 242          
BLAST of Aquaporin vs. Ensembl Fly
Match: Drip (gene:FBgn0015872 transcript:FBtr0331389)

HSP 1 Score: 135.576 bits (340), Expect = 3.330e-37
Identity = 89/241 (36.93%), Postives = 133/241 (55.19%), Query Frame = 3
Query:   96 SLQDVTKTS-FWTALFAEFLGTFILVFIGLGACYENGDVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGISHAHAPWDKALYC------EIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSELSREHI--YDF 791
             + D+T+    W  L  E +GTF L+F+G+G+   +G V ++A  FGL  A        LSG HINPAV++G L+  +IS ++   YI+ Q +GA+  A  I +          G+S     +D +L C      E +I+F+LVF V++   +  R ++ KG A L +G++I  G LC   +SG SMNPARS GPA+V       W+Y VGP+ GG+LAG++ +L F      +    YDF
Sbjct:    6 GVADITENKKIWRMLLGELVGTFFLIFVGVGST-TSGSVPQIAFTFGLTVATIAQGLGHLSGCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVIKVALDGVAGGDLGVSS----FDPSLNCAQAVLIEALITFILVF-VVKAVSDPGRQDI-KGSAPLAVGLAIAAGHLCAIKLSGASMNPARSFGPAVVQGVWTYHWVYWVGPIAGGLLAGIIYRLIFKVRKGDDETDSYDF 239          
BLAST of Aquaporin vs. Ensembl Zebrafish
Match: aqp4 (aquaporin 4 [Source:ZFIN;Acc:ZDB-GENE-040724-152])

HSP 1 Score: 127.102 bits (318), Expect = 4.481e-33
Identity = 92/273 (33.70%), Postives = 144/273 (52.75%), Query Frame = 3
Query:   21 QQTLSEVNMPESKCNTLVKQLR-------IWSSLQDVTKTSFWTALFAEFLGTFILVFIGLG------ACYEN---GDVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGISHAHAPWDK--ALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSELSREHIY 785
            ++  S V++    C  + + +        I ++ + V    FW A+  EFL   I V + LG      A  EN    D++ ++L FGL  A  +     +SG HINPAV+V ++  R++S  + + Y+L Q +GA++ A  +  +T  +     G++  +       A+  E+II+F LVFTV   C  K R+++ KG AAL IG+S+ +G L     +G SMNPARS GPA++    +  W+Y VGPLIGGILA  V +  F  +   +  Y
Sbjct:    2 RKAFSRVSVQNKSCGVIRRCVSSCSCNNSIMAAFKGVWTQEFWRAVSGEFLAMIIFVLLSLGSTINWGAKQENPPPADLVLISLCFGLSIATLVQCFGHISGAHINPAVTVAMVATRKLSLAKGVFYLLAQCLGAVVGAAILYGVTPASVRGGMGVTSVNEEISAGHAIVIELIITFELVFTVFATCDPK-RNDL-KGSAALAIGLSVCIGHLFAIPYTGASMNPARSFGPAVIMVKWQDHWVYWVGPLIGGILAAAVYEYLFCPDPDLKRRY 272          
BLAST of Aquaporin vs. Ensembl Zebrafish
Match: aqp4 (aquaporin 4 [Source:ZFIN;Acc:ZDB-GENE-040724-152])

HSP 1 Score: 126.716 bits (317), Expect = 5.507e-33
Identity = 87/244 (35.66%), Postives = 133/244 (54.51%), Query Frame = 3
Query:   87 IWSSLQDVTKTSFWTALFAEFLGTFILVFIGLGACYENG---------DVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGISHAHAPWDK--ALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSELSREHIY 785
            I ++ + V    FW A+  EFL   I V + LG+    G         D++ ++L FGL  A  +     +SG HINPAV+V ++  R++S  + + Y+L Q +GA++ A  +  +T  +     G++  +       A+  E+II+F LVFTV   C  K R+++ KG AAL IG+S+ +G L     +G SMNPARS GPA++    +  W+Y VGPLIGGILA  V +  F  +   +  Y
Sbjct:   23 IMAAFKGVWTQEFWRAVSGEFLAMIIFVLLSLGSTINWGAKQENPPPADLVLISLCFGLSIATLVQCFGHISGAHINPAVTVAMVATRKLSLAKGVFYLLAQCLGAVVGAAILYGVTPASVRGGMGVTSVNEEISAGHAIVIELIITFELVFTVFATCDPK-RNDL-KGSAALAIGLSVCIGHLFAIPYTGASMNPARSFGPAVIMVKWQDHWVYWVGPLIGGILAAAVYEYLFCPDPDLKRRY 264          
BLAST of Aquaporin vs. Ensembl Zebrafish
Match: mipa (major intrinsic protein of lens fiber a [Source:ZFIN;Acc:ZDB-GENE-040801-41])

HSP 1 Score: 119.013 bits (297), Expect = 1.009e-30
Identity = 86/239 (35.98%), Postives = 113/239 (47.28%), Query Frame = 3
Query:   99 LQDVTKTSFWTALFAEFLGTFILVFIGLGAC--YENG--DVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGISHAHAPWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSELSREHIYDFLVNP 803
            + +    SFW A+FAEF GT   VF GLGA   +  G  +VL+VA  FGL  A  I     +SGGHINPAV+   L+  Q+S  R   YI  Q +GAL  A  +  +T         ++         +   I I   L   V    V   R     G AAL IG S+ VG L G   +G  MNPARS  PA+++ N    W+Y VGP+IG  +  L              +YDF++ P
Sbjct:    1 MWEFRSMSFWRAVFAEFYGTMFFVFFGLGAALRWTTGPHNVLQVAFCFGLAAATFIQSIGHISGGHINPAVTFAYLIGSQMSLFRAFFYICAQCLGALAGAAVLYGVTPTNMRGNLALNTLQPGISMGMATTIEIFLTLQLVVCVFAVTDERRNGRLGSAALSIGFSVLVGHLLGMYYTGAGMNPARSFAPAVLYRNFINHWVYWVGPMIGAAMGAL--------------LYDFMLFP 225          
BLAST of Aquaporin vs. Ensembl Zebrafish
Match: mipa (major intrinsic protein of lens fiber a [Source:ZFIN;Acc:ZDB-GENE-040801-41])

HSP 1 Score: 119.013 bits (297), Expect = 1.009e-30
Identity = 86/239 (35.98%), Postives = 113/239 (47.28%), Query Frame = 3
Query:   99 LQDVTKTSFWTALFAEFLGTFILVFIGLGAC--YENG--DVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGISHAHAPWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSELSREHIYDFLVNP 803
            + +    SFW A+FAEF GT   VF GLGA   +  G  +VL+VA  FGL  A  I     +SGGHINPAV+   L+  Q+S  R   YI  Q +GAL  A  +  +T         ++         +   I I   L   V    V   R     G AAL IG S+ VG L G   +G  MNPARS  PA+++ N    W+Y VGP+IG  +  L              +YDF++ P
Sbjct:    1 MWEFRSMSFWRAVFAEFYGTMFFVFFGLGAALRWTTGPHNVLQVAFCFGLAAATFIQSIGHISGGHINPAVTFAYLIGSQMSLFRAFFYICAQCLGALAGAAVLYGVTPTNMRGNLALNTLQPGISMGMATTIEIFLTLQLVVCVFAVTDERRNGRLGSAALSIGFSVLVGHLLGMYYTGAGMNPARSFAPAVLYRNFINHWVYWVGPMIGAAMGAL--------------LYDFMLFP 225          
BLAST of Aquaporin vs. Ensembl Zebrafish
Match: aqp1a.2 (aquaporin 1a (Colton blood group), tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-100409-1])

HSP 1 Score: 118.242 bits (295), Expect = 2.298e-30
Identity = 91/253 (35.97%), Postives = 135/253 (53.36%), Query Frame = 3
Query:   69 LVKQLRIWSSLQDVTKTSFWTALFAEFLGTFILVFIGLGACYEN------GDVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGISH--AHAPWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSELSREHIYDFLVNP 803
            + ++L+ WS         FW A+ AEF+G  I VFIG+ +   N         +KVALAFGL  A        +SG H+NPA+++GLLV+ QISF R  +YI+ Q++GA+LA+  I        + T G++         +    E+  +F LV  V+    +K+R++V  G A L IG+S+ +G L   + +G  +NPARS GPA+V  + K  WIY + P+ GG+ A L              IYDFL+ P
Sbjct:    1 MARELKSWS---------FWRAVLAEFVGMTIFVFIGIASAIGNKHNRYPDQEVKVALAFGLAIATLAQSLGHISGAHLNPAITLGLLVSCQISFFRAFMYIIAQMLGAVLAS-GIMFKVSPDPDTTLGLNMLGNGVKVGQGFAIELFATFQLVLCVL-ATTDKNRTDVS-GSAPLAIGLSVGLGHLVAISYTGCGINPARSFGPAVVLESFKNHWIYWIAPMCGGVAAAL--------------IYDFLLFP 227          
BLAST of Aquaporin vs. Ensembl Xenopus
Match: ppil2 (peptidylprolyl isomerase like 2 [Source:Xenbase;Acc:XB-GENE-855860])

HSP 1 Score: 128.257 bits (321), Expect = 2.066e-33
Identity = 90/266 (33.83%), Postives = 140/266 (52.63%), Query Frame = 3
Query:   42 NMPES----KCNTLVKQLRIWSSLQDVTKTSFWTALFAEFLGTFILVFIGLGACY--------ENGDVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGISHAHAPWDKA--LYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSELS-REHIYDFL 794
            + PE+    KC  L K   I ++ + V    FW A+  EFL   I V + LG+          +  D++ +AL FGL  A  +     +SGGHINPAV+V ++  R+IS  + I YI+ Q +GA+  A  + L+T        G +  +     A  L  E+II+F LVFT+   C  K R ++  G  AL IG S+ +G L     +G SMNPARS GPA++ +  +  W+Y VGP++G ++AG + +  +  +   + H+ + L
Sbjct:    3 DRPEASLRGKCGALCKCDEIMAACKGVWTQEFWKAVTGEFLAMLIFVLLSLGSTINWSPKDNPQPADLVLIALCFGLSIATLVQCFGHISGGHINPAVTVAMVSMRKISLAKSIFYIVAQCLGAIAGAGILYLVTPSDVAGNLGATMVNTKLSSAHGLLVELIITFQLVFTICASCDPK-RKDIS-GSVALAIGFSVAIGHLFAIPYTGASMNPARSFGPAVIMNKWESHWVYWVGPVLGAVIAGALYEYVYCPDPELKNHLKEVL 266          
BLAST of Aquaporin vs. Ensembl Xenopus
Match: aqp2 (aquaporin 2 [Source:NCBI gene;Acc:548466])

HSP 1 Score: 119.398 bits (298), Expect = 1.528e-30
Identity = 81/223 (36.32%), Postives = 122/223 (54.71%), Query Frame = 3
Query:  102 QDVTKTSFWTALFAEFLGTFILVFIGLGACYE----NGDVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGISH-AHAPWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFF 755
             ++   +F  A+FAEFL T I VF+G+G+         +VL+++LAFGL  +  +     +SG HINPAV++  L+   ISF+R + YI+ Q++GA+  A  +S +          I+   +    +A   E+ ++F LV  V       SR     G  A+ IG+S+TVG L G  ++G SMNPARS GPA +       W++ +GPL+GGILA L     F
Sbjct:    3 NEICSLAFVRAVFAEFLATMIFVFLGMGSALSWKPSLPNVLQISLAFGLAISTLVQAFGHISGAHINPAVTIAFLIGCHISFLRALFYIIAQLVGAIAGAAIVSAIAPLDARGNLAINEVTNGSPGQACAVELFLTFQLVLCVF--ASTDSRRSDNVGSPAISIGLSVTVGHLLGIYLTGCSMNPARSFGPAAITGIFTDHWVFWIGPLVGGILASLFYNYIF 223          
BLAST of Aquaporin vs. Ensembl Xenopus
Match: aqp5 (aquaporin 5 [Source:NCBI gene;Acc:100491662])

HSP 1 Score: 119.013 bits (297), Expect = 3.194e-30
Identity = 89/230 (38.70%), Postives = 120/230 (52.17%), Query Frame = 3
Query:  123 FWTALFAEFLGTFILVFIGLGACYE----NGDVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGI---SHAHAPWDKALYCEIIISFVLVFTVMRMCV---EKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLV-QQLFFTSELSREH 779
            FW A+FAEFL T I VF GLG+          VL+++LAFGL     +     +SG HINPAV++  LV  QIS +R   YI+ Q++G L  A  +  +          I   S+   P   A   E+I++F LV     MC+     SR E   G  AL IG+S+T+G L G   +G SMNPARS  PA+V       W++ +GPL GG+LA L    + F S  +R  
Sbjct:   10 FWKAIFAEFLATLIFVFFGLGSALRWPAALPTVLQISLAFGLVIGTLVQSVGHISGAHINPAVTMSFLVGSQISLIRAFFYIIAQLLGGLAGAGILYGVVSPNVRGNLAINTLSNNITP-GVAFVVEMILTFQLV-----MCIFASTDSRREDNVGSPALSIGLSVTLGHLVGIYFTGCSMNPARSFAPAVVVRRFTNHWVFWIGPLAGGMLASLTYNYILFPSTKTRSQ 233          
BLAST of Aquaporin vs. Ensembl Xenopus
Match: clip3 (CAP-Gly domain containing linker protein 3 [Source:Xenbase;Acc:XB-GENE-5806327])

HSP 1 Score: 115.546 bits (288), Expect = 3.202e-29
Identity = 82/237 (34.60%), Postives = 129/237 (54.43%), Query Frame = 3
Query:   99 LQDVTKTSFWTALFAEFLGTFILVFIGLGACY----ENGDVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGIS--HAHAPWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLV-------QQLFFTSELS 770
            ++++    F  A  AEFLGT + VF GL +      E   VL+++L FGLG    +     +SG H+NPAV++  LVA QIS  R + YI  Q++GA++ A  +   T E+ +   G++    +    +A+  E+I++  L+  V     + +R +   G  ++ IG+S+ VG L G   +G SMNPARS GPA++  N    WI+ +GP  G I+A L+       QQ  F+ +LS
Sbjct:    1 MKEICTGPFTRAFVAEFLGTLVFVFFGLCSAMQWAPELPSVLQISLTFGLGVGTIVQAVGHISGAHLNPAVTIAFLVASQISLFRALCYICAQLLGAVVGAALLHEFTPESVHGNFGVNLLSNNTTEGQAVTVEMILTLQLILCVFAS-TDSNRCD-NVGSPSISIGLSVAVGHLVGIYFTGCSMNPARSFGPALIAGNFDAHWIFWIGPFTGAIIASLLYNYVLCPQQQSFSEKLS 235          
BLAST of Aquaporin vs. Ensembl Xenopus
Match: c1orf116 (chromosome 1 open reading frame 116 [Source:Xenbase;Acc:XB-GENE-1014590])

HSP 1 Score: 115.161 bits (287), Expect = 4.375e-29
Identity = 81/234 (34.62%), Postives = 116/234 (49.57%), Query Frame = 3
Query:  120 SFWTALFAEFLGTFILVFIGLGACYE----NGDVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGIS--HAHAPWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSELSREHIYDFLVNP 803
            +FW A+FAEF  T   VF GLGA  +      +VL +ALAFG   A  +     +SG HINPAV+   L+  Q+SF R I YI  Q++GA+  A  +  +T         ++  H      +A   E  ++   V  +     E+    +  G  +L +G S+ +G L G   +G SMNPARS  PA++  N    W+Y VGP+IGG + GLV              YDF++ P
Sbjct:    9 AFWRAIFAEFFATMFYVFFGLGASLKWAAGPANVLNIALAFGFALATLVQSVGHISGAHINPAVTFAFLIGSQMSFFRAIFYIAAQLLGAVAGAAVLYGVTPTAVRGNLALNTIHPGVSLGQATTVEAFLTLQFVLCIFATFDERRNGRM--GSVSLALGFSVALGHLFGIYYTGASMNPARSFAPAVLTRNFVNHWVYWVGPIIGGAVGGLV--------------YDFILFP 226          
BLAST of Aquaporin vs. Ensembl Mouse
Match: Aqp4 (aquaporin 4 [Source:MGI Symbol;Acc:MGI:107387])

HSP 1 Score: 140.198 bits (352), Expect = 6.125e-38
Identity = 91/247 (36.84%), Postives = 138/247 (55.87%), Query Frame = 3
Query:   57 KCNTLVKQLRIWSSLQDVTKTSFWTALFAEFLGTFILVFIGLGACYENG--------DVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGIS--HAHAPWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSEL 767
            KC     +  I  + + V   +FW A+ AEFL T I V +G+G+    G        D++ ++L FGL  A  +     +SGGHINPAV+V ++  R+IS  + + YI+ Q +GA++ A  + L+T  +     G++  H +      L  E+II+F LVFT+   C  K R++V  G  AL IG S+ +G L   N +G SMNPARS GPA++  N    WIY VGP++G +LAG + +  F  ++
Sbjct:   12 KCGHSCSRESIMVAFKGVWTQAFWKAVSAEFLATLIFVLLGVGSTINWGGSENPLPVDMVLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRKISIAKSVFYIIAQCLGAIIGAGILYLVTPPSVVGGLGVTTVHGNLTAGHGLLVELIITFQLVFTIFASCDSK-RTDV-TGSIALAIGFSVAIGHLFAINYTGASMNPARSFGPAVIMGNWANHWIYWVGPIMGAVLAGALYEYVFCPDV 256          
BLAST of Aquaporin vs. Ensembl Mouse
Match: Aqp4 (aquaporin 4 [Source:MGI Symbol;Acc:MGI:107387])

HSP 1 Score: 137.117 bits (344), Expect = 5.190e-37
Identity = 87/234 (37.18%), Postives = 134/234 (57.26%), Query Frame = 3
Query:   96 SLQDVTKTSFWTALFAEFLGTFILVFIGLGACYENG--------DVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGIS--HAHAPWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSEL 767
            + + V   +FW A+ AEFL T I V +G+G+    G        D++ ++L FGL  A  +     +SGGHINPAV+V ++  R+IS  + + YI+ Q +GA++ A  + L+T  +     G++  H +      L  E+II+F LVFT+   C +  R++V  G  AL IG S+ +G L   N +G SMNPARS GPA++  N    WIY VGP++G +LAG + +  F  ++
Sbjct:    3 AFKGVWTQAFWKAVSAEFLATLIFVLLGVGSTINWGGSENPLPVDMVLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRKISIAKSVFYIIAQCLGAIIGAGILYLVTPPSVVGGLGVTTVHGNLTAGHGLLVELIITFQLVFTIFASC-DSKRTDV-TGSIALAIGFSVAIGHLFAINYTGASMNPARSFGPAVIMGNWANHWIYWVGPIMGAVLAGALYEYVFCPDV 234          
BLAST of Aquaporin vs. Ensembl Mouse
Match: Aqp4 (aquaporin 4 [Source:MGI Symbol;Acc:MGI:107387])

HSP 1 Score: 137.117 bits (344), Expect = 5.190e-37
Identity = 87/234 (37.18%), Postives = 134/234 (57.26%), Query Frame = 3
Query:   96 SLQDVTKTSFWTALFAEFLGTFILVFIGLGACYENG--------DVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGIS--HAHAPWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSEL 767
            + + V   +FW A+ AEFL T I V +G+G+    G        D++ ++L FGL  A  +     +SGGHINPAV+V ++  R+IS  + + YI+ Q +GA++ A  + L+T  +     G++  H +      L  E+II+F LVFT+   C +  R++V  G  AL IG S+ +G L   N +G SMNPARS GPA++  N    WIY VGP++G +LAG + +  F  ++
Sbjct:    3 AFKGVWTQAFWKAVSAEFLATLIFVLLGVGSTINWGGSENPLPVDMVLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRKISIAKSVFYIIAQCLGAIIGAGILYLVTPPSVVGGLGVTTVHGNLTAGHGLLVELIITFQLVFTIFASC-DSKRTDV-TGSIALAIGFSVAIGHLFAINYTGASMNPARSFGPAVIMGNWANHWIYWVGPIMGAVLAGALYEYVFCPDV 234          
BLAST of Aquaporin vs. Ensembl Mouse
Match: Aqp4 (aquaporin 4 [Source:MGI Symbol;Acc:MGI:107387])

HSP 1 Score: 137.117 bits (344), Expect = 5.190e-37
Identity = 87/234 (37.18%), Postives = 134/234 (57.26%), Query Frame = 3
Query:   96 SLQDVTKTSFWTALFAEFLGTFILVFIGLGACYENG--------DVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGIS--HAHAPWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSEL 767
            + + V   +FW A+ AEFL T I V +G+G+    G        D++ ++L FGL  A  +     +SGGHINPAV+V ++  R+IS  + + YI+ Q +GA++ A  + L+T  +     G++  H +      L  E+II+F LVFT+   C +  R++V  G  AL IG S+ +G L   N +G SMNPARS GPA++  N    WIY VGP++G +LAG + +  F  ++
Sbjct:    3 AFKGVWTQAFWKAVSAEFLATLIFVLLGVGSTINWGGSENPLPVDMVLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRKISIAKSVFYIIAQCLGAIIGAGILYLVTPPSVVGGLGVTTVHGNLTAGHGLLVELIITFQLVFTIFASC-DSKRTDV-TGSIALAIGFSVAIGHLFAINYTGASMNPARSFGPAVIMGNWANHWIYWVGPIMGAVLAGALYEYVFCPDV 234          
BLAST of Aquaporin vs. Ensembl Mouse
Match: Aqp4 (aquaporin 4 [Source:MGI Symbol;Acc:MGI:107387])

HSP 1 Score: 137.117 bits (344), Expect = 5.190e-37
Identity = 87/234 (37.18%), Postives = 134/234 (57.26%), Query Frame = 3
Query:   96 SLQDVTKTSFWTALFAEFLGTFILVFIGLGACYENG--------DVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGIS--HAHAPWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSEL 767
            + + V   +FW A+ AEFL T I V +G+G+    G        D++ ++L FGL  A  +     +SGGHINPAV+V ++  R+IS  + + YI+ Q +GA++ A  + L+T  +     G++  H +      L  E+II+F LVFT+   C +  R++V  G  AL IG S+ +G L   N +G SMNPARS GPA++  N    WIY VGP++G +LAG + +  F  ++
Sbjct:    3 AFKGVWTQAFWKAVSAEFLATLIFVLLGVGSTINWGGSENPLPVDMVLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRKISIAKSVFYIIAQCLGAIIGAGILYLVTPPSVVGGLGVTTVHGNLTAGHGLLVELIITFQLVFTIFASC-DSKRTDV-TGSIALAIGFSVAIGHLFAINYTGASMNPARSFGPAVIMGNWANHWIYWVGPIMGAVLAGALYEYVFCPDV 234          
BLAST of Aquaporin vs. UniProt/SwissProt
Match: sp|G5CTG2|AQP5_MILTA (Aquaporin-5 OS=Milnesium tardigradum OX=46460 GN=AQP5 PE=2 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 7.408e-41
Identity = 99/241 (41.08%), Postives = 147/241 (61.00%), Query Frame = 3
Query:   93 SSLQDVTKTSFWTALFAEFLGTFILVFIGLGACY-----ENGD--VLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNK----THGISHAHAPW----DKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSELS 770
            SS++D+ K  FW AL AEF+GT +LV+IG GA        N D  V +V+LAFGL  A  ++    +SGGHINPAVS+G LV R+IS VR +LY+ FQ  GA+  A  +   T+++  +    T+ ++  +  +     + +  E II+FVLVFTV   C +  RS++ KG   L IGI++ +  L    ++G SMNPARSLGPA++       W++ VGP++GG +AGL+  + F ++ S
Sbjct:    8 SSIEDLAKIQFWKALGAEFIGTAVLVYIGCGAAVTSTPDANRDAFVTRVSLAFGLTVATMVWAICGVSGGHINPAVSLGFLVTRRISLVRFLLYVAFQCSGAVAGAALLYASTFDSVKRGGFGTNSMATENGQYLISPAQGILIEAIITFVLVFTVFATC-DAKRSDL-KGSGPLAIGIAVLISHLVAIPLTGTSMNPARSLGPAVLIGFWTDHWVFWVGPMLGGAVAGLLYDMAFAADAS 246          
BLAST of Aquaporin vs. UniProt/SwissProt
Match: sp|Q9NHW7|AQP_AEDAE (Aquaporin AQPAe.a OS=Aedes aegypti OX=7159 GN=AAEL003512 PE=2 SV=2)

HSP 1 Score: 145.206 bits (365), Expect = 8.234e-40
Identity = 101/248 (40.73%), Postives = 138/248 (55.65%), Query Frame = 3
Query:   72 VKQLRIWSSLQDVTKT-SFWTALFAEFLGTFILVFIGLGACYE-NGD----VLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGIS--HAHAPWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSELSREHIYDF 791
            VKQL     + D+T+  + W  L AEFLGTF LV IG+G+     GD    + ++A  FGL  A        +SG HINPAV++GL++   IS ++   YI+ Q +GA+  A  I   T        G++         + +  E +I+F+LVF V  +C +  RS++ KG A L IG+SIT G L     +G SMNPARS GPA+V  N    W+Y VGP++GGILAG V +LFF      E  YDF
Sbjct:    7 VKQL---VGVADITENRNIWRMLVAEFLGTFFLVSIGIGSTMGWGGDYAPTMTQIAFTFGLVVATLAQAFGHVSGCHINPAVTIGLMITADISILKGAFYIVSQCVGAIAGAALIKAATPSDVIGGLGVTGIDPRLTAGQGVMIEALITFILVFVVHGVC-DNRRSDI-KGSAPLAIGLSITAGHLSAIKYTGASMNPARSFGPAVVMGNWTDQWVYWVGPIVGGILAGAVYRLFFKVRKGDEESYDF 249          
BLAST of Aquaporin vs. UniProt/SwissProt
Match: sp|Q923J4|AQP4_DIPME (Aquaporin-4 OS=Dipodomys merriami OX=94247 GN=AQP4 PE=2 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 1.747e-38
Identity = 93/250 (37.20%), Postives = 140/250 (56.00%), Query Frame = 3
Query:   48 PESKCNTLVKQLRIWSSLQDVTKTSFWTALFAEFLGTFILVFIGLGACYENG--------DVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGIS--HAHAPWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSEL 767
            P  KC +L ++  I  + + V   +FW A+ AEFL   I V + LG+    G        D++ ++L FGL  A  +     +SGGHINPAV+V ++  R+IS  + + YI  Q +GA++ A  + L+T  +     G++  H +      L  E+II+F LVFT+   C  K R++V  G  AL IG S+ +G L   N +G SMNPARS GPA++  N +  WIY VGP+IG +LAG + +  F  ++
Sbjct:    9 PWGKCGSLCRREEIMVAFKGVWTQAFWKAVTAEFLAMLIFVLLSLGSTINWGGKENPLPVDMVLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRKISIAKSVFYIAAQCLGAIIGAGILYLVTPPSVVGGLGVTTVHGNLTAGHGLLVELIITFQLVFTIFASCDSK-RTDV-TGSIALAIGFSVAIGHLFAINYTGASMNPARSFGPAVIMGNWENHWIYWVGPIIGAVLAGGLYEYVFCPDV 256          
BLAST of Aquaporin vs. UniProt/SwissProt
Match: sp|Q7PWV1|AQP_ANOGA (Aquaporin AQPAn.G OS=Anopheles gambiae OX=7165 GN=AGAP008842 PE=3 SV=4)

HSP 1 Score: 140.584 bits (353), Expect = 6.141e-38
Identity = 101/250 (40.40%), Postives = 141/250 (56.40%), Query Frame = 3
Query:   72 VKQLRIWSSLQDVTKT-SFWTALFAEFLGTFILVFIGLGACYENGD----VLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGISHAHAPW---DKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSELSRE--HIYDF 791
            VKQ+     + D+T+  + W  L AEFLGTF LV IG+G+     D    + ++A  FGL  A        +SG HINPAV++GL+V   +S ++   YI+ Q IGA+  A  I   T        G++   AP     + +  E +I+F+LVF V  +C +  R++V KG A L IG+SIT G L     +G SMNPARS GPA+V  N   +W+Y VGP++GGI+AG V +LFF      E  + YDF
Sbjct:    7 VKQI---VGVSDITENRNIWRMLVAEFLGTFFLVAIGIGSTTGWTDYSPTLTQIAFTFGLVVATLAQAFGHVSGCHINPAVTIGLIVTADVSILKGAFYIVSQCIGAIAGAAVIKAATPSEVVGGLGVT-GIAPGLSTGQGVLIEALITFMLVFVVHGVC-DNRRTDV-KGSAPLAIGLSITAGHLAAIKYTGASMNPARSFGPAVVMGNYTDLWVYWVGPIVGGIVAGAVYRLFFKVRKGDEESNSYDF 250          
BLAST of Aquaporin vs. UniProt/SwissProt
Match: sp|O77750|AQP4_BOVIN (Aquaporin-4 OS=Bos taurus OX=9913 GN=AQP4 PE=2 SV=3)

HSP 1 Score: 140.969 bits (354), Expect = 2.008e-37
Identity = 93/247 (37.65%), Postives = 138/247 (55.87%), Query Frame = 3
Query:   57 KCNTLVKQLRIWSSLQDVTKTSFWTALFAEFLGTFILVFIGLGACYENG--------DVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGIS--HAHAPWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSEL 767
            KC  L  +  I  + + V   +FW A+ AEFL   I V + LG+    G        D++ ++L FGL  A  +     +SGGHINPAV+V ++  R+IS  + + YI  Q +GA++ A  + L+T  +     G++  H +      L  E+II+F LVFT+   C  K R++V  G  AL IGIS+ +G L   N +G SMNPARS GPA++  N +  WIY VGP+IG +LAG + +  F  ++
Sbjct:   12 KCGPLCTRESIMVAFKGVWTQTFWKAVTAEFLAMLIFVLLSLGSTINWGGAEKPLPVDMVLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRRISIAKSVFYIAAQCLGAIIGAGILYLVTPPSVVGGLGVTTVHGNLSAGHGLLVELIITFQLVFTIFASCDSK-RTDV-TGSIALAIGISVAIGHLFAINYTGASMNPARSFGPAVIMGNWENHWIYWVGPIIGAVLAGGLYEYVFCPDV 256          
BLAST of Aquaporin vs. TrEMBL
Match: A0A0G4DC26 (Aquaporin OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 427.172 bits (1097), Expect = 2.224e-146
Identity = 237/322 (73.60%), Postives = 285/322 (88.51%), Query Frame = 3
Query:   45 MPESKCNTLVKQLRIWSSLQDVTKTSFWTALFAEFLGTFILVFIGLGACYENGDVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGISHAHAPWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSELSREHIYDFLVNPXXXXXXXXXXXXXXXXXXXXXXXXXXXXYEEFKQLEENRKYEENLKIKGSTLKADRYDENVKLTEMAEI 1010
            M ESKCN LVK LRIWSSLQD+T  +FWTALFAE  GTFILVFIGLGACY NG ++  ALAFGLGG+IGIY+S P+SGG+INPAVS+GLL+ARQISF+RC+LY+LFQ+IGALLAAK IS+MTYET+NKTHGISH   PWDKAL+CEI+ISF+LVFTVMRMCVEKSRSEVE+GLAALLIGISI VG+LCG NISGGSMNPAR+LGPAIV++ +  +WIYI GPLIGGILAGLVQQL FTSELS+++++D+L NPKF ME+E+++YEERK++EEFKKME RKKYEEFK+ +E + Y E+L+ K  ++K  R +E VKLT+MAE+
Sbjct:    2 MSESKCNFLVK-LRIWSSLQDITTRNFWTALFAECCGTFILVFIGLGACYSNGGLVGAALAFGLGGSIGIYVSGPISGGNINPAVSIGLLIARQISFIRCMLYMLFQVIGALLAAKCISIMTYETFNKTHGISHPSVPWDKALFCEIVISFILVFTVMRMCVEKSRSEVERGLAALLIGISIVVGILCGGNISGGSMNPARTLGPAIVNNKLNNVWIYIAGPLIGGILAGLVQQLLFTSELSKDYLFDYLTNPKFNMEEEYKKYEERKRYEEFKKMEERKKYEEFKKYQECKNYAESLEAKADSVKTSRSEEKVKLTDMAEL 322          
BLAST of Aquaporin vs. TrEMBL
Match: A0A0G4DCR1 (Aquaporin OS=Dugesia japonica OX=6161 GN=aquaporin PE=2 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 1.441e-69
Identity = 135/261 (51.72%), Postives = 171/261 (65.52%), Query Frame = 3
Query:   72 VKQLRIWSSLQDVTKTSFWTALFAEFLGTFILVFIGLGACYENGDVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGA-----LLAAKSISLMTYETY---NKTHGISHAHAPWDKALY----------CEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSELSREHIYDFLVN 800
            +K  R+ SS++DV   +FW +L AEFLGTFILVF+G G  Y N + +K+ L FGL GA+ I    P+SG HINPAVS GLLVARQIS +R I Y +FQIIGA     L++  S   + Y++Y   N T   S   A  D+ ++          CE++I+FVLVFTVMR+CVEK RS  EKG+A L IG+SIT GV CG NISGGSMNPA SLG          I  +I+GPL+GG LAG+ QQ+FFTS+LS  HI  +L +
Sbjct:    1 MKTFRLESSIKDVKTFNFWQSLVAEFLGTFILVFVGFGTAYNNMNPVKLGLGFGLAGAVAIVCIGPISGAHINPAVSCGLLVARQISLIRYIFYTIFQIIGATAGFGLISGVSSGEVLYKSYYKINFTSSPSLGEARIDEVIHRVTNPYLKIICELVITFVLVFTVMRLCVEKRRSPTEKGIAPLFIGLSITAGVYCGMNISGGSMNPAASLGKYFFKGGTT-IMTHIIGPLLGGALAGVSQQMFFTSDLSMSHIKSYLFD 260          
BLAST of Aquaporin vs. TrEMBL
Match: A0A4S2L3H4 (Uncharacterized protein OS=Temnothorax longispinosus OX=300112 GN=DBV15_09857 PE=3 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 1.710e-38
Identity = 98/247 (39.68%), Postives = 144/247 (58.30%), Query Frame = 3
Query:   75 KQLRIWSSLQDVTKTSFWTALFAEFLGTFILVFIGLGACYE-----NGDVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGIS--HAHAPWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQL-FFTSELSREHIYDF 791
            K ++ +  L++VTK  F   LFAE LGTF+LV IG  +C          VL +A  FGL  A    +  P+SG H+NPAVS GLL++   S ++ I YI+ Q  GA+  +  ++L+  +T+    G++  H      + +  EIII+F+LV  V+    +  R++V +G A L IG++I+V  +    ++G SMNPARSLGPA+V    K +WIY VGPLIGG +AG V +L    ++   E  YDF
Sbjct:    6 KGMKEFVGLEEVTKLDFLVMLFAEILGTFLLVLIGTASCISWTTTMPPSVLHIAFTFGLAVASLAQVLGPISGCHVNPAVSFGLLISGNCSLLKTISYIVCQCCGAIAGSAVLNLIIPKTHASGLGLTALHTEVTAGQGVGMEIIITFLLVL-VVHAVTDPKRTDV-RGWAPLAIGLTISVAHMAAVPVTGSSMNPARSLGPAVVDDEYKNLWIYWVGPLIGGSVAGGVYRLGLRANKEDDEGSYDF 250          
BLAST of Aquaporin vs. TrEMBL
Match: A0A023EL67 (Putative aquaporin major intrinsic protein family OS=Aedes albopictus OX=7160 PE=2 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 2.236e-38
Identity = 103/249 (41.37%), Postives = 139/249 (55.82%), Query Frame = 3
Query:   72 VKQLRIWSSLQDVTKT-SFWTALFAEFLGTFILVFIGLGACYENGD-----VLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNK---THGISHAHAPWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSELSREHIYDF 791
            VKQL     + D+T+  + W  L AEFLGTF LV IG+G+    GD     + ++A  FGL  A        +SG HINPAV++GL++   IS ++   YI+ Q +GA+  A  I   T           GI    +P  + +  E +I+F+LVF V  +C +  RS++ KG A L IG+SIT G L     +G SMNPARS GPA+V  N    W+Y VGP++GGILAG V +LFF      E  YDF
Sbjct:    7 VKQL---VGVADITENRNIWRMLVAEFLGTFFLVSIGIGSTMGWGDGYAPTMTQIAFTFGLVVATLAQAFGHVSGCHINPAVTIGLMITADISILKGAFYIVSQCVGAIAGAALIKAATPSDVIGGLGVTGIDPRLSP-GQGVMIEALITFILVFVVHGVC-DNRRSDI-KGSAPLAIGLSITAGHLSAIKYTGASMNPARSFGPAVVMGNWTDQWVYWVGPIVGGILAGAVYRLFFKVRKGDEESYDF 249          
BLAST of Aquaporin vs. TrEMBL
Match: A0A1S2ZJ33 (aquaporin-4 isoform X1 OS=Erinaceus europaeus OX=9365 GN=AQP4 PE=3 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 9.135e-38
Identity = 97/247 (39.27%), Postives = 141/247 (57.09%), Query Frame = 3
Query:   57 KCNTLVKQLRIWSSLQDVTKTSFWTALFAEFLGTFILVFIGLGACYENG--------DVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGIS--HAHAPWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSEL 767
            KC  L ++  I  + + V   +FW A+ AEFL TFI V + LG+    G        D++ ++L FGL  A  +     +SGGHINPAV+V ++  R+IS  + + YIL Q +GA++ A  + L+T  +     G++  H +      L  E+II+F LVFT+   C  K RS+V  G  AL IG S+ +G L   N +G SMNPARS GPA+V  N +  WIY VGP+IG +LAG + +  F  ++
Sbjct:   12 KCGRLCRREDIMVAFKGVWTQAFWKAVTAEFLATFIFVLLSLGSTINWGGMEKPLPVDMVLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRKISIAKSVFYILAQCLGAIIGAGILYLITPPSVVGGLGVTMVHGNLTAGHGLLVELIITFQLVFTIFASCDSK-RSDV-TGSIALAIGFSVAIGHLFAINYTGASMNPARSFGPAVVMGNWENHWIYWVGPIIGAVLAGGLYEYVFCPDV 256          
BLAST of Aquaporin vs. Ensembl Cavefish
Match: AQP4 (aquaporin-4 [Source:NCBI gene;Acc:103027636])

HSP 1 Score: 131.339 bits (329), Expect = 1.219e-34
Identity = 88/252 (34.92%), Postives = 141/252 (55.95%), Query Frame = 3
Query:   45 MPESKCNTLVKQLR-IWSSLQDVTKTSFWTALFAEFLGTFILVFIGLGAC------YEN---GDVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGIS--HAHAPWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSE 764
            +P   C +++   + IW+        +FW A+  EFL T I V + LG+        EN    D++ ++L FGL  A  +     +SGGHINPAV+  ++V R++S  + + YIL Q +GA++ A  + L+T        G++  +       AL  E++I+F L+FTV   C  K RS++ KG A+L IGI++ +G L     +G SMNPARS GPA+V  + +  W+Y VGP++GG+LA  + +  +  +
Sbjct:   23 LPSCSCESIMAAFKGIWTK-------AFWRAVSGEFLATLIFVLLSLGSTINWASGTENPPPADLVLISLCFGLSIATMVQCFGHISGGHINPAVTAAMVVTRKMSLAKALFYILAQCLGAIVGAGLLFLVTPSAVRGGMGVTTVNPRISVGHALVVELLITFELIFTVFSTCDHK-RSDL-KGSASLAIGIAVLIGHLFAIPYTGASMNPARSFGPAVVTWSWESHWVYWVGPILGGVLAAALYEYLYCPD 265          
BLAST of Aquaporin vs. Ensembl Cavefish
Match: AQP4 (aquaporin-4 [Source:NCBI gene;Acc:103027636])

HSP 1 Score: 130.954 bits (328), Expect = 1.351e-34
Identity = 88/252 (34.92%), Postives = 141/252 (55.95%), Query Frame = 3
Query:   45 MPESKCNTLVKQLR-IWSSLQDVTKTSFWTALFAEFLGTFILVFIGLGAC------YEN---GDVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGIS--HAHAPWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSE 764
            +P   C +++   + IW+        +FW A+  EFL T I V + LG+        EN    D++ ++L FGL  A  +     +SGGHINPAV+  ++V R++S  + + YIL Q +GA++ A  + L+T        G++  +       AL  E++I+F L+FTV   C  K RS++ KG A+L IGI++ +G L     +G SMNPARS GPA+V  + +  W+Y VGP++GG+LA  + +  +  +
Sbjct:   22 LPSCSCESIMAAFKGIWTK-------AFWRAVSGEFLATLIFVLLSLGSTINWASGTENPPPADLVLISLCFGLSIATMVQCFGHISGGHINPAVTAAMVVTRKMSLAKALFYILAQCLGAIVGAGLLFLVTPSAVRGGMGVTTVNPRISVGHALVVELLITFELIFTVFSTCDHK-RSDL-KGSASLAIGIAVLIGHLFAIPYTGASMNPARSFGPAVVTWSWESHWVYWVGPILGGVLAAALYEYLYCPD 264          
BLAST of Aquaporin vs. Ensembl Cavefish
Match: aqp4 (aquaporin-4-like [Source:NCBI gene;Acc:103030167])

HSP 1 Score: 122.865 bits (307), Expect = 1.715e-31
Identity = 86/242 (35.54%), Postives = 134/242 (55.37%), Query Frame = 3
Query:   93 SSLQDVTKTSFWTALFAEFLGTFILVFIGLGAC--YENG-------DVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGISHAHA--PWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFT--SELSREH 779
            ++ + V    FW A+  EFL   I V +GLG+   +  G       D++ ++L FGL  A  +     +SG HINPAV+  ++  R++S  + + Y+  Q IGA++    +  +T      + G++  +A      AL  E++I+F LVFTV   C  K RS++ KG AAL IG+S+ +G L     +G SMNPARS GPA++  + +  W+Y VGP+IG +LAG + +  F    EL R +
Sbjct:   31 AAFKGVWTQDFWRAVGGEFLAMLIFVLLGLGSTINWSAGQESPPPPDLVLISLCFGLSIATLVQCFGHISGAHINPAVTTAMVATRKLSLAKGVFYLGAQCIGAVVGTAILYGVTPPAVRGSLGVTSVNAGISTGHALVIELLITFELVFTVFATCDPK-RSDL-KGSAALAIGLSVCIGHLFAIPYTGASMNPARSFGPAVIMGHWENHWVYWVGPVIGAVLAGALYEYLFCPDPELKRHY 270          
BLAST of Aquaporin vs. Ensembl Cavefish
Match: ENSAMXT00000043631.1 (aquaporin-4-like [Source:NCBI gene;Acc:103025508])

HSP 1 Score: 116.316 bits (290), Expect = 1.219e-29
Identity = 74/238 (31.09%), Postives = 123/238 (51.68%), Query Frame = 3
Query:  102 QDVTKTSFWTALFAEFLGTFILVFIGLGACYENGDVLKVXXXXXXXXXXXXYIS-----APLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLM-----TYETY-NKTHGISHAHAPWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSELSREHI 782
            ++V    FW ++ AE L + + V   LG+     +   +   +    A    +        +SG  +NPAV++ LL  R++  +R ++Y++ Q +GA+L A    L+     T E Y NK     +A     +AL  E++ +F L FTV  +  ++ R   E G  A  IG S++ G+     ISGG +NPARSLGPAI+    +  W++ +GP++G +LAG+  + FF    SR+ +
Sbjct:    5 EEVRSRQFWRSMLAEILASLVFVSAVLGSSLPGSEGPSLGPIYPALAAGMATVGLGHCFGEISGAQVNPAVTLALLATRRLDVLRAVVYVVAQCLGAILGAGIFYLVLPLKFTAEIYVNKVPMEVNA----GQALGAEMLATFQLAFTVFSVEDQRRREGSEPGNIA--IGFSVSAGIFIAGKISGGCLNPARSLGPAIIAGYWEHHWVFWIGPVLGAVLAGVSHEFFFAPSASRQKL 236          
BLAST of Aquaporin vs. Ensembl Cavefish
Match: ENSAMXT00000002023.2 (aquaporin-4-like [Source:NCBI gene;Acc:103025508])

HSP 1 Score: 115.931 bits (289), Expect = 1.667e-29
Identity = 74/239 (30.96%), Postives = 123/239 (51.46%), Query Frame = 3
Query:   99 LQDVTKTSFWTALFAEFLGTFILVFIGLGACYENGDVLKVXXXXXXXXXXXXYIS-----APLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLM-----TYETY-NKTHGISHAHAPWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSELSREHI 782
            + +V    FW ++ AE L + + V   LG+     +   +   +    A    +        +SG  +NPAV++ LL  R++  +R ++Y++ Q +GA+L A    L+     T E Y NK     +A     +AL  E++ +F L FTV  +  ++ R   E G  A  IG S++ G+     ISGG +NPARSLGPAI+    +  W++ +GP++G +LAG+  + FF    SR+ +
Sbjct:    1 MAEVRSRQFWRSMLAEILASLVFVSAVLGSSLPGSEGPSLGPIYPALAAGMATVGLGHCFGEISGAQVNPAVTLALLATRRLDVLRAVVYVVAQCLGAILGAGIFYLVLPLKFTAEIYVNKVPMEVNA----GQALGAEMLATFQLAFTVFSVEDQRRREGSEPGNIA--IGFSVSAGIFIAGKISGGCLNPARSLGPAIIAGYWEHHWVFWIGPVLGAVLAGVSHEFFFAPSASRQKL 233          
BLAST of Aquaporin vs. Ensembl Sea Lamprey
Match: aqp3b (aquaporin 3b [Source:ZFIN;Acc:ZDB-GENE-040724-66])

HSP 1 Score: 83.9593 bits (206), Expect = 1.710e-18
Identity = 69/236 (29.24%), Postives = 118/236 (50.00%), Query Frame = 3
Query:  141 AEFLGTFILVFIGLGACYE-------NGDVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETY----NKTHGISHA---------HAPWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISIT-VGVLCGANISGGSMNPARSLGP-----------AIVHSNMKLIWIYIVGPLIGGILAGLVQQLF 752
            AEF+GT+ILV  G G+  +        G  L + LAFG    +G++ +A +SGGH+NPAV+    V  +  + +  LY+L Q++GA + A ++  + Y+ +    N  + I  A         H         ++I +  L+  +M + ++K  +   KG+   +IG+ +  +G+  G N +G ++NPAR LGP           A+  S     W+ +V P+IGG+L     +LF
Sbjct:   27 AEFVGTYILVLFGCGSVAQVELSGGLKGQFLTINLAFGFAVTMGLHAAAGVSGGHLNPAVTFAFAVLGRFEWHKLPLYMLAQLLGAFMGAGTVFGLYYDAFLFAANGNYTIQLAGVFATYPSEHLSLGNGFVDQLIGTAALLVCIMAV-IDKRNNPAPKGMQPYIIGLVVVLIGLSMGFN-AGYAVNPARDLGPRLFTSIAGWGWAVFSSGNYWSWVPVVAPMIGGVLGAFFYELF 260          
BLAST of Aquaporin vs. Ensembl Sea Lamprey
Match: AQP4 (aquaporin 4 [Source:HGNC Symbol;Acc:HGNC:637])

HSP 1 Score: 72.7886 bits (177), Expect = 1.571e-15
Identity = 37/98 (37.76%), Postives = 58/98 (59.18%), Query Frame = 3
Query:  471 LYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSE 764
            L  E++I+F L FTV   C + +R E  +   ++ +G+++  G L     +G SMNPARSLGPAIV +N    W+Y +GP++G +LAG   +     +
Sbjct:   11 LLIEMMITFFLSFTVFSTC-DPNRPE-PRIPGSVAVGVAVIAGHLFAIPYTGASMNPARSLGPAIVSANWDHHWLYWIGPMLGAVLAGAAYEYLLCPD 106          
BLAST of Aquaporin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004954.1 (pep scaffold:Pmarinus_7.0:GL478425:226692:228041:-1 gene:ENSPMAG00000004494.1 transcript:ENSPMAT00000004954.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.6994 bits (156), Expect = 3.273e-13
Identity = 41/106 (38.68%), Postives = 62/106 (58.49%), Query Frame = 3
Query:  465 KALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSELSREHI 782
            +AL  E++ SF LV + +     + R   E G   L +G+++  G+L     SGGS+NPARS GPA+V    K  W+Y +GPL+GG+LA     L F+S  +R+ +
Sbjct:    9 QALAAELLCSFQLVLSALAGEEHRVRRSGEAG--PLPVGLALGAGILASEKFSGGSLNPARSFGPALVCGLWKHHWVYWMGPLLGGLLAAAAHDLVFSSAANRDRL 112          
BLAST of Aquaporin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004947.1 (pep scaffold:Pmarinus_7.0:GL478425:219996:222130:-1 gene:ENSPMAG00000004489.1 transcript:ENSPMAT00000004947.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.8474 bits (146), Expect = 4.007e-12
Identity = 41/83 (49.40%), Postives = 54/83 (65.06%), Query Frame = 3
Query:  123 FWTALFAEFLGTFILVFIGLGACYENG------DVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILY 353
            FW A+FAEFL T  LV +G+G+    G      DV++V+LAFGL  A  +     +SGGH+NPAV+ GLLV R+I  VR +LY
Sbjct:   14 FWRAVFAEFLATAALVALGIGSTLRWGRADGSVDVVRVSLAFGLAVATLVQCVGHVSGGHLNPAVTFGLLVGRKILIVRGLLY 96          
BLAST of Aquaporin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008324.1 (pep scaffold:Pmarinus_7.0:GL479140:275:9118:1 gene:ENSPMAG00000007511.1 transcript:ENSPMAT00000008324.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.6102 bits (135), Expect = 2.192e-9
Identity = 69/239 (28.87%), Postives = 116/239 (48.54%), Query Frame = 3
Query:  141 AEFLGTFILVFIGLGAC-------YENGDVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSI------SLMTYETYNKTHGISHAHA------PWDK----ALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGP----AIVHSNMKLI-------WIYIVGPLIGGILAGLVQQLFF 755
            AEFLGTF+L+  G G+        +  G+ L + LAF  G  +G Y+S  +SG H+NPAVS  + +  +  + +  ++ L Q +GA  AA ++      +LM +   N T     A A      P +       + + ++   L+   +   ++   + V +GL  LL+G+ + V  L     +G ++NPAR LGP    A+V    ++        W+ +V PL+GG L G +  +FF
Sbjct:   27 AEFLGTFVLIVFGCGSVAQVELSHHSAGETLTINLAFAFGVVMGAYLSWGISGAHLNPAVSFSMSLIGRFHWWKLPIFCLAQFLGAFTAAATVYGLYHEALMAFNGGNLTVTGPGATAAIFATYPSEHLSIAGGFLDQVLGTALLLLCVMALLDPKNNAVPRGLEPLLVGLVVLVIGLSMGFNAGYAINPARDLGPRVFTAMVGYGSEVFTMGPHWWWVPVVAPLVGGPL-GTMCYIFF 264          
BLAST of Aquaporin vs. Ensembl Yeast
Match: AQY1 (Spore-specific water channel; mediates the transport of water across cell membranes, developmentally controlled; may play a role in spore maturation, probably by allowing water outflow, may be involved in freeze tolerance [Source:SGD;Acc:S000006396])

HSP 1 Score: 74.7146 bits (182), Expect = 1.705e-15
Identity = 75/247 (30.36%), Postives = 110/247 (44.53%), Query Frame = 3
Query:  102 QDVTKTSFWTALFAEFLGTFILVFIGLGAC-YENGDVLKVXXXXXXXXXXXXYIS--------------APLSGGHINPAVSVGLLVARQISFVRCILYILFQII--------------GALLAAKSISLMTYETYNKTHGISHAHAPWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLI-WIYIVGPLIGGILAGLVQQLF 752
            +D  +  F  A+  EF GTF+ ++     C   N DV  VA   G      I I+              A +SGG +NPA+S+ L +AR +S  RC++  + QI+              G +L A S+ L    T               + L+ E+  + +L  TV+   VEK  +     +AAL IGIS+ +  +     +G  +NPARSLG A+         WIY +G L+G ILA  V QL 
Sbjct:   42 RDTLRDHFIAAV-GEFCGTFMFLWCAYVICNVANHDVALVAAPDGSHPGQLIMIAIGFGFSVMFSIWCFAGVSGGALNPAMSLSLCLARAVSPTRCVVMWVSQIVAGMAAGGAASAMTPGEVLFANSLGLGCSRT---------------RGLFLEMFGTAILCLTVLMTAVEKRETNF---MAALPIGISLFIAHVALTAYTGTGVNPARSLGAAVAARYFPHYHWIYWIGTLLGSILAWSVWQLL 269          
BLAST of Aquaporin vs. Ensembl Yeast
Match: AQY3 (Putative channel-like protein; similar to Fps1p; mediates passive diffusion of glycerol in the presence of ethanol [Source:SGD;Acc:S000001840])

HSP 1 Score: 75.0998 bits (183), Expect = 3.713e-15
Identity = 64/219 (29.22%), Postives = 107/219 (48.86%), Query Frame = 3
Query:  108 VTKTSFWTAL-------FAEFLGTFILVFIGLGACYE-------NGDVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGISH---------------AHAPWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISI-TVGVLCGANISGGSMNPARSLGPAIVHS 674
            +T  +FW  +       FAEFLGT +LV  G+G   +        G    ++ A+G G  +G+Y++  +SGGHINPAV++ + + R+  + +  +YI+ QIIGA           + +  +  G  H               ++  W  A + E I + +LV  +M + ++ S +    G+ AL+IG  +  +G+  G   S  ++NPAR LGP I  S
Sbjct:  334 MTFPNFWAKIRYHMREPFAEFLGTLVLVIFGVGGNLQATVTKGSGGSYESLSFAWGFGCMLGVYVAGGISGGHINPAVTISMAIFRKFPWKKVPVYIVAQIIGAYFGGAMAYGYFWSSITEFEGGPHIRTTATGACLFTDPKSYVTWRNAFFDEFIGASILVGCLMAL-LDDSNAPPGNGMTALIIGFLVAAIGMALGYQTS-FTINPARDLGPRIFAS 550          
BLAST of Aquaporin vs. Ensembl Yeast
Match: YLL053C_mRNA (Putative protein; in the Sigma 1278B strain background YLL053C is contiguous with AQY2 which encodes an aquaporin [Source:SGD;Acc:S000003976])

HSP 1 Score: 55.8398 bits (133), Expect = 4.792e-10
Identity = 36/97 (37.11%), Postives = 51/97 (52.58%), Query Frame = 3
Query:  462 DKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLI-WIYIVGPLIGGILAGLVQQL 749
             + L+ E+  + VL  TV+   VEK  +     +AAL IGIS+ +  +     +G  +NPARSLG A+         WIY + PL+G  LA  V QL
Sbjct:   37 SRGLFLEMFGTAVLCLTVLMTAVEKRETNF---MAALPIGISLFMAHMALTGYTGTGVNPARSLGAAVAARYFPHYHWIYWISPLLGAFLAWSVWQL 130          
BLAST of Aquaporin vs. Ensembl Nematostella
Match: EDO28361 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6P4])

HSP 1 Score: 101.679 bits (252), Expect = 3.260e-25
Identity = 76/210 (36.19%), Postives = 118/210 (56.19%), Query Frame = 3
Query:  141 AEFLGTFILVFIGLGACY----ENGDV--LKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGISHAHAPWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLF 752
            AEF+GTF LVF G GA       NG +  + +AL FG+  +  IY+   +SG HINP+V++ L++ +       + YIL QI+GA+LA+  +  M  E  N + G +       ++   E +++F L+ T++ +  +K  + +      L+IGI +T  +L    ISGGS NPARSL PA++  N   +WIYI  P +G I+A L+   F
Sbjct:    6 AEFIGTFALVFCGTGAIIVNEQSNGSLGLIGIALTFGIIISAMIYVFGNISGTHINPSVTIALVIGKLTLKRDALFYILAQILGAILASSLLKFMFTE--NLSLGATIPSGELLQSFILEFVLTFFLMLTILGITSKKEFTNI----VGLIIGIVVTGIILFAGPISGGSFNPARSLAPALISGNFTALWIYIAAPTLGAIVAMLIWNSF 209          
BLAST of Aquaporin vs. Ensembl Nematostella
Match: EDO30549 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0G8])

HSP 1 Score: 98.9821 bits (245), Expect = 4.668e-24
Identity = 70/242 (28.93%), Postives = 115/242 (47.52%), Query Frame = 3
Query:  120 SFWTALFAEFLGTFILVF-----------------IGLGACYENGDVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGISH---AHAPWDKALYCEIIISFVLVFTVMRMCVEKSRSE-VEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSELSREHI 782
            S W  +FAE+LGT + +F                 I L A +    V +V            ++S PL   H NPAV+V   +A   S V   LY++ Q  GA+  A  + L+       T G +       P  +AL  EII++F+LV  ++       R +  ++   +  +G+++T+G L    ++G  +NPARS GPAI+ +N +  W+Y  GPL+G ++AGL+  +     L  + +
Sbjct:    5 SLWICVFAEYLGTLLFMFSVSAASLRWEGTPSTLEIALAAGFSMATVTQVFR----------WVSRPLV--HANPAVTVASFLAGDTSLVASFLYVIVQCFGAITGAGLLHLVCPAYARGTLGATSLAVGTTP-PQALGTEIIVTFLLVSAILSTLDACPRDDNYDRYDVSAAVGLAVTLGYLVALPLTGAGLNPARSFGPAILTNNWQDHWVYWCGPLVGAVIAGLMYNMLLHRGLKTKRV 233          
BLAST of Aquaporin vs. Ensembl Nematostella
Match: EDO41164 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S515])

HSP 1 Score: 88.5817 bits (218), Expect = 4.950e-20
Identity = 67/226 (29.65%), Postives = 110/226 (48.67%), Query Frame = 3
Query:  102 QDVTKTSFWTALFAEFLGTFILVFIGLGACYENGDVLKVXXXXXXXXXXXXYISA----PLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGIS-HAHAP---WDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFF 755
            +++    FWT + AEF+ T + V I  G   +N           L   +     A     +S G  NPA+++G L+  + + ++ I YI+ Q+ G++  A +I  M  +   +   ++ +A +P     +A+  EI  +F+LV  V     +  R  +      L IGI + + +     ISGGSMNPARS GPA+V ++ K  W+Y +GP+ G  LA L     F
Sbjct:    9 KELYSRRFWTEILAEFIITSLFVSIVCGTALQNWSTPPTLTHMALNSGLAAGTFAMCMWDVSSGLFNPALTIGFLITGKKTLLQTIFYIMAQLTGSICGAAAIYGMASQHSVEASNLAVNARSPDVSIGQAVGMEIWATFILVLIVFAA-GDSDRQHMRGYGPPLSIGIVVFINLSLTIPISGGSMNPARSFGPAVVMNSWKDHWMYWIGPIAGSCLASLCYHHVF 233          
BLAST of Aquaporin vs. Ensembl Nematostella
Match: EDO41124 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S514])

HSP 1 Score: 87.0409 bits (214), Expect = 1.069e-19
Identity = 72/242 (29.75%), Postives = 122/242 (50.41%), Query Frame = 3
Query:   99 LQDVTKTSFWTALFAEFLGTFILVFIGLGACYENGDVLK-----VXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHG--ISHAHAPWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSELSREHIYDFLVNP 803
            L++    +FW +++AE + T + VF+  G+      +L      ++L+FGL  A     +A +SGGHINPAV++  ++ R++SF+R   Y++ Q+ G +  +  +  +T      T G  + +A     +A   E +++F+LV T+      K      +    L IG+ +TV  L G   +G  +NPARS GPA++ +     W+Y  GP+ G ILA L+    F +        D  V P
Sbjct:    3 LREFLTGNFWASVWAELMATALFVFLTTGSAITWDPLLPPSIEHISLSFGLSIATLAMCTAHISGGHINPAVTISFMIVRKVSFLRGAFYVIGQVGGGIAGSAMLYGLTPVDKRGTLGATVPNAGVSTGQAFGIEFLLTFLLVLTIFATTDAKRNHYGYE--VPLAIGLCVTVCHLVGIRFTGCGINPARSFGPAVIMNIWTDHWVYWAGPVAGAILASLLYHFVFRARKELGPNADKAVGP 242          
BLAST of Aquaporin vs. Ensembl Nematostella
Match: EDO41149 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S565])

HSP 1 Score: 84.7297 bits (208), Expect = 3.463e-19
Identity = 67/207 (32.37%), Postives = 114/207 (55.07%), Query Frame = 3
Query:  144 EFLGTFILVFIGLGAC-----YENGDVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGISHAHAPW---DKALYCEIIISFVLVFTVMRMCVE-KSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGL 737
            E L + + VF+   +C     ++   V  +AL  GL  +  + + + ++GG INPAV+V ++V R++  V  ++++  Q++G LL A  +  +T  +   + G++   AP     +A+  E I++F+LVF ++    E K+    EK  A   +G  + +  + G   +G SMNPARSLGPA+V  + +  W+Y VGP  G ILA L
Sbjct:    1 ELLASHVFVFLVCASCVSWPHFQAPSVQHIALTAGLTTSTLVMVMSHVTGGQINPAVAVAMVVTRRVKPVHGLVFVFSQVLGGLLGAALLFGLTPSSIRGSLGMT-VPAPTIQVGQAVAMETILTFLLVFGILAATDERKALKGYEKAAA---VGFCVFICHMAGIPFTGCSMNPARSLGPAVVMDHWRHHWVYWVGPFAGSILASL 203          
BLAST of Aquaporin vs. Ensembl Medaka
Match: ENSORLT00000043818.1 (aquaporin-4 [Source:NCBI gene;Acc:101156496])

HSP 1 Score: 128.257 bits (321), Expect = 5.640e-34
Identity = 80/234 (34.19%), Postives = 122/234 (52.14%), Query Frame = 3
Query:  102 QDVTKTSFWTALFAEFLGTFILVFIGLGACYENGDVLKVXXXXXXXXXXXXYIS-----APLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGISHAHAPWD--KALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSELSREHI 782
            +D+    FW A+ AE LGT +LV   LGA     +   V   +         I+       +SG  +NP++++ LL  R++  +R ++YI  Q  GA LAA  + L         H ++      +  +AL  E++ +F +VFTV  +  ++ R   E G   L IG++ + GVL GA  SG SMNPARSLGPAIV    +  WIY +GP++G +LAG+  +  F    SR+ +
Sbjct:    5 EDLRSRKFWCAILAELLGTLVLVSAVLGASVPGPEEAAVGPMYPAVAVGVAIIALSHCFGEISGAQVNPSLTLSLLATRRLDVLRALVYIAAQCFGACLAAWFLYLALPFKTTAEHFVNRVPIELNAAQALGIEVLCTFQMVFTVYSVEDQRRRDSPEPG--NLAIGVAHSAGVLIGARFSGASMNPARSLGPAIVTGFWENHWIYWIGPVMGALLAGVSHEFLFARSASRQKL 236          
BLAST of Aquaporin vs. Ensembl Medaka
Match: AQP4 (aquaporin 4 [Source:NCBI gene;Acc:101164753])

HSP 1 Score: 127.487 bits (319), Expect = 2.502e-33
Identity = 83/244 (34.02%), Postives = 139/244 (56.97%), Query Frame = 3
Query:   57 KCNTLVKQLRIWSSLQDVTKTSFWTALFAEFLGTFILVFIGLGACYE---------NGDVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGIS--HAHAPWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGIL-AGLVQQLF 752
            KC T  ++  I  + + +    FW A+  E+L + I V +GLG+              D++ ++L FGL  A  +     +SGGHINPAV+  ++V R++S  + + Y+  Q +GA+  A  + L+T +T   + G++  + +     AL  E++I+F LVFT+   C  K R+++  G  +L IG+++ +G L G   +G SMNPARS GPA+V  N +  W+Y +GP++GG+L AG  + L+
Sbjct:   12 KCCT-CQEPNIMVAFKGIWTKEFWRAVSGEYLASVIFVLLGLGSTINWAAGEEKPPPADLVLISLCFGLSIATMVQCFGHISGGHINPAVTAAMVVTRKLSLAKALFYVAAQCLGAITGAGILYLVTPDTVRGSLGVTKVNTNVALGNALLVELLITFELVFTIFATCDSK-RTDL-SGSPSLAIGLAVAIGHLFGIPYTGASMNPARSFGPAVVTLNFENHWVYWLGPILGGLLAAGFYEYLY 252          
BLAST of Aquaporin vs. Ensembl Medaka
Match: AQP4 (aquaporin 4 [Source:NCBI gene;Acc:101164753])

HSP 1 Score: 125.176 bits (313), Expect = 1.683e-32
Identity = 83/242 (34.30%), Postives = 136/242 (56.20%), Query Frame = 3
Query:   63 NTLVKQLRIWSSLQDVTKTSFWTALFAEFLGTFILVFIGLGACYE---------NGDVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGIS--HAHAPWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGIL-AGLVQQLF 752
            N +V    IW+         FW A+  E+L + I V +GLG+              D++ ++L FGL  A  +     +SGGHINPAV+  ++V R++S  + + Y+  Q +GA+  A  + L+T +T   + G++  + +     AL  E++I+F LVFT+   C  K R+++  G  +L IG+++ +G L G   +G SMNPARS GPA+V  N +  W+Y +GP++GG+L AG  + L+
Sbjct:   32 NIMVAFKGIWTK-------EFWRAVSGEYLASVIFVLLGLGSTINWAAGEEKPPPADLVLISLCFGLSIATMVQCFGHISGGHINPAVTAAMVVTRKLSLAKALFYVAAQCLGAITGAGILYLVTPDTVRGSLGVTKVNTNVALGNALLVELLITFELVFTIFATCDSK-RTDLS-GSPSLAIGLAVAIGHLFGIPYTGASMNPARSFGPAVVTLNFENHWVYWLGPILGGLLAAGFYEYLY 264          
BLAST of Aquaporin vs. Ensembl Medaka
Match: mipa (lens fiber major intrinsic protein [Source:NCBI gene;Acc:101161368])

HSP 1 Score: 116.701 bits (291), Expect = 7.106e-30
Identity = 86/239 (35.98%), Postives = 112/239 (46.86%), Query Frame = 3
Query:   99 LQDVTKTSFWTALFAEFLGTFILVFIGLGAC--YENG--DVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGISHAHAPWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSELSREHIYDFLVNP 803
            + +    SFW A+FAEF GT   VF GLGA   +  G  +VL VA  FGL  A  I     +SGGHINPAV+   L+  Q+S  R   YI+ Q +GAL  A  +  +T         ++         +   I I   L   V    V   R     G AAL IG S+ +G L G   +G  MNPARS  PA++  N    W+Y VGP+IG  +  L              +YDFL+ P
Sbjct:    1 MWEFRSMSFWRAVFAEFYGTMFFVFFGLGAALRWTTGPHNVLHVAFCFGLAAATFIQSIGHISGGHINPAVTFAYLIGSQMSLFRAFFYIVAQCLGALAGAAVLYGVTPNNMRGNLALNTLQPGVSLGMATTIEIFLTLQLVVCVFAVTDERRNGRLGSAALAIGFSVLIGHLLGMYYTGAGMNPARSFAPAVLIRNFVNHWVYWVGPMIGAAIGAL--------------LYDFLLFP 225          
BLAST of Aquaporin vs. Ensembl Medaka
Match: aqp1a.1 (aquaporin 1 (Colton blood group) [Source:NCBI gene;Acc:101155722])

HSP 1 Score: 106.301 bits (264), Expect = 4.237e-26
Identity = 77/246 (31.30%), Postives = 132/246 (53.66%), Query Frame = 3
Query:   99 LQDVTKTSFWTALFAEFLGTFILVFIGLGACYENGDV------LKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSI-----SLMTYETYNKTHGISHAHAPWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSELSREHIYDFLVNP 803
            +++     FW A+ AE +G    +F+ + A   N +       +KV+L FGL  A        +SG H+NPAV++G+L + QIS  + ++YI+ Q++G+ LA+  +     S  +    N  +G++ +     + +  E++ +F LV  V+ +  +K R +V  G A L IG+S+ +G L   + +G  +NPARS GPA++ ++    W+Y VGP+ GG+ A LV              YDFL++P
Sbjct:    1 MREFKSKDFWRAVLAELVGMAFFIFLSISAAIGNSNNANPDQEVKVSLTFGLAIATLAQSLGHISGAHLNPAVTLGMLASCQISVFKAVMYIVAQMLGSALASGIVYGTRPSNTSALGLNSLNGVTPS-----QGVGIELLATFQLVLCVIAV-TDKRRRDV-MGSAPLAIGLSVCLGHLAAISYTGCGINPARSFGPALILNDFTDHWVYWVGPMCGGVAAALV--------------YDFLLSP 225          
BLAST of Aquaporin vs. Planmine SMEST
Match: SMESG000023346.1 (SMESG000023346.1)

HSP 1 Score: 561.222 bits (1445), Expect = 0.000e+0
Identity = 322/322 (100.00%), Postives = 322/322 (100.00%), Query Frame = 3
Query:   45 MPESKCNTLVKQLRIWSSLQDVTKTSFWTALFAEFLGTFILVFIGLGACYENGDVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGISHAHAPWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSELSREHIYDFLVNPXXXXXXXXXXXXXXXXXXXXXXXXXXXXYEEFKQLEENRKYEENLKIKGSTLKADRYDENVKLTEMAEI 1010
            MPESKCNTLVKQLRIWSSLQDVTKTSFWTALFAEFLGTFILVFIGLGACYENGDVLKVALAFGLGGAIGIYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGISHAHAPWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSELSREHIYDFLVNPKFQMEKEFEEYEERKKFEEFKKMENRKKYEEFKQLEENRKYEENLKIKGSTLKADRYDENVKLTEMAEI
Sbjct:    1 MPESKCNTLVKQLRIWSSLQDVTKTSFWTALFAEFLGTFILVFIGLGACYENGDVLKVALAFGLGGAIGIYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGISHAHAPWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSELSREHIYDFLVNPKFQMEKEFEEYEERKKFEEFKKMENRKKYEEFKQLEENRKYEENLKIKGSTLKADRYDENVKLTEMAEI 322          
BLAST of Aquaporin vs. Planmine SMEST
Match: SMESG000023353.1 (SMESG000023353.1)

HSP 1 Score: 223.016 bits (567), Expect = 3.031e-70
Identity = 131/262 (50.00%), Postives = 169/262 (64.50%), Query Frame = 3
Query:   72 VKQLRIWSSLQDVTKTSFWTALFAEFLGTFILVFIGLGACYENGDVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTY-ETYNKTHGI---SHAHAPWDKALY-----------------CEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSELSREHIYDFL 794
            + Q+R+ SS +D+   + W ++ AE LGTF+L FIG G+ + N + +KV L FGL G + IY   P+SGGHINPAVS GLL+ARQIS +R ILYI  QI+GA      IS++T  +  N +H     S+    ++ A Y                 CE++I+FVLVFTVMR+CVEKSR+  EKGLA L+IGISITVGV CG NISGGSMNPA SL   +     K +  +IVGPL+GG LA ++QQL FTS LS  H+  FL
Sbjct:    1 MNQIRLASSFKDLKSLNLWQSIIAELLGTFLLAFIGFGSVFSNMNPVKVGLGFGLAGVVIIYCIGPISGGHINPAVSFGLLIARQISLIRFILYIFVQILGATFGYLFISILTKGKVLNPSHFSILSSNNLTKFNSADYKITENIDKIKDLHLKILCELVITFVLVFTVMRLCVEKSRNPTEKGLAPLIIGISITVGVYCGMNISGGSMNPAVSLAKFMCTKQSKGLISHIVGPLLGGFLAAILQQLVFTSNLSILHVKSFL 262          
BLAST of Aquaporin vs. Planmine SMEST
Match: SMESG000023352.1 (SMESG000023352.1)

HSP 1 Score: 218.009 bits (554), Expect = 1.814e-68
Identity = 123/258 (47.67%), Postives = 170/258 (65.89%), Query Frame = 3
Query:   72 VKQLRIWSSLQDVTKTSFWTALFAEFLGTFILVFIGLGACYENGDVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGAL--------LAAKSISLMTYETYNKTHG-------ISHAHAPWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSELSREHIYDFLVN 800
            ++ LR+ SS +D+    FW ++ AEFLGTF+LVFIG G  Y N + +K+ L FG  G + IY   P+SGGHINPAVS GLL+AR+IS  + I++ + QI+GA         ++ K +   ++  +N ++        I     P  K L CE++I+FVLVFTVMR+CVEK+R+  EKGLA L+IG++I VGV CG NISGGSMNPA SLG    ++    IW +I+GPL GG +AGL+ QL FTS++SR HI  +L +
Sbjct:    1 METLRLGSSARDLKSCQFWLSVVAEFLGTFLLVFIGFGTAYNNMNPVKLGLGFGFAGIVVIYCIGPISGGHINPAVSFGLLIAREISLAKFIIFSIIQILGASAGFGMIYGVSGKGVLHKSFLRFNISNTSIRIDEVIHRVENPAFKIL-CEMVITFVLVFTVMRLCVEKTRTSTEKGLAPLVIGLAIAVGVFCGMNISGGSMNPAASLGKYF-YAGSTTIWTHIIGPLSGGAIAGLLYQLMFTSQISRSHIRSYLFD 256          
BLAST of Aquaporin vs. Planmine SMEST
Match: SMESG000028474.1 (SMESG000028474.1)

HSP 1 Score: 114.005 bits (284), Expect = 3.897e-29
Identity = 71/235 (30.21%), Postives = 123/235 (52.34%), Query Frame = 3
Query:   99 LQDVTKTSFWTALFAEFLGTFILVFIGLGACYENGDVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYETYNKTHGISHAHAPWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLA-ALLIGISITVGVLCGANISGGSMNPARSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSELSREHIYDFLVN 800
            L ++     +  +F EFLGTF L+FIG  +   +         FGL     I + +   G H+NPA+S+   ++ +I F+R I Y++ Q  G++     I+++T  +++ T  ++  +    +A+  E I++F+LV  +  +      SE+  GL   + +G+++ V  +    ISG SMNPARS GPAI +S    IWIY VGP++G +   L     F   +S + + ++  N
Sbjct:    8 LNEIKNPVLYVDIFVEFLGTFFLLFIGSSSLMNSNASFNAGSTFGLILVGLITVFSERGGCHLNPAISIAHFISHRIQFIRFIFYVIAQHCGSISGTILINVLTNHSFDNT--VNEPNIANSRAVVIEGILTFILVLIIFTVK-NNFNSEIYNGLLLGVAVGVTVFVFHIGFMGISGASMNPARSFGPAIYYSKTNHIWIYYVGPILGSVAGTLFYDTIFERNISIKKLKEYFTN 239          
BLAST of Aquaporin vs. Planmine SMEST
Match: SMESG000067985.1 (SMESG000067985.1)

HSP 1 Score: 75.0998 bits (183), Expect = 6.606e-15
Identity = 64/241 (26.56%), Postives = 110/241 (45.64%), Query Frame = 3
Query:  132 ALFAEFLGTFILVFIGLGACYE-------NGDVLKVXXXXXXXXXXXXYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYE-----TYNKTHG-----------ISHAHAPWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIV----------HSNMKL-IWIYIVGPLIGGILAGLVQQLF 752
            A+  E  GTFIL+  GLG   +        G  L ++L +G    + ++ S  L  GH NPAV++      ++ ++R   Y L Q++GA L +  + L+ YE       NK  G           I+        A + +   +F+L    + +  E    ++   L  +++G+ ++  V C A  +G ++NPAR LGP I+           +N+    W+ IV PL+GG+   L  ++F
Sbjct:   21 AMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIVQSTGAFFITSRSTSLLTAFFDQFFGTFLLASCAIAITDEDGF-DLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVF 260          
The following BLAST results are available for this feature:
BLAST of Aquaporin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AQP41.483e-3737.25aquaporin 4 [Source:HGNC Symbol;Acc:HGNC:637][more]
AQP41.483e-3737.25aquaporin 4 [Source:HGNC Symbol;Acc:HGNC:637][more]
AQP41.887e-3737.25aquaporin 4 [Source:HGNC Symbol;Acc:HGNC:637][more]
AQP41.716e-3537.18aquaporin 4 [Source:HGNC Symbol;Acc:HGNC:637][more]
AQP41.716e-3537.18aquaporin 4 [Source:HGNC Symbol;Acc:HGNC:637][more]
back to top
BLAST of Aquaporin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aqp-65.017e-2527.94AQuaPorin or aquaglyceroporin related [Source:Uni... [more]
aqp-61.999e-2429.34AQuaPorin or aquaglyceroporin related [Source:Uni... [more]
aqp-62.732e-2429.34AQuaPorin or aquaglyceroporin related [Source:Uni... [more]
aqp-47.162e-1929.87AQuaPorin or aquaglyceroporin related [Source:Uni... [more]
aqp-27.205e-1529.91AQuaPorin or aquaglyceroporin related [Source:Uni... [more]
back to top
BLAST of Aquaporin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Drip1.535e-3736.00gene:FBgn0015872 transcript:FBtr0331387[more]
Drip2.618e-3736.93gene:FBgn0015872 transcript:FBtr0088141[more]
Drip2.618e-3736.93gene:FBgn0015872 transcript:FBtr0088142[more]
Drip3.313e-3736.93gene:FBgn0015872 transcript:FBtr0331388[more]
Drip3.330e-3736.93gene:FBgn0015872 transcript:FBtr0331389[more]
back to top
BLAST of Aquaporin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aqp44.481e-3333.70aquaporin 4 [Source:ZFIN;Acc:ZDB-GENE-040724-152][more]
aqp45.507e-3335.66aquaporin 4 [Source:ZFIN;Acc:ZDB-GENE-040724-152][more]
mipa1.009e-3035.98major intrinsic protein of lens fiber a [Source:ZF... [more]
mipa1.009e-3035.98major intrinsic protein of lens fiber a [Source:ZF... [more]
aqp1a.22.298e-3035.97aquaporin 1a (Colton blood group), tandem duplicat... [more]
back to top
BLAST of Aquaporin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppil22.066e-3333.83peptidylprolyl isomerase like 2 [Source:Xenbase;Ac... [more]
aqp21.528e-3036.32aquaporin 2 [Source:NCBI gene;Acc:548466][more]
aqp53.194e-3038.70aquaporin 5 [Source:NCBI gene;Acc:100491662][more]
clip33.202e-2934.60CAP-Gly domain containing linker protein 3 [Source... [more]
c1orf1164.375e-2934.62chromosome 1 open reading frame 116 [Source:Xenbas... [more]
back to top
BLAST of Aquaporin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Aqp46.125e-3836.84aquaporin 4 [Source:MGI Symbol;Acc:MGI:107387][more]
Aqp45.190e-3737.18aquaporin 4 [Source:MGI Symbol;Acc:MGI:107387][more]
Aqp45.190e-3737.18aquaporin 4 [Source:MGI Symbol;Acc:MGI:107387][more]
Aqp45.190e-3737.18aquaporin 4 [Source:MGI Symbol;Acc:MGI:107387][more]
Aqp45.190e-3737.18aquaporin 4 [Source:MGI Symbol;Acc:MGI:107387][more]
back to top
BLAST of Aquaporin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|G5CTG2|AQP5_MILTA7.408e-4141.08Aquaporin-5 OS=Milnesium tardigradum OX=46460 GN=A... [more]
sp|Q9NHW7|AQP_AEDAE8.234e-4040.73Aquaporin AQPAe.a OS=Aedes aegypti OX=7159 GN=AAEL... [more]
sp|Q923J4|AQP4_DIPME1.747e-3837.20Aquaporin-4 OS=Dipodomys merriami OX=94247 GN=AQP4... [more]
sp|Q7PWV1|AQP_ANOGA6.141e-3840.40Aquaporin AQPAn.G OS=Anopheles gambiae OX=7165 GN=... [more]
sp|O77750|AQP4_BOVIN2.008e-3737.65Aquaporin-4 OS=Bos taurus OX=9913 GN=AQP4 PE=2 SV=... [more]
back to top
BLAST of Aquaporin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0G4DC262.224e-14673.60Aquaporin OS=Dugesia japonica OX=6161 PE=2 SV=1[more]
A0A0G4DCR11.441e-6951.72Aquaporin OS=Dugesia japonica OX=6161 GN=aquaporin... [more]
A0A4S2L3H41.710e-3839.68Uncharacterized protein OS=Temnothorax longispinos... [more]
A0A023EL672.236e-3841.37Putative aquaporin major intrinsic protein family ... [more]
A0A1S2ZJ339.135e-3839.27aquaporin-4 isoform X1 OS=Erinaceus europaeus OX=9... [more]
back to top
BLAST of Aquaporin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AQP41.219e-3434.92aquaporin-4 [Source:NCBI gene;Acc:103027636][more]
AQP41.351e-3434.92aquaporin-4 [Source:NCBI gene;Acc:103027636][more]
aqp41.715e-3135.54aquaporin-4-like [Source:NCBI gene;Acc:103030167][more]
ENSAMXT00000043631.11.219e-2931.09aquaporin-4-like [Source:NCBI gene;Acc:103025508][more]
ENSAMXT00000002023.21.667e-2930.96aquaporin-4-like [Source:NCBI gene;Acc:103025508][more]
back to top
BLAST of Aquaporin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aqp3b1.710e-1829.24aquaporin 3b [Source:ZFIN;Acc:ZDB-GENE-040724-66][more]
AQP41.571e-1537.76aquaporin 4 [Source:HGNC Symbol;Acc:HGNC:637][more]
ENSPMAT00000004954.13.273e-1338.68pep scaffold:Pmarinus_7.0:GL478425:226692:228041:-... [more]
ENSPMAT00000004947.14.007e-1249.40pep scaffold:Pmarinus_7.0:GL478425:219996:222130:-... [more]
ENSPMAT00000008324.12.192e-928.87pep scaffold:Pmarinus_7.0:GL479140:275:9118:1 gene... [more]
back to top
BLAST of Aquaporin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
AQY11.705e-1530.36Spore-specific water channel; mediates the transpo... [more]
AQY33.713e-1529.22Putative channel-like protein; similar to Fps1p; m... [more]
YLL053C_mRNA4.792e-1037.11Putative protein; in the Sigma 1278B strain backgr... [more]
back to top
BLAST of Aquaporin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO283613.260e-2536.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO305494.668e-2428.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411644.950e-2029.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411241.069e-1929.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411493.463e-1932.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Aquaporin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000043818.15.640e-3434.19aquaporin-4 [Source:NCBI gene;Acc:101156496][more]
AQP42.502e-3334.02aquaporin 4 [Source:NCBI gene;Acc:101164753][more]
AQP41.683e-3234.30aquaporin 4 [Source:NCBI gene;Acc:101164753][more]
mipa7.106e-3035.98lens fiber major intrinsic protein [Source:NCBI ge... [more]
aqp1a.14.237e-2631.30aquaporin 1 (Colton blood group) [Source:NCBI gene... [more]
back to top
BLAST of Aquaporin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023346.10.000e+0100.00SMESG000023346.1[more]
SMESG000023353.13.031e-7050.00SMESG000023353.1[more]
SMESG000023352.11.814e-6847.67SMESG000023352.1[more]
SMESG000028474.13.897e-2930.21SMESG000028474.1[more]
SMESG000067985.16.606e-1526.56SMESG000067985.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016557 ID=SMED30016557|Name=Aquaporin|organism=Schmidtea mediterranea sexual|type=transcript|length=1176bp
ATATAAATCTTATATGAAAACAACAAACACTTTCAGAAGTAAACATGCCC
GAAAGCAAATGTAATACATTGGTAAAACAACTACGTATTTGGAGTAGTTT
ACAGGACGTAACAAAAACAAGCTTTTGGACAGCACTATTTGCAGAGTTTT
TAGGCACATTCATTCTTGTGTTTATCGGATTGGGGGCTTGTTATGAAAAT
GGAGACGTTTTAAAGGTTGCGTTAGCTTTTGGTTTGGGTGGCGCAATTGG
AATTTATATCAGCGCCCCCCTTAGTGGAGGACACATCAATCCAGCCGTCA
GTGTTGGACTATTAGTAGCTCGCCAAATCAGTTTTGTCAGATGCATACTC
TACATATTGTTTCAGATTATCGGAGCATTGCTGGCAGCCAAAAGCATTTC
ACTCATGACATATGAAACCTACAATAAAACTCATGGGATTTCACATGCCC
ATGCTCCTTGGGATAAAGCTTTGTACTGTGAAATTATTATTAGTTTTGTT
CTCGTTTTTACAGTCATGAGAATGTGCGTAGAAAAATCTCGATCAGAAGT
CGAAAAAGGTCTAGCAGCACTTTTAATTGGTATCAGCATTACCGTTGGTG
TTTTGTGTGGGGCAAACATTAGTGGAGGCAGCATGAATCCCGCTAGAAGT
TTGGGCCCTGCTATCGTCCACAGCAATATGAAACTAATATGGATTTATAT
TGTCGGTCCTTTAATCGGAGGAATTCTTGCCGGATTAGTTCAACAATTAT
TTTTCACTTCAGAACTATCAAGAGAACACATTTACGATTTTTTGGTCAAT
CCAAAATTTCAAATGGAAAAGGAGTTCGAGGAATATGAGGAAAGAAAAAA
GTTTGAAGAATTTAAAAAAATGGAAAATAGGAAAAAATATGAAGAATTTA
AACAGTTGGAAGAAAATAGAAAATACGAAGAAAATTTGAAAATTAAAGGT
AGTACTTTAAAGGCTGATCGGTATGACGAAAATGTTAAACTTACAGAAAT
GGCGGAAATCTGCTAATTTATGTTGTTATTTTGCAAATGATTTTTTTTGG
AAAATTATTGTGTTGTTTTTCACACAAATCTCACTCTAGATAAGAAAATG
TTTTCGATTTAATTATGCCGTAAAAATGTTGAAAAATGCACATTATTTAA
TTTTGATTATTTATTTATGTTTGTCG
back to top

protein sequence of SMED30016557-orf-1

>SMED30016557-orf-1 ID=SMED30016557-orf-1|Name=SMED30016557-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=324bp
MPESKCNTLVKQLRIWSSLQDVTKTSFWTALFAEFLGTFILVFIGLGACY
ENGDVLKVALAFGLGGAIGIYISAPLSGGHINPAVSVGLLVARQISFVRC
ILYILFQIIGALLAAKSISLMTYETYNKTHGISHAHAPWDKALYCEIIIS
FVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPA
RSLGPAIVHSNMKLIWIYIVGPLIGGILAGLVQQLFFTSELSREHIYDFL
VNPKFQMEKEFEEYEERKKFEEFKKMENRKKYEEFKQLEENRKYEENLKI
KGSTLKADRYDENVKLTEMAEIC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0015267channel activity
GO:0005215transporter activity
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
GO:0006810transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0000464GABAergic neuron
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR000425MIP
IPR023271Aquaporin-like
IPR022357MIP_CS
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane