DNA_pol_B_2 domain-containing protein

Overview
NameDNA_pol_B_2 domain-containing protein
Smed IDSMED30016538
Length (bp)1610
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DNA_pol_B_2 domain-containing protein (SMED30016538) t-SNE clustered cells

Violin plots show distribution of expression levels for DNA_pol_B_2 domain-containing protein (SMED30016538) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016538

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neoblastSMED30016538 dd_Smed_v4_22559_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Celegans
Match: ZC53.4 (pep chromosome:WBcel235:X:1925750:1937689:1 gene:WBGene00022511.1 transcript:ZC53.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZC53.4)

HSP 1 Score: 139.813 bits (351), Expect = 1.185e-34
Identity = 124/428 (28.97%), Postives = 190/428 (44.39%), Query Frame = 3
Query:  375 VTPPFVIYADFESILPIDIRFHQK-----------HLPISAGLLLINNF----NNTKSYFSFIGLDCVLEFLKKIEEIAATIVQ-PYFDLFSDSNIIPLSFNQENAFKFCLNCYLCKKPIRNRVKVYEHFSGRYLGAACSLCRNVRRNRQHLPVIFHNLRGYDLHHILKYGLSSF----PSWDLNIIPTTTEKFISLIAHIDKVSVRFIDSYQFVSASLDNAVKTLSNFPLTDSVFTGSIMGCKGIFPYNFAKSLEILETTFELPPIWPEVTESQYLRAQKIWNENNCNTLLDYMMVYLKLDVFLLADFFQQFRSKSIAHNGLDPLNFYGIPGMSWASALMTLKEPIELLTDMEMYNFYEGGIRGGI-------TFVNKHYVKTSDDTE----LLYIDINNLYGWALSQSLPFGDFSWVINNLDSILD 1565
            V   ++IYADFESI+      H K           H+     ++++++F    +N KSY   IG +  LEF K I +I+  I+  P   +   +      FN+      C   Y  +     +V+ ++H++G Y G  C  C  +RR    +PV FHNL+GYD H I+    S+        ++  I + TEKFIS             + +QF                         +M  KG++PY +  S +  + T +LP               K +++ N            K     +AD F+ FR+ S+    LDP  ++  PG++W + L   K  ++ L D+EMY   E GIRGGI       + VN  Y K  ++ +    LLY+D NNLYGWA+ Q LP GDF +   +L SIL+
Sbjct:  872 VKHRYIIYADFESIIWKFSNAHYKPNESWTMDVGEHVASRFCVVVVDSFTKKIHNMKSY---IGYNATLEFNKYIIKISQEIMSLPSVRMKKLTQDEWTEFNKNQECPHCQVQYNTEDMKTTKVRDHDHWTGEYRGPFCGSCNILRRKNNFIPVFFHNLKGYDSHLIVGCLESTKYLNEHEIEIEKISSNTEKFISFS----------YNPHQF------------------------QLMRKKGVYPYEYMDSFKRFDKT-KLP------------NRDKFYDKLNNK----------KCKRKGIADVFENFRALSLRVYQLDPCWYFTSPGLAWDAMLKKTKVELDKLHDVEMYLMIEKGIRGGIVNAVKRYSKVNNKYTKNFNEKQLTNFLLYLDANNLYGWAMCQMLPTGDFKFETQSLISILN 1239          
BLAST of DNA_pol_B_2 domain-containing protein vs. TrEMBL
Match: A0A267DRN2 (DNA_pol_B_2 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig020163g6 PE=4 SV=1)

HSP 1 Score: 268.47 bits (685), Expect = 1.836e-78
Identity = 178/558 (31.90%), Postives = 271/558 (48.57%), Query Frame = 3
Query:  114 LYLLLLENDEQYHYTAVIDLQRLMNSHINDIVSVRIQCQWCPRCLNGFRLQDAFNSHYALCIKNQVGTTLYTLP--QNKYLEFGDYSKTVTPPFVIYADFE---------SILPIDIRFHQKHLPISAGLLLINNFNNTK--------SYFSFIGLD---CVLEFLKKIEEIAATIVQPYFDLFSDSNIIPLSFNQENAFKFCLNCYLCKKPI---RNRVKVYEHFSGRYLGAACSLCR-NVRRNRQHLPVIFHNLRGYDLHHILKYGLSSFPSWDLNIIPTTTEKFISLIAHID-------------KVSVRFIDSYQFVSASLDNAVKTL-------------SNFPLTDSVFTGSIMGCKGIFPYNFAKSLEIL-------ETTFELPPIWPEVTESQYLRAQKIWNENNCNTLLDYMMVYLKLDVFLLADFFQQFRSKSIAHNGLDPLNFYGIPGMSWASALMTLKEPIELLTDMEMYNFYEGGIRGGITFVNKHYVKTSDD------------------------TELLYIDINNLYGWALSQSLPFGDFSWV 1538
            L++   E++   H+ AV  + RL+NS      +   + +WC RCL  F    AF  H     +  V      LP  +N  L F  + KT++PPFV+YADFE         SI  I  +   +H+ ++AG ++++    T            +F+  D   C+ +FL+ +E++A  +   +   FS    I         F+    C  C        N+   ++H SG + GAAC+ C    R  R  LPV+FHN +GYDLH ++   L     W +++IP   E+F+S+                    +++FIDS QF++ASL   +K L             S FPL  S     ++  KG+FPY++ K+ ++L       + +F         T S Y  AQ+ W E   + L +YM+ YL+LD+  LAD F+ FR  S+  +GLDP++F   PG+S+ASAL ++K  IELLTD +MY+ +E GIRGG++FVN H V+ +                          TELL +D NNLYG AL+ +LP G F W+
Sbjct:   10 LFIPPSEDEASGHWCAVSSINRLLNSK-----AALHRRKWCERCLLPFHSDAAFEEHSRAPCQPGVINVKEELPDERNNILRFSSWEKTISPPFVVYADFEALNAPCQEDSIAGIATKKLTEHIAVAAGYIVLHREGMTGLAPRGADDKVSTFVSDDPNKCISDFLQSLEKLAREVYG-WNTEFSRQAAIRTEMAGRQ-FREATACCYCGSEFTEGSNKHWDHDHLSGEFRGAACADCNMKARLKRSFLPVVFHNFKGYDLHLMMSSALGLMEGWKISVIPLNPEQFLSMKIEFKIGEYESEGKIKPLNFTIQFIDSNQFLNASLSQLIKNLPEAECRITSRLRSSRFPLLSS----EVLFSKGVFPYDYLKNSDVLKDAVLPSQESFYNALTKSHCTNSDYEHAQRAWREFQVSNLKEYMLCYLELDIRQLADIFENFRKISMQEDGLDPVHFISTPGLSFASALKSIKSGIELLTDAQMYSLFERGIRGGMSFVNIHKVQATSAAGASTGVDSNEDVDGGTPTIHAGLTELLAVDANNLYGQALTMNLPVGGFRWL 556          
BLAST of DNA_pol_B_2 domain-containing protein vs. TrEMBL
Match: A0A5N3ZYJ5 (Uncharacterized protein (Fragment) OS=Photinus pyralis OX=7054 GN=PPYR_15562 PE=4 SV=1)

HSP 1 Score: 265.003 bits (676), Expect = 1.703e-77
Identity = 158/504 (31.35%), Postives = 275/504 (54.56%), Query Frame = 3
Query:  132 ENDEQYHYTAVIDLQRLMNSHINDIVSVRIQCQWCPRCLNGFRLQDAFNSHYALCIKNQVGTTLYTLPQNKYLEFGDYSKTVTPPFVIYADFESILPIDIR--FHQKHLPISAGLLLINNFNNTKSYF-SFIGLDCVLEFLKKIEEIAATIVQPYFDLFSDSNIIPLSFNQENAFKFCLNCYLCKKPIRN---RVKVYEHF--SGRYLGAACSLCRNVRRNRQHLPVIFHNLRGYDLHHILKYGLSSFPSWDLNIIPTTTEKFISLIAHID--KVSVRFIDSYQFVSASLDNAVKTLSNFPLTDSVFTGSIMGCKGIFPYNFAKSLEILETTFELPP---IWPEVTES-----QYLRAQKIWNENNCNTLLDYMMVYLKLDVFLLADFFQQFRSKSIAHNGLDPLNFYGIPGMSWASALMTLKEPIELLTDMEMYNFYEGGIRGGITFV---------NKH---YVKTSDDTELLYIDINNLYGWALSQSLPFGDFSWVINNLD 1553
            E   ++HY  + +L RL++  ++     ++Q   C RCL+ F  +D    H   C++     T     + K L+F ++   +  PFV+YAD ES+L    +   +Q+H+P + G     +++ + S++ S+ G DC+  F  ++ ++A  +   +   +     + ++  QE  F+   +C++C++  ++   +V+ + H      + GAAC  C    ++   +PV+FHNL GYD H ++   +++     ++++P T EK+IS   HI+  ++  RFIDS++F+++SLD     L+NFP             KGI PY++  S +  +    LPP    + ++ +       Y RAQ++W+  NC+ L  Y+ +Y+K D+ LLAD F+QFRS  I+   LDP +++ +PG +W + L   ++ +ELLTD +M+ F E GIRGG++ V         NK+   Y  T  D  L+Y DINN YGW++SQ LP+G F WV +N+D
Sbjct:   85 EQPSKFHYVWIKNLSRLVSMQLS---KKKVQKHICDRCLHYFNSKDKLIKHTVDCLQKNDTATKMPTDEKKMLKFKNFKNKIKAPFVVYADLESVLKPSTKKTAYQQHIPAAVGYYFKCSYDESLSFYNSYRGEDCMRWFADEMNKLAEDVSTVFLCPYK----MHMTPQQELEFQAATHCHICEQSFKSGQKKVRDHNHLIPENNFRGAACEGCNVNYQDTHTIPVVFHNLSGYDAHFVVT-DIATRMDGKIDLLPITKEKYISFTKHINESRICFRFIDSFRFMASSLDKLSSALTNFPK------------KGIMPYDYFDSFDRFDE-LCLPPQDAFYNKLEDKPCPRRMYRRAQEVWSRFNCSNLGQYVDLYMKTDILLLADVFEQFRSSCISTYDLDPAHYFTLPGFTWDAMLKYTRQELELLTDQDMFLFVERGIRGGLSQVCSKRRAHANNKYMSKYDSTKPDVYLMYNDINNQYGWSMSQYLPYGGFEWVDSNID 567          
BLAST of DNA_pol_B_2 domain-containing protein vs. TrEMBL
Match: A0A5N3ZZW1 (Uncharacterized protein (Fragment) OS=Photinus pyralis OX=7054 GN=PPYR_14986 PE=4 SV=1)

HSP 1 Score: 269.24 bits (687), Expect = 1.003e-76
Identity = 161/513 (31.38%), Postives = 280/513 (54.58%), Query Frame = 3
Query:  132 ENDEQYHYTAVIDLQRLMNSHINDIVSVRIQCQWCPRCLNGFRLQDAFNSHYALCIKNQVGTTLYTLPQNKYLEFGDYSKTVTPPFVIYADFESIL-PIDIR-FHQKHLPISAGLLLINNFNNTKSYF-SFIGLDCVLEFLKKIEEIAATIVQPYFDLFSDSNIIPLSFNQENAFKFCLNCYLCKKPIRN---RVKVYEHF--SGRYLGAACSLCRNVRRNRQHLPVIFHNLRGYDLHHILKYGLSSFPSWDLNIIPTTTEKFISLIAHID--KVSVRFIDSYQFVSASLDNAVKTLSNFPLTDSVFTG------SIMGCKGIFPYNFAKSLEILETTFELPPIWPE-----------VTESQYLRAQKIWNENNCNTLLDYMMVYLKLDVFLLADFFQQFRSKSIAHNGLDPLNFYGIPGMSWASALMTLKEPIELLTDMEMYNFYEGGIRGGITFV---------NKHYVK---TSDDTELLYIDINNLYGWALSQSLPFGDFSWVINNLD 1553
            E   ++HY  + +L RL++  ++     + Q   C RCL+ +R +D  + H   CI+           + K L+F ++   +  PFV+YAD ES+L P + +  +Q+H+P + G  L  +++ + S++ S+ G D +  F  ++ ++A  +   +   +     + ++  QE  F+    C++C++  ++   +V+ + H      + GAAC  C    ++   +PV+FHNL GYD H ++   +++     ++++P T EK+IS   HID  +VS RFIDS++F+++ LD     L+ FP   + F+       +++  KG+ PY++  S +     FE P + P+                Y RAQ++W+  NC+ L  Y+ +Y+K D+ LLAD F+QFRS  I+   LDP +++ +PG +W + L   ++ +ELLTD +M+ F E GIRGG++ V         NK+ +K   T  D  L+Y DINN YGW++SQ LP+G F WV +N+D
Sbjct:  344 EQSVKFHYVWIKNLSRLVSKQLS---KEKRQKYICDRCLHFYRSEDKLHKHTKDCIQKNDTAIKMPTEEKKMLKFKNFKNKIKAPFVVYADLESVLKPSEKKTAYQQHIPAAVGYYLKCSYDESLSFYNSYRGEDSMRWFADEMNKLAEDVSTVFLCPYK----MHMTPQQELEFQAATECHICEQSFKSGQKKVRDHNHLIPENNFRGAACEGCNVNYQDTHTIPVVFHNLSGYDAHFVVA-DIATRMDGKIDLLPITKEKYISFTKHIDESRVSFRFIDSFRFMASGLDKLSSALTEFPNLKAQFSTLPADQFNLLTKKGVMPYDYLDSFD----RFEEPTLPPQDDFYNKLEDKPCPRKMYRRAQEVWDRFNCSNLGQYVDLYMKTDILLLADVFEQFRSSCISTYDLDPAHYFTLPGFTWDAMLKYTQQELELLTDQDMFLFVERGIRGGLSQVCCKRRAHANNKYMLKYDSTKPDVYLMYNDINNQYGWSMSQYLPYGGFEWVDSNID 844          
BLAST of DNA_pol_B_2 domain-containing protein vs. TrEMBL
Match: A0A5N3ZZI5 (Uncharacterized protein (Fragment) OS=Photinus pyralis OX=7054 GN=PPYR_15189 PE=4 SV=1)

HSP 1 Score: 269.24 bits (687), Expect = 1.107e-76
Identity = 161/513 (31.38%), Postives = 279/513 (54.39%), Query Frame = 3
Query:  132 ENDEQYHYTAVIDLQRLMNSHINDIVSVRIQCQWCPRCLNGFRLQDAFNSHYALCIKNQVGTTLYTLPQNKYLEFGDYSKTVTPPFVIYADFESIL-PIDIR-FHQKHLPISAGLLLINNFNNTKSYF-SFIGLDCVLEFLKKIEEIAATIVQPYFDLFSDSNIIPLSFNQENAFKFCLNCYLCKKPIRN---RVKVYEHF--SGRYLGAACSLCRNVRRNRQHLPVIFHNLRGYDLHHILKYGLSSFPSWDLNIIPTTTEKFISLIAHID--KVSVRFIDSYQFVSASLDNAVKTLSNFPLTDSVFTG------SIMGCKGIFPYNFAKSLEILETTFELPPIWPE-----------VTESQYLRAQKIWNENNCNTLLDYMMVYLKLDVFLLADFFQQFRSKSIAHNGLDPLNFYGIPGMSWASALMTLKEPIELLTDMEMYNFYEGGIRGGITFV---------NKH---YVKTSDDTELLYIDINNLYGWALSQSLPFGDFSWVINNLD 1553
            E   ++HY  + +L RL++  ++     + Q   C RCL+ +R +D  + H   CI+           + K L+F ++   +  PFV+YAD ES+L P + +  +Q+H+P + G  L  +++ + S++ S+ G D +  F  ++ ++A  +   +   +     + ++  QE  F+    C++C++  ++   +V+ + H      + GAAC  C    ++   +PV+FHNL GYD H ++   +++     ++++P T EK+IS   HID  +VS RFIDS++F+++ LD     L+ FP   + F+       +++  KG+ PY++  S +     FE P + P+                Y RAQ++W+  NC+ L  Y+ +Y+K D+ LLAD F+QFRS  I+   LDP +++ +PG +W + L   ++ +ELLTD +M+ F E GIRGG++ V         NK+   Y  T  D  L+Y DINN YGW++SQ LP+G F WV +N+D
Sbjct:  344 EQSVKFHYVWIKNLSRLVSKQLS---KEKRQKYICDRCLHFYRSEDKLHKHTKDCIQKNDTAIKMPTEEKKMLKFKNFKNKIKAPFVVYADLESVLKPSEKKTAYQQHIPAAVGYYLKCSYDESLSFYNSYRGEDSMRWFADEMNKLAEDVSTVFLCPYK----MHMTPQQELEFQAATECHICEQSFKSGQKKVRDHNHLIPVNNFRGAACEGCNVNYQDTHTIPVVFHNLSGYDAHFVVA-DIATRMDGKIDLLPITKEKYISFTKHIDESRVSFRFIDSFRFMASGLDKLSSALTEFPNLKAQFSTLPADQFNLLTKKGVMPYDYLDSFD----RFEEPTLPPQDDFYNKLEDKPCPRKMYRRAQEVWDRFNCSNLGQYVDLYMKTDILLLADVFEQFRSSCISTYDLDPAHYFTLPGFTWDAMLKYTRQELELLTDQDMFLFVERGIRGGLSQVCSKRRAHANNKYMPKYDSTKPDVYLMYNDINNQYGWSMSQYLPYGGFEWVDSNID 844          
BLAST of DNA_pol_B_2 domain-containing protein vs. TrEMBL
Match: A0A1Y1MZZ0 (Uncharacterized protein OS=Photinus pyralis OX=7054 PE=4 SV=1)

HSP 1 Score: 270.011 bits (689), Expect = 1.448e-76
Identity = 161/516 (31.20%), Postives = 275/516 (53.29%), Query Frame = 3
Query:  132 ENDEQYHYTAVIDLQRLMNSHINDIVSVRIQCQWCPRCLNGFRLQDAFNSHYALCIKNQVGTTLYTLPQNKYLEFGDYSKTVTPPFVIYADFESILPIDIR--FHQKHLPISAGLLLINNFNNTKSYF-SFIGLDCVLEFLKKIEEIAATIVQPYFDLFSDSNIIPLSFNQENAFKFCLNCYLCKKPI---RNRVKVYEHF--SGRYLGAACSLCRNVRRNRQHLPVIFHNLRGYDLHHILKYGLSSFPSWDLNIIPTTTEKFISLIAHID--KVSVRFIDSYQFVSASLDNAVKTLSNFPLTDSVFTG------SIMGCKGIFPYNFAKSLEILETTFELPPIWPE-----------VTESQYLRAQKIWNENNCNTLLDYMMVYLKLDVFLLADFFQQFRSKSIAHNGLDPLNFYGIPGMSWASALMTLKEPIELLTDMEMYNFYEGGIRGGITFV--------NKHYVKTSD----DTELLYIDINNLYGWALSQSLPFGDFSWVINNLDSIL 1562
            E   ++HY  + +L RL++  +        Q   C RCL+ F  +D    H   C++           + K L+F ++   +  PFV+YAD ES+L    +   +Q+H+P + G     +++ + S++ S+ G DC+  F  ++ ++A  +   +   +     + ++  QE  F+   +C++C++P    + +V+ + H      + GAAC +C    ++   +PV+FHNL GYD H ++   +++     ++++P T EK+IS   HI+  ++  RFIDS++F+++SLD     L+NFP   S F+       +I+  KGI PY++  S     T F+ P + P+                Y RAQ++W++ NCN L  Y+ +Y+K D+ LLAD F+ FRS  I+   LDP +++ +PG +W + L   ++ +ELLTD +M+ F E GIRGG++ V        N  Y+   D    D  L+Y DINN YGW++SQ LP+G F WV  N+D  +
Sbjct:   24 EQPTKFHYVWIKNLSRLVSKKLG---KRNGQKYVCDRCLHYFHSEDKLIKHTGDCMQKNDTAIKMPTEEKKMLKFKNFKNKIKAPFVVYADLESVLKPSAKKTAYQQHIPAAVGYYFKCSYDESLSFYNSYRGEDCMRWFADEMNQLAEDVSTVFLCPYK----MQMTPQQEIEFQTATHCHICEQPFTAGQKKVRDHNHLIPENNFRGAACEICNVNYQDTHTIPVVFHNLSGYDAHFVVS-DIATRMDGKIDLLPITKEKYISFTKHINESRICFRFIDSFRFMASSLDKLSSALTNFPNLKSQFSTLPEDQFNILTKKGIMPYDYLDSF----TRFDEPCLPPQDAFYNKLEDKPCPRRMYRRAQEVWSKFNCNNLGQYVELYMKTDILLLADVFELFRSSCISTYDLDPAHYFTLPGFTWDAMLKHTRQELELLTDQDMFLFIERGIRGGLSQVCSKRRVHANNKYMPKYDSAKPDVYLMYNDINNQYGWSMSQYLPYGGFQWVDANIDVTM 527          
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO46109 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR56])

HSP 1 Score: 235.343 bits (599), Expect = 4.133e-67
Identity = 174/579 (30.05%), Postives = 281/579 (48.53%), Query Frame = 3
Query:   21 INKYENENDDFVPHHPHLDIIHRTKV-----TDVDP---LYLLLLENDEQYHYTAVIDLQRLMNSHINDIVSVRIQCQWCPRCLNGFRLQDAFNSHYALCIKNQVGTTLYTLPQNK-----YLEFGDYSKTVTPPFVIYADFESILP-IDI----------RFHQKHLPISAGLLLINNFNN-------TKSYFSFIGLDCVLEFLKKIEEIAATIVQPYFDLFSDSNIIPLSFNQENAFKFCLNCYLCKKPI-RNRVKVYEHFSGRYLGAACSLCRNVRRNRQHLPVIFHNLRGYDLHHILKYGLSSFPSWDLNIIPTTTEKFISLIAHID--------------KVSVRFIDSYQFVSASLDNAVKTL--SNFPLTDSVFTGSIMGC---KGIFPYNFAKSLEILETTFELPPIWP--------EVTESQYLRAQKIWNENNCNTLLDYMMVYLKLDVFLLADFFQQFRSKSIAHNGLDPLNFYGIPGMSWASALMTLKEPIELLTDMEMYNFYEGGIRGGITFVNKHYVKTSD------DTEL-----LYIDINNLYGWALSQSLPFGDFSWVINN 1547
            I+K+E +N    PH  ++      K+     +  DP   + LLL+ N E  HY  + D+  L++S I+     R     C RCLN FR + A   HY  C KN+  +    +P +K     Y  F ++++ +  PFV+YADFES    ID           + +QKH P     L+  + ++        +        D    F++ +E    + ++  ++ F     + ++   E  +    +C++C   +  ++V  + H +G+Y GAA + C    R  +  PV+FHNL GYD H  +K   +S     +N IP   EK+IS    +               K  +RFIDS++F+SASLD+ VK L   +F      + G  +     KG+FPY++  + + L+   +LPP           +++E  Y  AQK+W     +T+ DY  +YL+ DV LLAD F+ FR   + + GLDP  +Y  PG++W +AL   +  +ELLTD +M   +E GIRGG++ ++  + K ++      D  L      Y+D NNLYGWA+S+ LP   F W+ + 
Sbjct:  686 IDKFERQN----PHTVNVFTYEEKKICPLRISGKDPFNAINLLLISNGETSHYCWIKDVMSLVSSQIDKYHHTRF---LCFRCLNSFRCKKALEKHYEYCSKNE--SVRIEMPMDKDGKPLYTRFVNFNRKMRVPFVVYADFESFTENIDTCSPDESRSFTKQYQKHKPSGFCYLIKCSIDDGVFSPKLVQRTVQGSAEDVAQLFVESLE----SDIKEIYNKFKFPKEVEMTREDEMNYDNATHCHICGGELGEDKVLDHCHLTGKYRGAAHNACNLRFRAPKFFPVLFHNLSGYDSHLFVKNLGTS--EGKINCIPNNEEKYISFTKQVVVDRFTNKEGKQVDVKRDIRFIDSFKFMSASLDSLVKNLPRESFKNLTIHYKGEQLQLLLRKGVFPYDWFCNFDQLDA-IQLPPKEAFYSTLNDTDISEEDYQHAQKVWETFKMSTMRDYHDLYLESDVLLLADVFENFRDVCLENYGLDPAWYYTAPGLAWDAALKITRVELELLTDCDMLLMFEEGIRGGVSMISTRHSKANNPYMREYDPNLPTKYITYLDANNLYGWAMSKPLPTHGFRWMTDQ 1248          
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO44110 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWZ0])

HSP 1 Score: 67.781 bits (164), Expect = 2.592e-12
Identity = 63/256 (24.61%), Postives = 112/256 (43.75%), Query Frame = 3
Query:   45 DDFVPHHPHLDIIHR----------TKVTDVDPLYLLLLENDEQYHYTAVIDLQRLMNSHINDIVSVRIQCQWCPRCLNGFRLQDAFNSHYALCIKNQVGTTLYTLPQN-----KYLEFGDYSKTVTPPFVIYADFESILP-ID----------IRFHQKHLPISAGLLLINNFNNT-------KSYFSFIGLDCVLEFLKKIEEIAATIVQPYFDLFSDSNIIPLSFNQENAFKFCLNCYLCKKPIRNRVKVYEH 713
            D+F   +PH   ++           +K  D   + LLL+ +DE  HY  + ++ RL++S I D        ++CPRCLN F  ++A   H   C KN+       +P++      Y +F  +++ +  PFV+YADFE     ID           + +QKH P S    LI  F+++       +        D    F++ +E    + ++  +D F  S  + ++      +    +C++C+   R   +VYE 
Sbjct:  111 DEFEKQNPHAVNVYGYEGSVYPLRISKRHDTRTINLLLISDDETNHYCWIKNMSRLLSSQIGDHQHAS---EFCPRCLNSFWCKEALERHSEYCSKNE--EVKIEMPRDIDGNPLYTKFRSFNRKMRVPFVVYADFECFTENIDTCSPDESKSFTKQYQKHKP-SGFCYLIKCFDDSIFPPTLVRETLQGPTEDVAQMFVESLE----SDIKEIYDKFRFSKRVEMTQRDRIDYSNATHCHICEGCGR---QVYEQ 353          
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO34977 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMS5])

HSP 1 Score: 67.0106 bits (162), Expect = 9.831e-12
Identity = 47/144 (32.64%), Postives = 72/144 (50.00%), Query Frame = 3
Query:   21 INKYENENDDFVPHHPHLDIIHRTKV-----TDVDP---LYLLLLENDEQYHYTAVIDLQRLMNSHINDIVSVRIQCQWCPRCLNGFRLQDAFNSHYALCIKNQVGTTLYTLPQNK-----YLEFGDYSKTVTPPFVIYADFES 413
            I+K+E +N    PH  ++      K+     +  DP   + LLL+ N E  HY  + D+  L++S I+     R     C RCLN FR + A   HY  C KN+  +    +P +K     Y  F ++++ +  PFV+YADFES
Sbjct:  259 IDKFERQN----PHTVNVFTYEEKKICPLRISGKDPFNAINLLLISNGETSHYCWIKDVMSLVSSQIDKYHHTRF---LCFRCLNSFRCEMALEKHYEYCSKNE--SVRIEMPMDKDGKPLYTRFVNFNRKMRVPFVVYADFES 393          
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO34080 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQD5])

HSP 1 Score: 65.855 bits (159), Expect = 2.298e-11
Identity = 41/137 (29.93%), Postives = 67/137 (48.91%), Query Frame = 3
Query:   45 DDFVPHHPHLDIIHR----------TKVTDVDPLYLLLLENDEQYHYTAVIDLQRLMNSHINDIVSVRIQCQWCPRCLNGFRLQDAFNSHYALCIKNQVGTTLYTLPQN-----KYLEFGDYSKTVTPPFVIYADFE 410
            D+F   +PH   ++           +K  D   + LLL+ +DE  HY  + ++ RL++S I D        ++CPRCLN F  + A   H   C KN+       +P++      Y +F  +++ +  PFV+YADFE
Sbjct:  464 DEFEKQNPHAVNVYGYEGSVYPLRISKRHDTRTINLLLISDDETNHYCWIKNMSRLLSSQIGDHQHA---SEFCPRCLNSFWCKKALERHSEYCSKNE--EVKIEMPRDIDGNPLYTKFRSFNRKMRVPFVVYADFE 595          
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO31141 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYS4])

HSP 1 Score: 65.855 bits (159), Expect = 2.631e-11
Identity = 67/288 (23.26%), Postives = 133/288 (46.18%), Query Frame = 3
Query:   21 INKYENENDDFVPHHPHLDIIHRTKVTDVDP---LYLLLLENDEQYHYTAVIDLQRLMNSHINDIVSVRIQCQWCPRCLNGFRLQDAFNSHYALCIKNQ-VGTTLYTLPQNK---YLEFGDYSKTVTPPFVIYADFESILP-ID----------IRFHQKHLPISAGLLLINNFNNTKSYFSFIGL-------DCVLEFLKKIEEIAATIVQPYFDLFSDSNIIPLSFNQENAFKFCLNCYLCKKPI-RNRVKVYEHFSGRYLGAACSLCRNVRRNRQHLPVIFHNLR 806
            I+K+E +N   V    +   ++  ++++ DP   + LLL+ NDE  HY  + ++ RL+++ I+     R     C RCLN FR + +   H   C  ++ V   +  + ++    +++F  Y++ +  PFV+YADFES    ID           + +QKH P S    LI  F+   S    +         D    F++ +E    + ++  +D F     + ++     A+    +C++C+  +  ++  +     G +  + C++  ++  +    P++FHNLR
Sbjct:  361 IDKFEKQNPYTVNVFGYETKVYPLRISEKDPDNAINLLLISNDETNHYCWIKNMMRLVSTQIDKFHHTRF---LCCRCLNSFRCKQSLEKHSECCGNHEAVRIEMPNIDKDGNLPHIKFKKYNRKMRVPFVVYADFESFTENIDTCSPDGSKSFTKQYQKHKP-SGFCYLIKCFDGDISPSELVRYTAESPDEDIPQLFVESLE----SDIKKIYDKFRFPKKVKMTPEDGIAYNDATHCHICEGELGEDKCSI-----GAFDKSLCAMVPSL-ASLDGNPLLFHNLR 634          
BLAST of DNA_pol_B_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000026530.1 (SMESG000026530.1)

HSP 1 Score: 726.087 bits (1873), Expect = 0.000e+0
Identity = 352/534 (65.92%), Postives = 420/534 (78.65%), Query Frame = 3
Query:   12 PTVINKYENENDDFVPHHPHLDIIHRTKVTDVDPLYLLLLENDEQYHYTAVIDLQRLMNSHINDIVSVRIQCQWCPRCLNGFRLQDAFNSHYALCIKNQVGTTLYTLPQNKYLEFGDYSKTVTPPFVIYADFESILPIDIRFHQKHLPISAGLLLINNFNNTKSYFSFIGLDCVLEFLKKIEEIAATIVQPYFDLFSDSNIIPLSFNQENAFKFCLNCYLCKKPIRNRVKVYEHFSGRYLGAACSLCRNVRRNRQHLPVIFHNLRGYDLHHILKYGLSSFPSWDLNIIPTTTEKFISLIAHIDKVSVRFIDSYQFVSASLDNAVKTLSNFPLTDSVFTGSIMGCKGIFPYNFAKSLEILETTFELPPIWPEVTESQYLRAQKIWNENNCNTLLDYMMVYLKLDVFLLADFFQQFRSKSIAHNGLDPLNFYGIPGMSWASALMTLKEPIELLTDMEMYNFYEGGIRGGITFVNKHYVKTSDDTELLYIDINNLYGWALSQSLPFGDFSWVINNLDSILDERIS-TDIETLSYGYT 1610
            PTVI   +   D++V HHPHL +IHR+KVTD +P+YLLLLEN+++YHYTAV ++  LMN H N   +++I+C+WCP CLNGFRL +AFN+H ALC KNQ GTTLYTLP+NK LEF +YSK +TPPFVIYADFES+LP D R HQ H+PI+AGLLLINN+ NTKSY+ F GLDC+ +FLKKIEEIA  IV PY+D   D  I P+SF++   FK C  CYL                     AAC  C   RR  + LP++FHNLRGYDLHHILKYGL  FPSW+L+IIPT+TEKFISLI HI+K++VRFIDS QFV+ SL  AVKTL++ PLT SVF GSI+ CKGIFPYNFA S E+LETT+ELPPIW  V+E +Y RAQ IW + NC TL DYM++YLKLDVFLLAD+FQQFR+K+I +NGL+PLNFYGIPGMSWASALMTL EPIELL DMEM+NFYEGGIRGG+TFVNKHY+  S+DTELLYIDINNLYGWALSQSLP+ DF+WV + LD +L+E  +  DIE L YGYT
Sbjct:  511 PTVI--IDEVPDNYVFHHPHLSLIHRSKVTDGNPIYLLLLENNDRYHYTAVTNINWLMNCHQNPDCNIQIRCRWCPHCLNGFRLDNAFNTHVALCAKNQTGTTLYTLPENKNLEFLNYSKHITPPFVIYADFESVLPPDDRHHQIHMPIAAGLLLINNYTNTKSYYYFYGLDCIPDFLKKIEEIATEIVIPYYDSEGDKLIGPMSFSEVRQFKSCRTCYLW--------------------AACRKCNIARRIYRLLPIVFHNLRGYDLHHILKYGLDRFPSWNLDIIPTSTEKFISLIVHINKLAVRFIDSMQFVNCSLAKAVKTLTSLPLTSSVFQGSIVDCKGIFPYNFAVSEEVLETTYELPPIWEGVSEDEYDRAQLIWTQQNCRTLRDYMLIYLKLDVFLLADYFQQFRAKAIVYNGLEPLNFYGIPGMSWASALMTLTEPIELLQDMEMFNFYEGGIRGGLTFVNKHYIAASEDTELLYIDINNLYGWALSQSLPYADFTWVYDGLDDVLNECANVVDIEILPYGYT 1022          
BLAST of DNA_pol_B_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000062279.1 (SMESG000062279.1)

HSP 1 Score: 709.909 bits (1831), Expect = 0.000e+0
Identity = 338/522 (64.75%), Postives = 415/522 (79.50%), Query Frame = 3
Query:   48 DFVPHHPHLDIIHRTKVTDVDPLYLLLLENDEQYHYTAVIDLQRLMNSHINDIVSVRIQCQWCPRCLNGFRLQDAFNSHYALCIKNQVGTTLYTLPQNKYLEFGDYSKTVTPPFVIYADFESILPIDIRFHQKHLPISAGLLLINNFNNTKSYFSFIGLDCVLEFLKKIEEIAATIVQPYFDLFSDSNIIPLSFNQENAFKFCLNCYLCKKPIRNRVKVYEHFSGRYLGAACSLCRNVRRNRQHLPVIFHNLRGYDLHHILKYGLSSFPSWDLNIIPTTTEKFISLIAHIDKVSVRFIDSYQFVSASLDNAVKTLSNFPLTDSVFTGSIMGCKGIFPYNFAKSLEILETTFELPPIWPEVTESQYLRAQKIWNENNCNTLLDYMMVYLKLDVFLLADFFQQFRSKSIAHNGLDPLNFYGIPGMSWASALMTLKEPIELLTDMEMYNFYEGGIRGGITFVNKHYVKTSDDTELLYIDINNLYGWALSQSLPFGDFSWVINNLDSILDERIS-TDIETLSYGYT 1610
            +++PHHPHLDIIHR+KVTD  P+YLLLLE+ + YHYTAV DL +LMN H     +V+I   WCP CLNGFRL+ AF++H ALC KNQ GTTLYTLP+NKYL+F +++K++TPPFVIYADFESILP+DIR HQ H+PI+AGLLLINN+ NTK YF+FIG DCVL FLKKI+EIA +IV PY+++     I PLSF ++  FK C  CYLCKK IR++VK + HFSG+YLGAAC  C   RR ++ LPV+FHNLRGYDLHHILKYGL++F SW+LNIIPTTTEKFISLIA+I+K+ VRFIDS QF+++SL  AVKTL++ PLTDSVF G+I+  K IFPY+FAKSLE+LE+T ELPPIW  V+  +Y  AQ+IW + NC T+LDYM+ YLKLDVFLLAD+FQQFR+K+IA+N L+PLNF                  +E L DMEM+NFYEGGIRGG+TFVNKHYV + +DTE LYIDINNLYGWALSQ LP+ DF WV + LD +L+E ++  DIE L YGYT
Sbjct: 1241 NYIPHHPHLDIIHRSKVTDGTPIYLLLLEDGDNYHYTAVFDLNKLMNCHATTSCNVQISVHWCPHCLNGFRLKPAFDAHVALCSKNQTGTTLYTLPKNKYLKFTNFAKSITPPFVIYADFESILPLDIRHHQIHMPIAAGLLLINNYTNTKQYFNFIGDDCVLAFLKKIDEIALSIVLPYYEVHCQKPIGPLSFKEDREFKDCRTCYLCKKFIRDKVKDHCHFSGKYLGAACMKCNVSRRIQKQLPVVFHNLRGYDLHHILKYGLNNFSSWELNIIPTTTEKFISLIAYINKLPVRFIDSMQFINSSLAKAVKTLTDLPLTDSVFDGAIVRAKAIFPYDFAKSLEVLESTTELPPIWGSVSVDEYATAQQIWTQQNCETMLDYMLTYLKLDVFLLADYFQQFRAKAIAYNTLEPLNF------------------MEFL-DMEMFNFYEGGIRGGLTFVNKHYVASFEDTEFLYIDINNLYGWALSQYLPYADFVWVYDGLDDVLNECMNVADIEILPYGYT 1743          
BLAST of DNA_pol_B_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000053372.1 (SMESG000053372.1)

HSP 1 Score: 707.212 bits (1824), Expect = 0.000e+0
Identity = 342/534 (64.04%), Postives = 413/534 (77.34%), Query Frame = 3
Query:   12 PTVINKYENENDDFVPHHPHLDIIHRTKVTDVDPLYLLLLENDEQYHYTAVIDLQRLMNSHINDIVSVRIQCQWCPRCLNGFRLQDAFNSHYALCIKNQVGTTLYTLPQNKYLEFGDYSKTVTPPFVIYADFESILPIDIRFHQKHLPISAGLLLINNFNNTKSYFSFIGLDCVLEFLKKIEEIAATIVQPYFDLFSDSNIIPLSFNQENAFKFCLNCYLCKKPIRNRVKVYEHFSGRYLGAACSLCRNVRRNRQHLPVIFHNLRGYDLHHILKYGLSSFPSWDLNIIPTTTEKFISLIAHIDKVSVRFIDSYQFVSASLDNAVKTLSNFPLTDSVFTGSIMGCKGIFPYNFAKSLEILETTFELPPIWPEVTESQYLRAQKIWNENNCNTLLDYMMVYLKLDVFLLADFFQQFRSKSIAHNGLDPLNFYGIPGMSWASALMTLKEPIELLTDMEMYNFYEGGIRGGITFVNKHYVKTSDDTELLYIDINNLYGWALSQSLPFGDFSWVINNLDSILDERIS-TDIETLSYGYT 1610
            PTVI   +   D++V HHPHL +IHR+KVTD +P+YLLLLEN+++YHYTAV ++  LMN H N   +++I+C+WCP CLNGFRL +AFN+H ALC KNQ GTTLYTLP+NK LEF +YSK +TPPFVIYADFES+LP D R HQ H+PI+AGLLLINN+ NTKSY+ F GLDC+ +FLKKIEEIA  IV PY+D   D  I P+SF++   FK C  CYLCKKPI N V+ + HF+G YLGAAC  C   RR  + LP++FHNLRGYDLHHILKYGL  F SW+L+IIPT+TEKFISLI HI+K++VRFIDS QFV+ SL  AVKTL++ PLT SVF GSI+ CKGIFPYNFA S E+LETT+ELPPIW  V+E +Y +AQ IW + NC TL DYM++YLKLDVFLLAD+FQQFR+K+I +NGL+PLNFYGIPG                        FYEGGIRGG+TFVNKHY+  S+DTELLYIDINNLYGWALSQSLP+ DF+WV + LD +L+E  +  DIE L YGYT
Sbjct:  921 PTVI--IDEVPDNYVFHHPHLSLIHRSKVTDGNPIYLLLLENNDRYHYTAVTNINWLMNCHQNPDCNIQIRCRWCPHCLNGFRLDNAFNTHVALCAKNQTGTTLYTLPENKNLEFLNYSKHITPPFVIYADFESVLPPDDRHHQIHMPIAAGLLLINNYTNTKSYYYFYGLDCIPDFLKKIEEIATEIVIPYYDSEGDKLIGPMSFSEVRQFKSCRTCYLCKKPIVNPVRDHCHFTGNYLGAACRKCNIARRIYRLLPIVFHNLRGYDLHHILKYGLDRFLSWNLDIIPTSTEKFISLIVHINKLAVRFIDSMQFVNCSLAKAVKTLTSLPLTSSVFQGSIVDCKGIFPYNFAVSEEVLETTYELPPIWEGVSEDEYDKAQLIWTQQNCRTLRDYMLIYLKLDVFLLADYFQQFRAKAIVYNGLEPLNFYGIPGHGNVQ-------------------FYEGGIRGGLTFVNKHYIAASEDTELLYIDINNLYGWALSQSLPYADFTWVYDGLDEVLNECANVVDIEILPYGYT 1433          
BLAST of DNA_pol_B_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000040848.1 (SMESG000040848.1)

HSP 1 Score: 682.945 bits (1761), Expect = 0.000e+0
Identity = 337/533 (63.23%), Postives = 403/533 (75.61%), Query Frame = 3
Query:   12 PTVINKYENENDDFVPHHPHLDIIHRTKVTDVDPLYLLLLENDEQYHYTAVIDLQRLMNSHINDIVSVRIQCQWCPRCLNGFRLQDAFNSHYALCIKNQVGTTLYTLPQNKYLEFGDYSKTVTPPFVIYADFESILPIDIRFHQKHLPISAGLLLINNFNNTKSYFSFIGLDCVLEFLKKIEEIAATIVQPYFDLFSDSNIIPLSFNQENAFKFCLNCYLCKKPIRNRVKVYEHFSGRYLGAACSLCRNVRRNRQHLPVIFHNLRGYDLHHILKYGLSSFPSWDLNIIPTTTEKFISLIAHIDKVSVRFIDSYQFVSASLDNAVKTLSNFPLTDSVFTGSIMGCKGIFPYNFAKSLEILETTFELPPIWPEVTESQYLRAQKIWNENNCNTLLDYMMVYLKLDVFLLADFFQQFRSKSIAHNGLDPLNFYGIPGMSWASALMTLKEPIELLTDMEMYNFYEGGIRGGITFVNKHYVKTSDDTELLYIDINNLYGWALSQSLPFGDFSWVINNLDSILDERIS-TDIETLSYGY 1607
            PTVI   +   D++V HH HL +IHR+KVTD +P YLLLLEN+++YHYTAV +++RLMN H     +++I+ +WCP CLNGFRL +AFN+H ALC KNQ GTTLYTLP+NK LEF +YSK +TPPFVIYADFES+LP D R HQ H PI+AGLLLINN+ NT+SY+ F GLDC+ +FLKKIEEIA  IV PY+D   D                 L CYLCKKPI + VK + HF+G YLGAAC  C   RR  + LP++FHNLRGYDLHHILKYGL  FPSW+L+IIPT+TEKFISLI HI+K++VRFIDS QFV+ SL  AVKTL++ PLT SV+ GSI+ CK                  ELPPIW  V++ +Y RAQ IW + NC TL DYM++YLKLDVFLLAD+FQQFR+K+I +NGL+PLNFYGIPGMSWASALMTL EPIELL DMEM+NFYEGGIRGG+TFVNKHY+   +DTELLY DINNLYGWALSQSLP+ DF+WV + LD  L E  +  DIE L YGY
Sbjct:  159 PTVI--IDKVPDNYVFHHSHLSLIHRSKVTDGNPFYLLLLENNDRYHYTAVTNIERLMNCHQTPDCNIQIRYRWCPHCLNGFRLDNAFNTHVALCAKNQTGTTLYTLPENKNLEFLNYSKDITPPFVIYADFESVLPPDDRHHQIHKPIAAGLLLINNYTNTESYYYFYGLDCIPDFLKKIEEIATEIVIPYYDSEGDK----------------LTCYLCKKPIVHPVKDHCHFTGNYLGAACRKCNIARRIYRLLPIVFHNLRGYDLHHILKYGLDRFPSWNLDIIPTSTEKFISLIVHINKLAVRFIDSMQFVNCSLAKAVKTLTSLPLTSSVYQGSIVDCK------------------ELPPIWEGVSKDEYDRAQLIWTQQNCRTLRDYMLIYLKLDVFLLADYFQQFRAKAIVYNGLEPLNFYGIPGMSWASALMTLTEPIELLQDMEMFNFYEGGIRGGLTFVNKHYIAALEDTELLYKDINNLYGWALSQSLPYADFTWVYDCLDEFLSECANVVDIEILPYGY 655          
BLAST of DNA_pol_B_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000040848.1 (SMESG000040848.1)

HSP 1 Score: 682.945 bits (1761), Expect = 0.000e+0
Identity = 337/533 (63.23%), Postives = 403/533 (75.61%), Query Frame = 3
Query:   12 PTVINKYENENDDFVPHHPHLDIIHRTKVTDVDPLYLLLLENDEQYHYTAVIDLQRLMNSHINDIVSVRIQCQWCPRCLNGFRLQDAFNSHYALCIKNQVGTTLYTLPQNKYLEFGDYSKTVTPPFVIYADFESILPIDIRFHQKHLPISAGLLLINNFNNTKSYFSFIGLDCVLEFLKKIEEIAATIVQPYFDLFSDSNIIPLSFNQENAFKFCLNCYLCKKPIRNRVKVYEHFSGRYLGAACSLCRNVRRNRQHLPVIFHNLRGYDLHHILKYGLSSFPSWDLNIIPTTTEKFISLIAHIDKVSVRFIDSYQFVSASLDNAVKTLSNFPLTDSVFTGSIMGCKGIFPYNFAKSLEILETTFELPPIWPEVTESQYLRAQKIWNENNCNTLLDYMMVYLKLDVFLLADFFQQFRSKSIAHNGLDPLNFYGIPGMSWASALMTLKEPIELLTDMEMYNFYEGGIRGGITFVNKHYVKTSDDTELLYIDINNLYGWALSQSLPFGDFSWVINNLDSILDERIS-TDIETLSYGY 1607
            PTVI   +   D++V HH HL +IHR+KVTD +P YLLLLEN+++YHYTAV +++RLMN H     +++I+ +WCP CLNGFRL +AFN+H ALC KNQ GTTLYTLP+NK LEF +YSK +TPPFVIYADFES+LP D R HQ H PI+AGLLLINN+ NT+SY+ F GLDC+ +FLKKIEEIA  IV PY+D   D                 L CYLCKKPI + VK + HF+G YLGAAC  C   RR  + LP++FHNLRGYDLHHILKYGL  FPSW+L+IIPT+TEKFISLI HI+K++VRFIDS QFV+ SL  AVKTL++ PLT SV+ GSI+ CK                  ELPPIW  V++ +Y RAQ IW + NC TL DYM++YLKLDVFLLAD+FQQFR+K+I +NGL+PLNFYGIPGMSWASALMTL EPIELL DMEM+NFYEGGIRGG+TFVNKHY+   +DTELLY DINNLYGWALSQSLP+ DF+WV + LD  L E  +  DIE L YGY
Sbjct:  155 PTVI--IDKVPDNYVFHHSHLSLIHRSKVTDGNPFYLLLLENNDRYHYTAVTNIERLMNCHQTPDCNIQIRYRWCPHCLNGFRLDNAFNTHVALCAKNQTGTTLYTLPENKNLEFLNYSKDITPPFVIYADFESVLPPDDRHHQIHKPIAAGLLLINNYTNTESYYYFYGLDCIPDFLKKIEEIATEIVIPYYDSEGDK----------------LTCYLCKKPIVHPVKDHCHFTGNYLGAACRKCNIARRIYRLLPIVFHNLRGYDLHHILKYGLDRFPSWNLDIIPTSTEKFISLIVHINKLAVRFIDSMQFVNCSLAKAVKTLTSLPLTSSVYQGSIVDCK------------------ELPPIWEGVSKDEYDRAQLIWTQQNCRTLRDYMLIYLKLDVFLLADYFQQFRAKAIVYNGLEPLNFYGIPGMSWASALMTLTEPIELLQDMEMFNFYEGGIRGGLTFVNKHYIAALEDTELLYKDINNLYGWALSQSLPYADFTWVYDCLDEFLSECANVVDIEILPYGY 651          
The following BLAST results are available for this feature:
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ZC53.41.185e-3428.97pep chromosome:WBcel235:X:1925750:1937689:1 gene:W... [more]
back to top
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA_pol_B_2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA_pol_B_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DRN21.836e-7831.90DNA_pol_B_2 domain-containing protein OS=Macrostom... [more]
A0A5N3ZYJ51.703e-7731.35Uncharacterized protein (Fragment) OS=Photinus pyr... [more]
A0A5N3ZZW11.003e-7631.38Uncharacterized protein (Fragment) OS=Photinus pyr... [more]
A0A5N3ZZI51.107e-7631.38Uncharacterized protein (Fragment) OS=Photinus pyr... [more]
A0A1Y1MZZ01.448e-7631.20Uncharacterized protein OS=Photinus pyralis OX=705... [more]
back to top
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO461094.133e-6730.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO441102.592e-1224.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349779.831e-1232.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO340802.298e-1129.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO311412.631e-1123.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DNA_pol_B_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA_pol_B_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026530.10.000e+065.92SMESG000026530.1[more]
SMESG000062279.10.000e+064.75SMESG000062279.1[more]
SMESG000053372.10.000e+064.04SMESG000053372.1[more]
SMESG000040848.10.000e+063.23SMESG000040848.1[more]
SMESG000040848.10.000e+063.23SMESG000040848.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016538 ID=SMED30016538|Name=DNA_pol_B_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1610bp
CTTCCGATCTCCCAACTGTTATTAATAAGTATGAAAATGAAAATGACGAT
TTTGTTCCTCATCATCCTCATTTGGATATTATTCATCGCACTAAAGTGAC
TGACGTTGATCCTTTGTATCTTTTACTTCTCGAAAATGATGAACAATATC
ATTATACTGCTGTTATTGACTTGCAACGCCTAATGAATTCACATATTAAT
GATATAGTTAGTGTACGGATACAATGTCAATGGTGTCCTAGATGTCTTAA
TGGTTTTCGTTTGCAGGATGCTTTTAACAGTCATTATGCATTGTGTATCA
AAAATCAGGTAGGAACAACTTTATACACTCTTCCTCAAAATAAATATTTA
GAGTTTGGTGATTACTCAAAAACAGTAACTCCACCATTTGTAATTTATGC
AGACTTTGAGTCAATTTTACCGATTGACATAAGATTTCATCAGAAACATC
TACCAATATCCGCAGGACTATTATTAATTAATAACTTTAATAATACTAAA
TCGTATTTTAGTTTCATTGGTTTAGACTGCGTCTTGGAATTTTTGAAAAA
GATAGAGGAAATTGCGGCGACAATTGTACAACCTTATTTTGATCTTTTTA
GTGATTCAAACATTATTCCGCTATCATTTAATCAGGAAAATGCTTTTAAA
TTTTGCTTGAATTGTTATCTTTGTAAGAAACCCATTAGAAATCGTGTTAA
AGTTTACGAACACTTTTCAGGTCGTTATCTTGGGGCTGCTTGTAGTCTTT
GTCGTAATGTTAGAAGAAATCGTCAGCATTTACCTGTTATTTTTCATAAT
CTTAGGGGTTATGACCTTCATCACATTTTGAAGTATGGTCTTAGTAGTTT
TCCTTCTTGGGATTTGAATATCATTCCAACTACAACAGAAAAGTTTATAT
CTTTGATAGCACATATCGATAAAGTATCAGTTAGGTTCATTGATAGTTAT
CAGTTTGTTAGCGCATCATTAGACAATGCAGTTAAAACTCTTTCTAACTT
TCCTTTGACAGATTCTGTATTTACTGGTTCAATAATGGGTTGTAAAGGTA
TCTTTCCTTATAATTTTGCAAAGAGTTTGGAAATCTTGGAAACAACTTTT
GAATTACCACCAATTTGGCCTGAAGTGACAGAATCACAATATTTGAGAGC
TCAAAAGATTTGGAATGAGAATAATTGCAATACCTTGTTAGATTATATGA
TGGTATACTTGAAATTAGATGTATTTCTTCTTGCTGACTTTTTTCAACAA
TTTCGTTCAAAGAGTATTGCACATAACGGTTTAGATCCCTTAAATTTTTA
CGGTATACCTGGAATGAGTTGGGCTTCTGCTTTGATGACATTGAAAGAAC
CCATTGAACTCCTTACCGATATGGAAATGTATAATTTCTATGAAGGAGGG
ATCAGGGGTGGAATAACATTTGTGAATAAACATTATGTTAAAACTTCTGA
TGATACCGAATTGTTATATATTGATATCAACAATCTGTATGGTTGGGCTC
TTAGCCAAAGTCTTCCTTTCGGTGATTTTAGTTGGGTAATTAATAATCTT
GATTCTATTTTGGATGAGCGTATAAGTACAGATATTGAAACGCTTTCATA
TGGTTACACG
back to top

protein sequence of SMED30016538-orf-1

>SMED30016538-orf-1 ID=SMED30016538-orf-1|Name=SMED30016538-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=536bp
SDLPTVINKYENENDDFVPHHPHLDIIHRTKVTDVDPLYLLLLENDEQYH
YTAVIDLQRLMNSHINDIVSVRIQCQWCPRCLNGFRLQDAFNSHYALCIK
NQVGTTLYTLPQNKYLEFGDYSKTVTPPFVIYADFESILPIDIRFHQKHL
PISAGLLLINNFNNTKSYFSFIGLDCVLEFLKKIEEIAATIVQPYFDLFS
DSNIIPLSFNQENAFKFCLNCYLCKKPIRNRVKVYEHFSGRYLGAACSLC
RNVRRNRQHLPVIFHNLRGYDLHHILKYGLSSFPSWDLNIIPTTTEKFIS
LIAHIDKVSVRFIDSYQFVSASLDNAVKTLSNFPLTDSVFTGSIMGCKGI
FPYNFAKSLEILETTFELPPIWPEVTESQYLRAQKIWNENNCNTLLDYMM
VYLKLDVFLLADFFQQFRSKSIAHNGLDPLNFYGIPGMSWASALMTLKEP
IELLTDMEMYNFYEGGIRGGITFVNKHYVKTSDDTELLYIDINNLYGWAL
SQSLPFGDFSWVINNLDSILDERISTDIETLSYGYT
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR012337RNaseH-like_sf
IPR023211DNA_pol_palm_dom_sf
IPR004868DNA-dir_DNA_pol_B_mt/vir
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:00084083'-5' exonuclease activity
GO:0003887DNA-directed DNA polymerase activity
GO:0003677DNA binding
GO:0000166nucleotide binding
Vocabulary: biological process
TermDefinition
GO:0006260DNA replication
GO:0071897DNA biosynthetic process
GO:0090305nucleic acid phosphodiester bond hydrolysis