DDE_3 domain-containing protein

Overview
NameDDE_3 domain-containing protein
Smed IDSMED30016522
Length (bp)3025
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DDE_3 domain-containing protein (SMED30016522) t-SNE clustered cells

Violin plots show distribution of expression levels for DDE_3 domain-containing protein (SMED30016522) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DDE_3 domain-containing protein (SMED30016522) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DDE_3 domain-containing protein (SMED30016522) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of DDE_3 domain-containing protein vs. Ensembl Human
Match: CGGBP1 (CGG triplet repeat binding protein 1 [Source:HGNC Symbol;Acc:HGNC:1888])

HSP 1 Score: 43.1282 bits (100), Expect = 1.629e-7
Identity = 24/64 (37.50%), Postives = 36/64 (56.25%), Query Frame = 3
Query:  933 KRKTENSQLLSSALKNQCTITSDFEQMSAAKQSRLKVVTDFITMCTKGNVPLEK*DDT*VRQFL 1124
            KRK E  +   +  K Q  +T+  +  S A+  ++ V+ DF+ MC + N+PLEK D   VR FL
Sbjct:   69 KRKAEFEE--QNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFL 130          

HSP 2 Score: 33.8834 bits (76), Expect = 1.629e-7
Identity = 13/27 (48.15%), Postives = 17/27 (62.96%), Query Frame = 2
Query:  830 ESGDIHFCTTCNKSIDHTRRQTISDHF 910
            E G   FCT+CN  ++H R+  ISDH 
Sbjct:   36 EDGGKLFCTSCNVVLNHVRKSAISDHL 62          
BLAST of DDE_3 domain-containing protein vs. Ensembl Human
Match: CGGBP1 (CGG triplet repeat binding protein 1 [Source:HGNC Symbol;Acc:HGNC:1888])

HSP 1 Score: 43.1282 bits (100), Expect = 1.629e-7
Identity = 24/64 (37.50%), Postives = 36/64 (56.25%), Query Frame = 3
Query:  933 KRKTENSQLLSSALKNQCTITSDFEQMSAAKQSRLKVVTDFITMCTKGNVPLEK*DDT*VRQFL 1124
            KRK E  +   +  K Q  +T+  +  S A+  ++ V+ DF+ MC + N+PLEK D   VR FL
Sbjct:   69 KRKAEFEE--QNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFL 130          

HSP 2 Score: 33.8834 bits (76), Expect = 1.629e-7
Identity = 13/27 (48.15%), Postives = 17/27 (62.96%), Query Frame = 2
Query:  830 ESGDIHFCTTCNKSIDHTRRQTISDHF 910
            E G   FCT+CN  ++H R+  ISDH 
Sbjct:   36 EDGGKLFCTSCNVVLNHVRKSAISDHL 62          
BLAST of DDE_3 domain-containing protein vs. Ensembl Human
Match: CGGBP1 (CGG triplet repeat binding protein 1 [Source:HGNC Symbol;Acc:HGNC:1888])

HSP 1 Score: 43.1282 bits (100), Expect = 1.629e-7
Identity = 24/64 (37.50%), Postives = 36/64 (56.25%), Query Frame = 3
Query:  933 KRKTENSQLLSSALKNQCTITSDFEQMSAAKQSRLKVVTDFITMCTKGNVPLEK*DDT*VRQFL 1124
            KRK E  +   +  K Q  +T+  +  S A+  ++ V+ DF+ MC + N+PLEK D   VR FL
Sbjct:   69 KRKAEFEE--QNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFL 130          

HSP 2 Score: 33.8834 bits (76), Expect = 1.629e-7
Identity = 13/27 (48.15%), Postives = 17/27 (62.96%), Query Frame = 2
Query:  830 ESGDIHFCTTCNKSIDHTRRQTISDHF 910
            E G   FCT+CN  ++H R+  ISDH 
Sbjct:   36 EDGGKLFCTSCNVVLNHVRKSAISDHL 62          
BLAST of DDE_3 domain-containing protein vs. Ensembl Human
Match: CGGBP1 (CGG triplet repeat binding protein 1 [Source:HGNC Symbol;Acc:HGNC:1888])

HSP 1 Score: 43.1282 bits (100), Expect = 1.629e-7
Identity = 24/64 (37.50%), Postives = 36/64 (56.25%), Query Frame = 3
Query:  933 KRKTENSQLLSSALKNQCTITSDFEQMSAAKQSRLKVVTDFITMCTKGNVPLEK*DDT*VRQFL 1124
            KRK E  +   +  K Q  +T+  +  S A+  ++ V+ DF+ MC + N+PLEK D   VR FL
Sbjct:   69 KRKAEFEE--QNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFL 130          

HSP 2 Score: 33.8834 bits (76), Expect = 1.629e-7
Identity = 13/27 (48.15%), Postives = 17/27 (62.96%), Query Frame = 2
Query:  830 ESGDIHFCTTCNKSIDHTRRQTISDHF 910
            E G   FCT+CN  ++H R+  ISDH 
Sbjct:   36 EDGGKLFCTSCNVVLNHVRKSAISDHL 62          
BLAST of DDE_3 domain-containing protein vs. Ensembl Mouse
Match: Cggbp1 (CGG triplet repeat binding protein 1 [Source:MGI Symbol;Acc:MGI:2146370])

HSP 1 Score: 42.743 bits (99), Expect = 1.603e-7
Identity = 24/64 (37.50%), Postives = 35/64 (54.69%), Query Frame = 3
Query:  933 KRKTENSQLLSSALKNQCTITSDFEQMSAAKQSRLKVVTDFITMCTKGNVPLEK*DDT*VRQFL 1124
            KRK E  +   +  K Q  +T+  +  S A+  +  V+ DF+ MC + N+PLEK D   VR FL
Sbjct:   69 KRKAEFEE--QNVRKKQRPLTASLQCNSPAQTEKASVIQDFVKMCLEANIPLEKADHPAVRAFL 130          

HSP 2 Score: 33.8834 bits (76), Expect = 1.603e-7
Identity = 13/27 (48.15%), Postives = 17/27 (62.96%), Query Frame = 2
Query:  830 ESGDIHFCTTCNKSIDHTRRQTISDHF 910
            E G   FCT+CN  ++H R+  ISDH 
Sbjct:   36 EDGGKLFCTSCNVVLNHVRKSAISDHL 62          
BLAST of DDE_3 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9UFW8|CGBP1_HUMAN (CGG triplet repeat-binding protein 1 OS=Homo sapiens OX=9606 GN=CGGBP1 PE=1 SV=2)

HSP 1 Score: 43.1282 bits (100), Expect = 7.252e-7
Identity = 24/64 (37.50%), Postives = 36/64 (56.25%), Query Frame = 3
Query:  933 KRKTENSQLLSSALKNQCTITSDFEQMSAAKQSRLKVVTDFITMCTKGNVPLEK*DDT*VRQFL 1124
            KRK E  +   +  K Q  +T+  +  S A+  ++ V+ DF+ MC + N+PLEK D   VR FL
Sbjct:   69 KRKAEFEE--QNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFL 130          

HSP 2 Score: 33.8834 bits (76), Expect = 7.252e-7
Identity = 13/27 (48.15%), Postives = 17/27 (62.96%), Query Frame = 2
Query:  830 ESGDIHFCTTCNKSIDHTRRQTISDHF 910
            E G   FCT+CN  ++H R+  ISDH 
Sbjct:   36 EDGGKLFCTSCNVVLNHVRKSAISDHL 62          
BLAST of DDE_3 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8BHG9|CGBP1_MOUSE (CGG triplet repeat-binding protein 1 OS=Mus musculus OX=10090 GN=Cggbp1 PE=1 SV=1)

HSP 1 Score: 42.743 bits (99), Expect = 9.865e-7
Identity = 24/64 (37.50%), Postives = 35/64 (54.69%), Query Frame = 3
Query:  933 KRKTENSQLLSSALKNQCTITSDFEQMSAAKQSRLKVVTDFITMCTKGNVPLEK*DDT*VRQFL 1124
            KRK E  +   +  K Q  +T+  +  S A+  +  V+ DF+ MC + N+PLEK D   VR FL
Sbjct:   69 KRKAEFEE--QNVRKKQRPLTASLQCNSPAQTEKASVIQDFVKMCLEANIPLEKADHPAVRAFL 130          

HSP 2 Score: 33.8834 bits (76), Expect = 9.865e-7
Identity = 13/27 (48.15%), Postives = 17/27 (62.96%), Query Frame = 2
Query:  830 ESGDIHFCTTCNKSIDHTRRQTISDHF 910
            E G   FCT+CN  ++H R+  ISDH 
Sbjct:   36 EDGGKLFCTSCNVVLNHVRKSAISDHL 62          
BLAST of DDE_3 domain-containing protein vs. TrEMBL
Match: A0A177B8B4 (DDE_3 domain-containing protein OS=Intoshia linei OX=1819745 GN=A3Q56_02603 PE=4 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 1.431e-23
Identity = 63/143 (44.06%), Postives = 94/143 (65.73%), Query Frame = 1
Query:    1 CRITLKELSAAFEEKFHLSISKTTISKHLDTLYYSLKYLRYEPEKGNSFENKQKREELVECLLEFKSQNKPILFTEETILNIHISRTQGRPLKGRRCAIIAAGSKSANVYVIG*ISKVGFIYYEINRGSFKKEIVCDFL--CL 423
            C+++L+E+  A   KF+LSISK  +S HL+ L Y+LK +R+EPE  N+  NK+ R   +  LLE +S+N  ++F +ET  N+HIS  +GR  +G RC  IAAGS+ AN++ IG    V  ++ EI RGSF+KE   +++  CL
Sbjct:   69 CKVSLQEIVDAIHFKFNLSISKVAVSHHLNNLLYTLKTIRHEPENANNGVNKESRNFTLR-LLELQSENANMVFMDETNFNLHISTRKGRSQRGERCTSIAAGSRGANIHCIG---NVELVHDEIKRGSFRKESAQEWMKNCL 207          
BLAST of DDE_3 domain-containing protein vs. TrEMBL
Match: A0A2D4BNB7 (DDE_3 domain-containing protein OS=Pythium insidiosum OX=114742 GN=PINS_003680 PE=4 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.684e-18
Identity = 51/138 (36.96%), Postives = 80/138 (57.97%), Query Frame = 1
Query:    4 RITLKELSAAFEEKFHLSISKTTISKHLDTLYYSLKYLRYEPEKGNSFENKQKREELVECLLEFKSQNKPILFTEETILNIHISRTQGRPLKGRRCAIIAAGSKSANVYVIG*ISKVGFIYYEINRGSFKKEIVCDFL 417
            ++TL+ L+    ++F +++S +T+++ LD   Y LK    +P+  N+ ENK+KR E +  LLE+KS    + + +ET LN+ I+RTQGR  KG  C  I   S   N++VI  +S  G  YYE   GS +   V +F 
Sbjct:   87 KLTLQNLADTLRDEFDVAVSVSTVARELDGACYMLKKTHVQPQYMNTDENKRKRAEFLADLLEYKSHGYTVFYVDETNLNMWITRTQGRSKKGEWCVDIKVASGGRNMHVIAFVSSGGLTYYENRFGSNRAPDVNEFF 224          
BLAST of DDE_3 domain-containing protein vs. TrEMBL
Match: A0A0K0EC41 (DDE_3 domain-containing protein OS=Strongyloides stercoralis OX=6248 PE=4 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 7.111e-18
Identity = 55/146 (37.67%), Postives = 80/146 (54.79%), Query Frame = 1
Query:    4 RITLKELSAAFEEKFHLSISKTTISKHLDTLYYSLKYLRYEPEKGNSFENKQKREELVECLLEFKSQNKPILFTEETILNIHISRTQGRPLKGRRCAIIAAGSKSANVYVIG*ISKVGFIYYEINRGSFKKEIVCDFL--CLANVK 435
            RITLKE+    E    LS                      EPE  NS +NK KR    + L+ +++ N PI++ +ET  N+ ISR++GR  KG RC  ++AG K ANV++IG I  +G I++EI +G+FKK    DF+  CL + +
Sbjct:   46 RITLKEIKENLEHSHQLS----------------------EPENANSEQNKIKRRCFAQQLMIYQADNMPIIYLDETNFNLFISRSKGRSKKGTRCTHVSAGCKGANVHLIGCIGNMGLIHHEIRKGAFKKPEAMDFVRQCLRSAR 169          
BLAST of DDE_3 domain-containing protein vs. TrEMBL
Match: A0A177B584 (Uncharacterized protein (Fragment) OS=Intoshia linei OX=1819745 GN=A3Q56_02794 PE=4 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 2.573e-16
Identity = 51/128 (39.84%), Postives = 72/128 (56.25%), Query Frame = 1
Query:   43 KFHLSISKTTISKHLDTLYYSLKYLRYEPEKGNSFENKQKREELVECLLEFKSQNKPILFTEETILNIHISRTQGRPLKGRRCAIIAAGSKSANVYVIG*ISKVGFIYYEINRGSFKKEIVCDFLCLA 426
            KF+LS+SK  +S +L+ L Y+LK +R+EPE  N+  NK+KR                  FT          R QGR  +G RC  IAAGS+SAN++ IG    V  I+YEI RGSF+K+   +++ +A
Sbjct:   24 KFNLSVSKVAVSHYLNNLLYTLKTIRHEPENANNAVNKKKRRN----------------FT---------LRRQGRSQRGERCTSIAAGSRSANIHCIG---NVELIHYEIKRGSFRKKSSQEWIKIA 123          
BLAST of DDE_3 domain-containing protein vs. TrEMBL
Match: A0A0W8CEH5 (Replication protein A 70 kDa DNA-binding subunit OS=Phytophthora nicotianae OX=4790 GN=AM588_10000399 PE=4 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 3.053e-16
Identity = 51/139 (36.69%), Postives = 75/139 (53.96%), Query Frame = 1
Query:    1 CRITLKELSAAFEEKFHLSISKTTISKHLDTLYYSLKYLRYEPEKGNSFENKQKREELVECLLEFKSQNKPILFTEETILNIHISRTQGRPLKGRRCAIIAAGSKSANVYVIG*ISKVGFIYYEINRGSFKKEIVCDFL 417
            C +TL E+  A E +F + +   T+ +H+D   Y++K    +    N   NKQ R++ V  LL +KSQ K I + +ET  N+  SR +GR LKG+R       SK +N++VI  IS  G  Y E   GSF  +   DF+
Sbjct:   80 CYLTLVEMVDALEARFGVRVIHQTVKRHVDARMYTMKQTHRDNNYRNLPHNKQLRQDYVIKLLSYKSQGKKIFYVDETNFNLWCSRRRGRSLKGKRAVDRNTASKGSNIHVIACISDDGIAYVEKRFGSFTADRCNDFI 218          
BLAST of DDE_3 domain-containing protein vs. Planmine SMEST
Match: SMESG000003593.1 (SMESG000003593.1)

HSP 1 Score: 328.561 bits (841), Expect = 1.150e-104
Identity = 161/181 (88.95%), Postives = 166/181 (91.71%), Query Frame = 3
Query: 2382 EKWLLRCFEAG---F*SAFQNRTRIVSVDGKFVTFIHSKFPGGFSDSSPCNKQDNFSILDGILDENLKKLYLLDVIRYGEHMLHDHSFTDRCQYLEEKVFSAISSTDALEFEICIIPSLPCNKFVLSSLVNAGSESLMDGMVVYRKGDTYTSGRSNSVTWVPIERIADLLSACDWRDYSTN 2915
            + +L++C   G      +  NRTRIVSVDGKFVTFIHSKFPGGFSDSSPCNKQDNFSILDGILDENLKKLYLLDVIRYGEHMLHDHSFTDRCQYLEEKVFSAISSTDA EFEICIIPSLPCNKFVLSSLVNAGSESLMDGMVVY K DTYTSGRSNSVTWVPIERIADLLSACDWRDYSTN
Sbjct:  106 DDYLIKCCPVGKRVILVSQHNRTRIVSVDGKFVTFIHSKFPGGFSDSSPCNKQDNFSILDGILDENLKKLYLLDVIRYGEHMLHDHSFTDRCQYLEEKVFSAISSTDASEFEICIIPSLPCNKFVLSSLVNAGSESLMDGMVVYSKCDTYTSGRSNSVTWVPIERIADLLSACDWRDYSTN 286          
BLAST of DDE_3 domain-containing protein vs. Planmine SMEST
Match: SMESG000026481.1 (SMESG000026481.1)

HSP 1 Score: 50.8322 bits (120), Expect = 6.031e-6
Identity = 36/143 (25.17%), Postives = 69/143 (48.25%), Query Frame = 1
Query:    1 CRITLKELSAAFEEKFHLSISKTTISKHLDTLYYSLKYLRYEPEKGNSFENKQKREELVECLLEFKS--QNKPILFTEETILNIHISRTQGRPLKGRRCAIIAAGSKSANVYVIG*ISKVGFIYYEINRGSFKKEIVCDFLCL 423
            C +TLK++ +  E +  + +S++TI++ +    YS+K +   P K N+ E  + R +     +E  S   +  I F +E   N+ I   +GR LK +R     +  ++ N+ V   ++K G   Y     S+  +   +F+ L
Sbjct:  484 CALTLKQIKSKIELERGVVVSQSTINRCIGGFGYSMKRINIMPIKRNTVEVIELRAQYANRFMELLSTIDDSKIFFIDEVGFNVSIRSRRGRSLKNKRAVQNVSSIRARNISVCCAMNKEGIFKYFTQTKSYNTQSFLEFIRL 626          
The following BLAST results are available for this feature:
BLAST of DDE_3 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CGGBP11.629e-737.50CGG triplet repeat binding protein 1 [Source:HGNC ... [more]
CGGBP11.629e-737.50CGG triplet repeat binding protein 1 [Source:HGNC ... [more]
CGGBP11.629e-737.50CGG triplet repeat binding protein 1 [Source:HGNC ... [more]
CGGBP11.629e-737.50CGG triplet repeat binding protein 1 [Source:HGNC ... [more]
back to top
BLAST of DDE_3 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_3 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_3 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_3 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_3 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Cggbp11.603e-737.50CGG triplet repeat binding protein 1 [Source:MGI S... [more]
back to top
BLAST of DDE_3 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q9UFW8|CGBP1_HUMAN7.252e-737.50CGG triplet repeat-binding protein 1 OS=Homo sapie... [more]
sp|Q8BHG9|CGBP1_MOUSE9.865e-737.50CGG triplet repeat-binding protein 1 OS=Mus muscul... [more]
back to top
BLAST of DDE_3 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A177B8B41.431e-2344.06DDE_3 domain-containing protein OS=Intoshia linei ... [more]
A0A2D4BNB71.684e-1836.96DDE_3 domain-containing protein OS=Pythium insidio... [more]
A0A0K0EC417.111e-1837.67DDE_3 domain-containing protein OS=Strongyloides s... [more]
A0A177B5842.573e-1639.84Uncharacterized protein (Fragment) OS=Intoshia lin... [more]
A0A0W8CEH53.053e-1636.69Replication protein A 70 kDa DNA-binding subunit O... [more]
back to top
BLAST of DDE_3 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_3 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_3 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_3 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_3 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_3 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000003593.11.150e-10488.95SMESG000003593.1[more]
SMESG000026481.16.031e-625.17SMESG000026481.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016522 ID=SMED30016522|Name=DDE_3 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3025bp
TGTCGTATTACATTAAAAGAACTCAGTGCAGCATTTGAAGAAAAATTTCA
CTTGAGTATTTCTAAAACAACAATTTCAAAACATTTAGATACTCTCTATT
ATTCGCTAAAATATTTAAGATATGAACCTGAAAAGGGAAACTCCTTTGAA
AACAAACAAAAGAGAGAGGAGCTTGTGGAATGTCTTTTGGAATTTAAGTC
CCAAAATAAACCTATTTTGTTTACAGAGGAAACAATTTTAAACATTCATA
TTTCAAGAACACAGGGCAGACCATTGAAGGGAAGAAGATGCGCCATTATA
GCAGCTGGTTCAAAAAGTGCTAATGTTTATGTAATAGGCTGAATAAGTAA
GGTTGGATTTATTTATTATGAAATAAATAGAGGTTCTTTCAAGAAAGAAA
TTGTGTGTGATTTCCTTTGTCTTGCAAATGTTAAACGAAATATCGATGTT
ATGCGCTAACTTCAACTCATGTCATTTACTATAAATGGGTAGTAAACAAC
TGCGTATTACTGTCACCATAGGAGAGGCCGGACATAGTACTTCCTCGTAC
GATCCATGTCACACACATGCAAACTTCTTCCAGCGCTATGCCATATTCAG
TATACAAATTTCGAAATAGTTTTGAGGAAGTGATAGTGTTGTAAAATATG
AAAAATGTCGCCTATACCTGCATCCGCACTTTCACTTGCATTTTTCATAC
CACGCAATCGAGAATAATGAATGTTCTGTCATTAGCTACAATGATTATTT
TCTCACTGAGTGATTTTCAGATACTCGTACAACATGCCTAGACCTGACAA
GACCAAGATTACAGCGTCAGACCGCGCCAGAGAGTGGTGATATTCATTTT
TGTACTACCTGTAACAAGTCAATAGATCACACTCGCCGACAGACCATTTC
TGATCATTTTAATTGTACAAACAGCTAGATAAAAAAGAAAAACAGAAAAT
AGCCAATTATTATCTTCAGCTCTTAAGAACCAATGCACAATCACTTCGGA
TTTTGAACAAATGTCTGCCGCTAAACAAAGCCGTTTGAAGGTTGTTACTG
ATTTCATCACTATGTGCACTAAAGGAAATGTTCCTTTGGAAAAATGAGAT
GATACCTAAGTTCGTCAATTTCTTCTCATCCAGCACCACTCGCAATTTAT
CCACTAGTATTTTTCGTTAATTGATTTGTAACGCCAAAAAAAGACGGATC
ACTAAAGGCTGTTTACGAACTTCTCAACACGGATACTATGGTCCAACGTG
TTTCTTATGCCACTGAAAATTGCAATCAACTCATGGTTTTGTTAGACAGG
TAACAATCACGTTAATTGCAAATTCAGACTGTTTTCAGTGATCGGCAAGT
TTTGGTAGTCTATTTAGAACATCTAGCTGACACAAGTGACGAATTATGCC
GAGAGGGACCATAGTCTGCGGCTTCAAAACTGGATGGCTACACAAAAGTT
CAACAGCAGCCCGCTATTTACCTTCTGCAGTATATTTGAGAATTGGATCA
CTATCAACTGCCTTCTTTAAATGTCCTGTAGTCGTATCAAATTATACTTA
TATTTGAATGACGTGTGTGACACGGAAATGCCAATTTATCTTGGTTTCAC
CAGTGGCTTTAATGTCACCAATAGTGGTAAGCTAATTGAATTCTGGATAT
TCAGTATCCAATCGTGTGCCAAACTTGGCATCCAAAGCTCTGCTTCTTCA
ACTACCTATCAATAGTGTAGATTTTGAAAGAACATTCGCTCAATCAACTA
TTCAGTGACCAACGTTAAAGACTTAAAGAAGAAAATTTCATGGGTCTATT
GAAAATTAAAAAATAAATTTAATAAAATCTAGCTTTGCTACATAATTGGA
ATGTGTTTATTATACGCTGTTTGCAAGGACAAAACTGTCTAATTTTAATC
GGAGAAAAACGCGGAATGTGTTGAAATTTTATTGCGGAAAAAGCGATGTG
TTACTGCAGAAATCTAGAATTTTTAGTGCGGCAAACTAGTGTCCCTGTTG
GTAACGAATGGAATAACTAAATATTGTGAAAATTCAGTTAATTTTAAGCA
TCAACCATTTTAAGGATTATTTAGGTTTTCAGTAATTTAAAAATTTCGAT
TTTTTGGATTTATTTCTTAAAAATGTAAGTCAGTTTAATTTTAAACCAAA
ATATGCAGGGTGAACCAAACAAAATAAGACAATATGAATAATTATGAATA
ACAAAATGTATAATTATAATATGGTAATATATAGAGTTGTTATTATTCAT
CTGAACTGTTCCGCATTTTGAAAGTTTGTGTTAAATTTTTACTGTGTGCT
GTGTTTGTTTACTAATAATAACAATTCCACACAAATGCTGTTTATTGACA
TTTTGTCGGGCCCATGATAAATAAGTCAGTTGAAAAGTGGCTATTACGGT
GCTTTGAAGCTGGATTCTAATCTGCTTTCCAGAATAGGACGAGGATTGTC
AGTGTCGATGGGAAGTTTGTCACGTTTATCCACAGTAAATTTCCCGGAGG
ATTCTCTGATTCCAGTCCATGCAATAAGCAGGATAACTTCTCGATTCTCG
ATGGGATTCTTGATGAGAATTTGAAGAAATTATATTTGCTAGACGTAATT
CGGTATGGGGAGCACATGCTGCATGACCATTCGTTTACTGATCGCTGCCA
ATACCTTGAGGAAAAGGTTTTCTCTGCAATCTCGTCTACTGATGCTTTGG
AATTTGAGATTTGCATCATTCCGTCTTTGCCTTGTAATAAATTTGTTCTT
TCCTCCCTCGTTAACGCTGGTTCCGAATCATTGATGGACGGAATGGTCGT
CTACAGGAAAGGTGATACTTATACTAGCGGCAGATCCAATTCTGTCACTT
GGGTGCCGATTGAGCGCATTGCGGATTTATTATCGGCCTGTGATTGGCGG
GATTATTCCACCAATTGAATTTGAGCGGATTTTGACTCACAGTGAATAAA
TAGTTTTGCGTTTTTATTTTTAATGATATGTAATAAATTAAATTCAATAA
AAATAAACTGTCGGAGTTACACAGA
back to top

protein sequence of SMED30016522-orf-1

>SMED30016522-orf-1 ID=SMED30016522-orf-1|Name=SMED30016522-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=101bp
MLHDHSFTDRCQYLEEKVFSAISSTDALEFEICIIPSLPCNKFVLSSLVN
AGSESLMDGMVVYRKGDTYTSGRSNSVTWVPIERIADLLSACDWRDYSTN
*
back to top

protein sequence of SMED30016522-orf-2

>SMED30016522-orf-2 ID=SMED30016522-orf-2|Name=SMED30016522-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=114bp
CRITLKELSAAFEEKFHLSISKTTISKHLDTLYYSLKYLRYEPEKGNSFE
NKQKREELVECLLEFKSQNKPILFTEETILNIHISRTQGRPLKGRRCAII
AAGSKSANVYVIG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000101muscle cell
PLANA:0000231vitelline gland
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR009057Homeobox-like_sf
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding