SMED30016551

Overview
NameSMED30016551
Smed IDSMED30016551
Length (bp)1549
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30016551 (SMED30016551) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30016551 (SMED30016551) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30016551 (SMED30016551) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30016551 (SMED30016551) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of SMED30016551 vs. Planmine SMEST
Match: SMESG000020889.1 (SMESG000020889.1)

HSP 1 Score: 449.129 bits (1154), Expect = 2.132e-152
Identity = 228/263 (86.69%), Postives = 235/263 (89.35%), Query Frame = 2
Query:    2 FCSFEIIFIFIGLTKASNLAPRRHLQFVACFYNNEVYYVNHLQFSPYLPRLCKYVETHHRVQPGSTICYYNHFAKSNISQDIKRIQTYEYMSDAHCIKYPSVTPNPFIANTISKLLAIILKTRRNRIANSESKENRKQRKITTSSYQSNNNFWRFYETTPIPWSIQPFSRYPYDQENEYPNRYWNRRRSNAFRKDWHYNNQWSNNYSQRQYQTTPIPWNIQSFTXXXXXXXXXXXXXQTDSPITNWNRDRSYGRLNNYWRPNN 790
            FCSFEIIFIFIGLTKASNLAPRRHLQFVACFYNNEVYYVNHLQFSPYLPRLCKYVETHHRVQPGSTICYYNHFAKSNISQDIKRIQTYEYMSDAHCIKYPSVTPNPFIANTISKLLAIILKTR NRI NSESKENRKQRKITTSSYQSNNNFWRFYETTPIPWSIQPFSRYPYDQENEYPNRYWNRRRSNAFR DW +NNQWSNNYSQRQYQTTPIPW+IQ F+          Y+++ + P   WNR RS     N WR NN
Sbjct:    3 FCSFEIIFIFIGLTKASNLAPRRHLQFVACFYNNEVYYVNHLQFSPYLPRLCKYVETHHRVQPGSTICYYNHFAKSNISQDIKRIQTYEYMSDAHCIKYPSVTPNPFIANTISKLLAIILKTRGNRIVNSESKENRKQRKITTSSYQSNNNFWRFYETTPIPWSIQPFSRYPYDQENEYPNRYWNRRRSNAFRNDWRFNNQWSNNYSQRQYQTTPIPWSIQPFS-------RYPYDQENEYPNRYWNRRRS-NAFRNDWRFNN 257          

HSP 2 Score: 277.33 bits (708), Expect = 8.690e-86
Identity = 155/180 (86.11%), Postives = 162/180 (90.00%), Query Frame = 2
Query:  443 SNNNFWRFYETTPIPWSIQPFSR-------YPYDQENEYPNRYWNRRRSNAFRKDWHYNNQWSNNYSQRQYQTTPIPWNIQSFTXXXXXXXXXXXXXQTDSPITNWNRDRSYGRLNNYWRPNNYIRGPNTRYQKLLAIKSPNHYHKYTAENTNRITTDGSLNTLLRKVYGFHLKDYIKLR 961
            SNN   R Y+TTPIPW IQPF++       + Y+Q  +YPNRYWNRRRSN FR DW YNNQWSNNYSQRQYQTTPIPWNIQSFTRYYYINRNRNYNRQTDSPITNWNRDRSYGRLNNYWRPNNYIRGPNTRYQKLLAIKSPNHYHKYTAENT+RITTDGSLNTLLRKVYGFHLKDYIKLR
Sbjct:  384 SNNYSQRQYQTTPIPWKIQPFTKDYYNTRYHNYNQRTDYPNRYWNRRRSNTFRNDWRYNNQWSNNYSQRQYQTTPIPWNIQSFTRYYYINRNRNYNRQTDSPITNWNRDRSYGRLNNYWRPNNYIRGPNTRYQKLLAIKSPNHYHKYTAENTHRITTDGSLNTLLRKVYGFHLKDYIKLR 563          

HSP 3 Score: 122.094 bits (305), Expect = 3.268e-29
Identity = 80/123 (65.04%), Postives = 87/123 (70.73%), Query Frame = 2
Query:  443 SNNNFWRFYETTPIPWSIQPFS------RYP-YDQENEYPNRYWNRRRSNAFRKDWHYNNQWSNNYSQRQYQTTPIPWNIQSFTXXXXXXXXXXXXXQTDSPITNWNRDRSYGRLNNYWRPNN 790
            SNN   R Y+TTPIPW IQPF+      RY  Y+Q  +YPNRYWNRRRSN FR DW YNNQWSNNYSQRQYQTTPIPW IQ FT+ YY  R RNYN++TD P   WNR RS     N WR NN
Sbjct:  260 SNNYSQRQYQTTPIPWKIQPFTKDYYNTRYRNYNQRTDYPNRYWNRRRSNTFRNDWRYNNQWSNNYSQRQYQTTPIPWKIQPFTKDYYNTRYRNYNQRTDYPNRYWNRRRS-NTFRNDWRYNN 381          

HSP 4 Score: 122.094 bits (305), Expect = 3.360e-29
Identity = 79/123 (64.23%), Postives = 86/123 (69.92%), Query Frame = 2
Query:  443 SNNNFWRFYETTPIPWSIQPFS------RYP-YDQENEYPNRYWNRRRSNAFRKDWHYNNQWSNNYSQRQYQTTPIPWNIQSFTXXXXXXXXXXXXXQTDSPITNWNRDRSYGRLNNYWRPNN 790
            SNN   R Y+TTPIPW IQPF+      RY  Y+Q  +YPNRYWNRRRSN FR DW YNNQWSNNYSQRQYQTTPIPW IQ FT+ YY  R  NYN++TD P   WNR RS     N WR NN
Sbjct:  322 SNNYSQRQYQTTPIPWKIQPFTKDYYNTRYRNYNQRTDYPNRYWNRRRSNTFRNDWRYNNQWSNNYSQRQYQTTPIPWKIQPFTKDYYNTRYHNYNQRTDYPNRYWNRRRS-NTFRNDWRYNN 443          
BLAST of SMED30016551 vs. Planmine SMEST
Match: SMESG000020889.1 (SMESG000020889.1)

HSP 1 Score: 449.129 bits (1154), Expect = 2.344e-152
Identity = 228/263 (86.69%), Postives = 235/263 (89.35%), Query Frame = 2
Query:    2 FCSFEIIFIFIGLTKASNLAPRRHLQFVACFYNNEVYYVNHLQFSPYLPRLCKYVETHHRVQPGSTICYYNHFAKSNISQDIKRIQTYEYMSDAHCIKYPSVTPNPFIANTISKLLAIILKTRRNRIANSESKENRKQRKITTSSYQSNNNFWRFYETTPIPWSIQPFSRYPYDQENEYPNRYWNRRRSNAFRKDWHYNNQWSNNYSQRQYQTTPIPWNIQSFTXXXXXXXXXXXXXQTDSPITNWNRDRSYGRLNNYWRPNN 790
            FCSFEIIFIFIGLTKASNLAPRRHLQFVACFYNNEVYYVNHLQFSPYLPRLCKYVETHHRVQPGSTICYYNHFAKSNISQDIKRIQTYEYMSDAHCIKYPSVTPNPFIANTISKLLAIILKTR NRI NSESKENRKQRKITTSSYQSNNNFWRFYETTPIPWSIQPFSRYPYDQENEYPNRYWNRRRSNAFR DW +NNQWSNNYSQRQYQTTPIPW+IQ F+          Y+++ + P   WNR RS     N WR NN
Sbjct:    3 FCSFEIIFIFIGLTKASNLAPRRHLQFVACFYNNEVYYVNHLQFSPYLPRLCKYVETHHRVQPGSTICYYNHFAKSNISQDIKRIQTYEYMSDAHCIKYPSVTPNPFIANTISKLLAIILKTRGNRIVNSESKENRKQRKITTSSYQSNNNFWRFYETTPIPWSIQPFSRYPYDQENEYPNRYWNRRRSNAFRNDWRFNNQWSNNYSQRQYQTTPIPWSIQPFS-------RYPYDQENEYPNRYWNRRRS-NAFRNDWRFNN 257          

HSP 2 Score: 277.33 bits (708), Expect = 9.606e-86
Identity = 155/180 (86.11%), Postives = 162/180 (90.00%), Query Frame = 2
Query:  443 SNNNFWRFYETTPIPWSIQPFSR-------YPYDQENEYPNRYWNRRRSNAFRKDWHYNNQWSNNYSQRQYQTTPIPWNIQSFTXXXXXXXXXXXXXQTDSPITNWNRDRSYGRLNNYWRPNNYIRGPNTRYQKLLAIKSPNHYHKYTAENTNRITTDGSLNTLLRKVYGFHLKDYIKLR 961
            SNN   R Y+TTPIPW IQPF++       + Y+Q  +YPNRYWNRRRSN FR DW YNNQWSNNYSQRQYQTTPIPWNIQSFTRYYYINRNRNYNRQTDSPITNWNRDRSYGRLNNYWRPNNYIRGPNTRYQKLLAIKSPNHYHKYTAENT+RITTDGSLNTLLRKVYGFHLKDYIKLR
Sbjct:  384 SNNYSQRQYQTTPIPWKIQPFTKDYYNTRYHNYNQRTDYPNRYWNRRRSNTFRNDWRYNNQWSNNYSQRQYQTTPIPWNIQSFTRYYYINRNRNYNRQTDSPITNWNRDRSYGRLNNYWRPNNYIRGPNTRYQKLLAIKSPNHYHKYTAENTHRITTDGSLNTLLRKVYGFHLKDYIKLR 563          

HSP 3 Score: 122.094 bits (305), Expect = 3.297e-29
Identity = 80/123 (65.04%), Postives = 87/123 (70.73%), Query Frame = 2
Query:  443 SNNNFWRFYETTPIPWSIQPFS------RYP-YDQENEYPNRYWNRRRSNAFRKDWHYNNQWSNNYSQRQYQTTPIPWNIQSFTXXXXXXXXXXXXXQTDSPITNWNRDRSYGRLNNYWRPNN 790
            SNN   R Y+TTPIPW IQPF+      RY  Y+Q  +YPNRYWNRRRSN FR DW YNNQWSNNYSQRQYQTTPIPW IQ FT+ YY  R RNYN++TD P   WNR RS     N WR NN
Sbjct:  260 SNNYSQRQYQTTPIPWKIQPFTKDYYNTRYRNYNQRTDYPNRYWNRRRSNTFRNDWRYNNQWSNNYSQRQYQTTPIPWKIQPFTKDYYNTRYRNYNQRTDYPNRYWNRRRS-NTFRNDWRYNN 381          

HSP 4 Score: 122.094 bits (305), Expect = 3.390e-29
Identity = 79/123 (64.23%), Postives = 86/123 (69.92%), Query Frame = 2
Query:  443 SNNNFWRFYETTPIPWSIQPFS------RYP-YDQENEYPNRYWNRRRSNAFRKDWHYNNQWSNNYSQRQYQTTPIPWNIQSFTXXXXXXXXXXXXXQTDSPITNWNRDRSYGRLNNYWRPNN 790
            SNN   R Y+TTPIPW IQPF+      RY  Y+Q  +YPNRYWNRRRSN FR DW YNNQWSNNYSQRQYQTTPIPW IQ FT+ YY  R  NYN++TD P   WNR RS     N WR NN
Sbjct:  322 SNNYSQRQYQTTPIPWKIQPFTKDYYNTRYRNYNQRTDYPNRYWNRRRSNTFRNDWRYNNQWSNNYSQRQYQTTPIPWKIQPFTKDYYNTRYHNYNQRTDYPNRYWNRRRS-NTFRNDWRYNN 443          
BLAST of SMED30016551 vs. Planmine SMEST
Match: SMESG000020889.1 (SMESG000020889.1)

HSP 1 Score: 276.559 bits (706), Expect = 1.518e-86
Identity = 155/180 (86.11%), Postives = 162/180 (90.00%), Query Frame = 2
Query:  443 SNNNFWRFYETTPIPWSIQPFSR-------YPYDQENEYPNRYWNRRRSNAFRKDWHYNNQWSNNYSQRQYQTTPIPWNIQSFTXXXXXXXXXXXXXQTDSPITNWNRDRSYGRLNNYWRPNNYIRGPNTRYQKLLAIKSPNHYHKYTAENTNRITTDGSLNTLLRKVYGFHLKDYIKLR 961
            SNN   R Y+TTPIPW IQPF++       + Y+Q  +YPNRYWNRRRSN FR DW YNNQWSNNYSQRQYQTTPIPWNIQSFTRYYYINRNRNYNRQTDSPITNWNRDRSYGRLNNYWRPNNYIRGPNTRYQKLLAIKSPNHYHKYTAENT+RITTDGSLNTLLRKVYGFHLKDYIKLR
Sbjct:  292 SNNYSQRQYQTTPIPWKIQPFTKDYYNTRYHNYNQRTDYPNRYWNRRRSNTFRNDWRYNNQWSNNYSQRQYQTTPIPWNIQSFTRYYYINRNRNYNRQTDSPITNWNRDRSYGRLNNYWRPNNYIRGPNTRYQKLLAIKSPNHYHKYTAENTHRITTDGSLNTLLRKVYGFHLKDYIKLR 471          

HSP 2 Score: 259.61 bits (662), Expect = 5.612e-80
Identity = 138/173 (79.77%), Postives = 145/173 (83.82%), Query Frame = 2
Query:  272 MSDAHCIKYPSVTPNPFIANTISKLLAIILKTRRNRIANSESKENRKQRKITTSSYQSNNNFWRFYETTPIPWSIQPFSRYPYDQENEYPNRYWNRRRSNAFRKDWHYNNQWSNNYSQRQYQTTPIPWNIQSFTXXXXXXXXXXXXXQTDSPITNWNRDRSYGRLNNYWRPNN 790
            MSDAHCIKYPSVTPNPFIANTISKLLAIILKTR NRI NSESKENRKQRKITTSSYQSNNNFWRFYETTPIPWSIQPFSRYPYDQENEYPNRYWNRRRSNAFR DW +NNQWSNNYSQRQYQTTPIPW+IQ F+          Y+++ + P   WNR RS     N WR NN
Sbjct:    1 MSDAHCIKYPSVTPNPFIANTISKLLAIILKTRGNRIVNSESKENRKQRKITTSSYQSNNNFWRFYETTPIPWSIQPFSRYPYDQENEYPNRYWNRRRSNAFRNDWRFNNQWSNNYSQRQYQTTPIPWSIQPFS-------RYPYDQENEYPNRYWNRRRS-NAFRNDWRFNN 165          

HSP 3 Score: 120.168 bits (300), Expect = 6.805e-29
Identity = 80/123 (65.04%), Postives = 87/123 (70.73%), Query Frame = 2
Query:  443 SNNNFWRFYETTPIPWSIQPFS------RYP-YDQENEYPNRYWNRRRSNAFRKDWHYNNQWSNNYSQRQYQTTPIPWNIQSFTXXXXXXXXXXXXXQTDSPITNWNRDRSYGRLNNYWRPNN 790
            SNN   R Y+TTPIPW IQPF+      RY  Y+Q  +YPNRYWNRRRSN FR DW YNNQWSNNYSQRQYQTTPIPW IQ FT+ YY  R RNYN++TD P   WNR RS     N WR NN
Sbjct:  168 SNNYSQRQYQTTPIPWKIQPFTKDYYNTRYRNYNQRTDYPNRYWNRRRSNTFRNDWRYNNQWSNNYSQRQYQTTPIPWKIQPFTKDYYNTRYRNYNQRTDYPNRYWNRRRS-NTFRNDWRYNN 289          

HSP 4 Score: 120.168 bits (300), Expect = 7.199e-29
Identity = 79/123 (64.23%), Postives = 86/123 (69.92%), Query Frame = 2
Query:  443 SNNNFWRFYETTPIPWSIQPFS------RYP-YDQENEYPNRYWNRRRSNAFRKDWHYNNQWSNNYSQRQYQTTPIPWNIQSFTXXXXXXXXXXXXXQTDSPITNWNRDRSYGRLNNYWRPNN 790
            SNN   R Y+TTPIPW IQPF+      RY  Y+Q  +YPNRYWNRRRSN FR DW YNNQWSNNYSQRQYQTTPIPW IQ FT+ YY  R  NYN++TD P   WNR RS     N WR NN
Sbjct:  230 SNNYSQRQYQTTPIPWKIQPFTKDYYNTRYRNYNQRTDYPNRYWNRRRSNTFRNDWRYNNQWSNNYSQRQYQTTPIPWKIQPFTKDYYNTRYHNYNQRTDYPNRYWNRRRS-NTFRNDWRYNN 351          
BLAST of SMED30016551 vs. Planmine SMEST
Match: SMESG000020887.1 (SMESG000020887.1)

HSP 1 Score: 121.324 bits (303), Expect = 3.491e-30
Identity = 86/105 (81.90%), Postives = 90/105 (85.71%), Query Frame = 3
Query:  471 KQRQYLGAFNHSVAIPTT-------KKMNIQIDIGTGDVQMPFAKTXXXXXXXXXXXHNDNTKQRQYRGTFNHSLGXXXXXXXXXXXGKLIPQLQIGIETAHMAV 764
            KQRQY G FNHS+ I TT        ++ IQ DIGTGDVQMPFAKTGIIIISGQIIIHNDNTKQRQYRGTFNHSLGIITSTEIETTIGKLIPQL+IG ETAHMAV
Sbjct:  243 KQRQYRGTFNHSLGIITTPDIVTTINELTIQRDIGTGDVQMPFAKTGIIIISGQIIIHNDNTKQRQYRGTFNHSLGIITSTEIETTIGKLIPQLRIGTETAHMAV 347          

HSP 2 Score: 117.857 bits (294), Expect = 5.577e-29
Identity = 76/91 (83.52%), Postives = 81/91 (89.01%), Query Frame = 3
Query:  468 MKQRQYLGAFNHSVAIPTTKKMNIQIDIGTGDVQMPFAKTXXXXXXXXXXXHNDNTKQRQYRGTFNHSLGXXXXXXXXXXXGKLIPQLQIG 740
            MKQRQYLGAFNHSVAIPTTKKMNIQIDIGTGDVQMPFA TG+IIISGQIIIHNDNTKQRQYRG FNHSL  IT+ +I TTI +L  Q+ IG
Sbjct:    1 MKQRQYLGAFNHSVAIPTTKKMNIQIDIGTGDVQMPFAMTGVIIISGQIIIHNDNTKQRQYRGKFNHSLRTITTPDIVTTINELTIQIDIG 91          

HSP 3 Score: 93.2041 bits (230), Expect = 1.660e-20
Identity = 72/113 (63.72%), Postives = 80/113 (70.80%), Query Frame = 3
Query:  441 SQIIISGGFMKQRQYLGAFNHSVAIPTT-------KKMNIQIDIGTGDVQMPFAKTXXXXXXXXXXXHNDNTKQRQYRGTFNHSLGXXXXXXXXXXXGKLIPQLQIGIETAHM 758
            +QIII     KQRQY G FNHS+   TT        ++ IQ DIGTGDVQMPFA TG+IIISGQIIIHNDNTKQRQYRGTFNHSLGIIT+ +I TTI +L  Q  IG     M
Sbjct:  171 AQIIIHNDNTKQRQYRGKFNHSLRTITTPDIVTTINELTIQRDIGTGDVQMPFAMTGVIIISGQIIIHNDNTKQRQYRGTFNHSLGIITTPDIVTTINELTIQRDIGTGDVQM 283          

HSP 4 Score: 83.5741 bits (205), Expect = 3.259e-17
Identity = 63/103 (61.17%), Postives = 72/103 (69.90%), Query Frame = 3
Query:  471 KQRQYLGAFNHSVAIPTT-------KKMNIQIDIGTGDVQMPFAKTXXXXXXXXXXXHNDNTKQRQYRGTFNHSLGXXXXXXXXXXXGKLIPQLQIGIETAHM 758
            KQRQY G FN+S+   TT        ++ IQIDIGTGDVQMPFA TG++IIS QIIIHNDNTKQRQYRG FNHSL  IT+ +I TTI +L  Q  IG     M
Sbjct:  119 KQRQYRGKFNNSLRTITTPDIVTTINELTIQIDIGTGDVQMPFAMTGVLIISAQIIIHNDNTKQRQYRGKFNHSLRTITTPDIVTTINELTIQRDIGTGDVQM 221          

HSP 5 Score: 81.2629 bits (199), Expect = 1.742e-16
Identity = 63/103 (61.17%), Postives = 72/103 (69.90%), Query Frame = 3
Query:  471 KQRQYLGAFNHSVAIPTT-------KKMNIQIDIGTGDVQMPFAKTXXXXXXXXXXXHNDNTKQRQYRGTFNHSLGXXXXXXXXXXXGKLIPQLQIGIETAHM 758
            KQRQY G FNHS+   TT        ++ IQIDIGTGDVQ+PF  TG IIISGQIIIHNDNTKQRQYRG FN+SL  IT+ +I TTI +L  Q+ IG     M
Sbjct:   57 KQRQYRGKFNHSLRTITTPDIVTTINELTIQIDIGTGDVQIPFEMTGFIIISGQIIIHNDNTKQRQYRGKFNNSLRTITTPDIVTTINELTIQIDIGTGDVQM 159          
The following BLAST results are available for this feature:
BLAST of SMED30016551 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016551 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016551 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016551 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016551 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016551 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016551 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016551 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016551 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016551 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016551 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016551 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016551 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016551 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000020889.12.132e-15286.69SMESG000020889.1[more]
SMESG000020889.12.344e-15286.69SMESG000020889.1[more]
SMESG000020889.11.518e-8686.11SMESG000020889.1[more]
SMESG000020887.13.491e-3081.90SMESG000020887.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016551 ID=SMED30016551|Name=SMED30016551|organism=Schmidtea mediterranea sexual|type=transcript|length=1549bp
GTTTTGTTCATTCGAGATTATTTTCATTTTTATCGGTTTAACAAAGGCAT
CTAATCTAGCGCCCCGACGCCATTTACAATTCGTTGCATGTTTCTACAAT
AATGAAGTATATTATGTGAATCATTTGCAATTCTCACCGTATTTGCCTCG
CTTATGCAAATATGTCGAAACTCACCACCGGGTACAGCCTGGCAGCACAA
TTTGCTATTATAATCACTTTGCTAAATCAAATATTTCACAAGATATTAAA
AGGATTCAAACATATGAGTACATGTCCGACGCTCACTGCATAAAATATCC
TTCAGTTACCCCAAACCCTTTTATTGCCAACACAATTTCAAAATTATTGG
CAATTATCTTAAAGACTAGGAGAAATAGGATTGCAAATAGTGAATCTAAA
GAAAATAGAAAACAAAGAAAGATTACTACGAGCAGCTATCAGTCAAATAA
TAATTTCTGGAGGTTTTATGAAACAACGCCAATACCTTGGAGCATTCAAC
CATTCAGTCGCTATCCCTACGACCAAGAAAATGAATATCCAAATAGATAT
TGGAACAGGAGACGTTCAAATGCCTTTCGCAAAGACTGGCATTATAATAA
TCAGTGGTCAAATAATTATTCACAACGACAATACCAAACAACGCCAATAC
CGTGGAACATTCAATCATTCACTAGGTATTATTACATCAACCGAAATAGA
AACTACAATCGGCAAACTGATTCCCCAATTACAAATTGGAATAGAGACCG
CTCATATGGCCGTCTAAATAATTATTGGAGGCCAAACAATTATATACGGG
GACCAAATACTCGATATCAAAAATTACTTGCAATTAAATCGCCAAATCAT
TACCACAAATATACAGCAGAAAATACAAATCGAATCACCACTGATGGATC
ATTGAATACGCTTTTACGAAAAGTTTACGGTTTTCACTTAAAAGACTACA
TCAAATTAAGATATTCAATCATATGGCTTTGTGCTGGGACCATAATTTTC
GGGACATTTTGTATTCTAACTATAATAATTATAACAATGCAGTATAGAAA
TACTTTAAATAAACACATAAAAAAAAAGGAAACACTTTTACAGCTCTCTG
AAGTATTAAATCGAGGGTTTGAAAGAGACGACATCCCCCCAAGATATGAA
GATGTCCAGAACAGTGTCGTTCAGAATGTTTAACACCTTTAGCACTCACA
TTTGTAAACTGATTTTAAAACTTAAAATAACTTTTTAATTTTTTACCGTT
ATTGTATTGTTTAAAAACATTTTATTTTATGTCATTTTTCTTATATGAGA
TTTACTTTAATGTTTTTCTATTTACTGTTGAGAGTATGTAAAACATTTAA
TTTTATATAATAAATAAGCACATTAAACGCTGGGTCGAATGTTTTAAAGT
TAAAGGAAATGTATTGCAGACCTCTAGAAATCAAAATAGAAAGAATTATC
TAACAATGAAAAGATAATAGAAGAGAGTAAAACAATAAAACACTTAAAAT
GTAAACCTTTGATTCCTTTGCAAGTTAATTTTTAAAATGTTGTCCGAAT
back to top

protein sequence of SMED30016551-orf-1

>SMED30016551-orf-1 ID=SMED30016551-orf-1|Name=SMED30016551-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=394bp
FCSFEIIFIFIGLTKASNLAPRRHLQFVACFYNNEVYYVNHLQFSPYLPR
LCKYVETHHRVQPGSTICYYNHFAKSNISQDIKRIQTYEYMSDAHCIKYP
SVTPNPFIANTISKLLAIILKTRRNRIANSESKENRKQRKITTSSYQSNN
NFWRFYETTPIPWSIQPFSRYPYDQENEYPNRYWNRRRSNAFRKDWHYNN
QWSNNYSQRQYQTTPIPWNIQSFTRYYYINRNRNYNRQTDSPITNWNRDR
SYGRLNNYWRPNNYIRGPNTRYQKLLAIKSPNHYHKYTAENTNRITTDGS
LNTLLRKVYGFHLKDYIKLRYSIIWLCAGTIIFGTFCILTIIIITMQYRN
TLNKHIKKKETLLQLSEVLNRGFERDDIPPRYEDVQNSVVQNV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0002089reproductive organ
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..16
score: 0.544
NoneNo IPR availableTMHMMTMhelixcoord: 322..344