Protein diaphanous homolog 2

Overview
NameProtein diaphanous homolog 2
Smed IDSMED30016516
Length (bp)3454
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein diaphanous homolog 2 (SMED30016516) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein diaphanous homolog 2 (SMED30016516) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein diaphanous homolog 2 (SMED30016516) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein diaphanous homolog 2 (SMED30016516) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016516

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30016516SMESG000057806.1 dd_Smed_v4_2533_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30016516SMESG000057806.1 dd_Smed_v4_2533_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30016516SMESG000057806.1 dd_Smed_v4_2533_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30016516SMESG000057806.1 dd_Smed_v4_2533_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
posterior region of the whole animalSMED30016516SMESG000057806.1 dd_Smed_v4_2533_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30016516SMESG000057806.1 dd_Smed_v4_2533_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30016516SMESG000057806.1 dd_Smed_v4_2533_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30016516SMESG000057806.1 dd_Smed_v4_2533_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein diaphanous homolog 2 vs. Ensembl Human
Match: DIAPH2 (diaphanous related formin 2 [Source:HGNC Symbol;Acc:HGNC:2877])

HSP 1 Score: 293.893 bits (751), Expect = 1.654e-82
Identity = 177/472 (37.50%), Postives = 279/472 (59.11%), Query Frame = 1
Query: 1924 YGLK-RNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIPT-DILKELENNFSXXXXXXXXXXXXXXXXXXP--------KILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSF-KGSAENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFN--------XXXXXXXXXXXXXXXXXXRREKEKQMPVMSKTTSEEDSGVIDNLLAVLKSGDGALSPKRRKPKSKDARR-QLNRSRSR 3279
            YG+K + +Y+PE  MK+ NW+KI    LSEN  WL +KE+     D+  +L  NF+T++ V K           P        +ILD KTAQN+SI LGS RM YE ++  ILE++  +L++++I+ L+K+LPE + + ++AEL + Y DL E EQF   +S++K L+PRL SILF+L F++ IN +K        A  E+ KSE   ++LE+VL +GNYMNSGSRN QS+GF++NFLCK+  TK      +L+HF+A+I      +  +  ++L +++ A++++     S L  ++  +  +E  +K F +   ++D+F EKMT F  T +EQ     T    M + ++++  YF F+S T  IEE F D+  F+T F+EA + N        + ++    +    +   ER++K+KQ+  ++K   E  +GV+DNLL  L+SG      ++R P++ D RR  L RSRSR
Sbjct:  624 YGMKQKKMYKPEVSMKRINWSKIEPTELSENCFWLRVKEDKFENPDLFAKLALNFATQIKVQKNAEALEEKKTGPTKKKVKELRILDPKTAQNLSIFLGSYRMPYEDIRNVILEVNEDMLSEALIQNLVKHLPEQKILNELAELKNEYDDLCEPEQFGVVMSSVKMLQPRLSSILFKLTFEEHINNIKPSIIAVTLACEELKKSESFNRLLELVLLVGNYMNSGSRNAQSLGFKINFLCKIRDTKSADQKTTLLHFIADICEEKYRDILKFPEELEHVESASKVSAQILKSNLASMEQQIVHLERDIKKFPQAENQHDKFVEKMTSFTKTAREQYEKLSTMHNNMMKLYENLGEYFIFDSKTVSIEEFFGDLNNFRTLFLEAVRENNKRREMEEKTRRAKLAKEKAEQEKLERQKKKKQLIDINKEGDE--TGVMDNLLEALQSGAAFRDRRKRIPRNPDNRRVPLERSRSR 1093          

HSP 2 Score: 124.405 bits (311), Expect = 5.117e-28
Identity = 112/408 (27.45%), Postives = 203/408 (49.75%), Query Frame = 1
Query:  193 SLSENEINDKFEKLLDDMNIPIDKRSVIREKTQEQKLVMLKSCITSQIKPVTY-------------YVELLKQIISEKLSESKICENLDQIRICLNSNPVSWIKEFDNKTNDGXXXXXXXXXXXXXXAD----SSIVCLKCFRAFANCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILTILTFFDYKSYQNVMD----ALFRAAKLNNYENRFVPLIESAKKNAQMENENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQVFDELLCNPNLKLTHEQINQFLXXXXXXXXXXXXXXXTIIRAFGDASDIFRIINRSVSNTKCEVNFRSILANLLIIRED-PIRDDLFRFIDEIVQEIILQDDSGFCPDPTLKKFDKINLKKFYDG 1350
            +LSE E+ D FEK+++DMN+  +K++ +R K    K  M+   I++  K                 YV  L+  IS++    K+   L+ +R+ L SNPVSW+  F ++    L   L  L    +  +    +    ++C +AF N  +GL +++  + + L +AR + P+  ++M    EI+ IL+       +N++D    A+  AA+ NN E RF P++E  +    ++     L +A ++FIN +++ P+       + D  +R+HLR EF+ +GL  +  +L    N +L   Q+  F    E++  E++ +   I     D ++++ ++   + +T  E  F SIL + L+IR D  IR   ++ I+E V +I+L   SG  PD   ++   I+L    D 
Sbjct:  100 NLSEKEVLDLFEKMMEDMNLNEEKKAPLRNKDFTTKREMVVQYISATAKSGGLKNSKHECTLSSQEYVHELRSGISDE----KLLNCLESLRVSLTSNPVSWVNNFGHEGLGLLLDELEKLLDKKQQENIDKKNQYKLIQCLKAFMNNKFGLQRILGDERSLLLLARAIDPKQPNMM---TEIVKILSAICIVGEENILDKLLGAITTAAERNNRE-RFSPIVEGLENQEALQ-----LQVACMQFINALVTSPY-------ELD--FRIHLRNEFLRSGLKTMLPDLKEKENDELDI-QLKVFDENKEDDLTELSHRLNDIRAEMDDMNEVYHLLYNMLKDTAAENYFLSILQHFLLIRNDYYIRPQYYKIIEECVSQIVLH-CSGMDPDFKYRQRLDIDLTHLIDS 483          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Human
Match: DIAPH2 (diaphanous related formin 2 [Source:HGNC Symbol;Acc:HGNC:2877])

HSP 1 Score: 293.508 bits (750), Expect = 2.716e-82
Identity = 177/472 (37.50%), Postives = 279/472 (59.11%), Query Frame = 1
Query: 1924 YGLK-RNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIPT-DILKELENNFSXXXXXXXXXXXXXXXXXXP--------KILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSF-KGSAENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFN--------XXXXXXXXXXXXXXXXXXRREKEKQMPVMSKTTSEEDSGVIDNLLAVLKSGDGALSPKRRKPKSKDARR-QLNRSRSR 3279
            YG+K + +Y+PE  MK+ NW+KI    LSEN  WL +KE+     D+  +L  NF+T++ V K           P        +ILD KTAQN+SI LGS RM YE ++  ILE++  +L++++I+ L+K+LPE + + ++AEL + Y DL E EQF   +S++K L+PRL SILF+L F++ IN +K        A  E+ KSE   ++LE+VL +GNYMNSGSRN QS+GF++NFLCK+  TK      +L+HF+A+I      +  +  ++L +++ A++++     S L  ++  +  +E  +K F +   ++D+F EKMT F  T +EQ     T    M + ++++  YF F+S T  IEE F D+  F+T F+EA + N        + ++    +    +   ER++K+KQ+  ++K   E  +GV+DNLL  L+SG      ++R P++ D RR  L RSRSR
Sbjct:  624 YGMKQKKMYKPEVSMKRINWSKIEPTELSENCFWLRVKEDKFENPDLFAKLALNFATQIKVQKNAEALEEKKTGPTKKKVKELRILDPKTAQNLSIFLGSYRMPYEDIRNVILEVNEDMLSEALIQNLVKHLPEQKILNELAELKNEYDDLCEPEQFGVVMSSVKMLQPRLSSILFKLTFEEHINNIKPSIIAVTLACEELKKSESFNRLLELVLLVGNYMNSGSRNAQSLGFKINFLCKIRDTKSADQKTTLLHFIADICEEKYRDILKFPEELEHVESASKVSAQILKSNLASMEQQIVHLERDIKKFPQAENQHDKFVEKMTIFTKTAREQYEKLSTMHNNMMKLYENLGEYFIFDSKTVSIEEFFGDLNNFRTLFLEAVRENNKRREMEEKTRRAKLAKEKAEQEKLERQKKKKQLIDINKEGDE--TGVMDNLLEALQSGAAFRDRRKRIPRNPDNRRVPLERSRSR 1093          

HSP 2 Score: 124.405 bits (311), Expect = 5.117e-28
Identity = 112/408 (27.45%), Postives = 203/408 (49.75%), Query Frame = 1
Query:  193 SLSENEINDKFEKLLDDMNIPIDKRSVIREKTQEQKLVMLKSCITSQIKPVTY-------------YVELLKQIISEKLSESKICENLDQIRICLNSNPVSWIKEFDNKTNDGXXXXXXXXXXXXXXAD----SSIVCLKCFRAFANCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILTILTFFDYKSYQNVMD----ALFRAAKLNNYENRFVPLIESAKKNAQMENENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQVFDELLCNPNLKLTHEQINQFLXXXXXXXXXXXXXXXTIIRAFGDASDIFRIINRSVSNTKCEVNFRSILANLLIIRED-PIRDDLFRFIDEIVQEIILQDDSGFCPDPTLKKFDKINLKKFYDG 1350
            +LSE E+ D FEK+++DMN+  +K++ +R K    K  M+   I++  K                 YV  L+  IS++    K+   L+ +R+ L SNPVSW+  F ++    L   L  L    +  +    +    ++C +AF N  +GL +++  + + L +AR + P+  ++M    EI+ IL+       +N++D    A+  AA+ NN E RF P++E  +    ++     L +A ++FIN +++ P+       + D  +R+HLR EF+ +GL  +  +L    N +L   Q+  F    E++  E++ +   I     D ++++ ++   + +T  E  F SIL + L+IR D  IR   ++ I+E V +I+L   SG  PD   ++   I+L    D 
Sbjct:  100 NLSEKEVLDLFEKMMEDMNLNEEKKAPLRNKDFTTKREMVVQYISATAKSGGLKNSKHECTLSSQEYVHELRSGISDE----KLLNCLESLRVSLTSNPVSWVNNFGHEGLGLLLDELEKLLDKKQQENIDKKNQYKLIQCLKAFMNNKFGLQRILGDERSLLLLARAIDPKQPNMM---TEIVKILSAICIVGEENILDKLLGAITTAAERNNRE-RFSPIVEGLENQEALQ-----LQVACMQFINALVTSPY-------ELD--FRIHLRNEFLRSGLKTMLPDLKEKENDELDI-QLKVFDENKEDDLTELSHRLNDIRAEMDDMNEVYHLLYNMLKDTAAENYFLSILQHFLLIRNDYYIRPQYYKIIEECVSQIVLH-CSGMDPDFKYRQRLDIDLTHLIDS 483          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Human
Match: DIAPH2 (diaphanous related formin 2 [Source:HGNC Symbol;Acc:HGNC:2877])

HSP 1 Score: 283.108 bits (723), Expect = 9.026e-79
Identity = 168/458 (36.68%), Postives = 270/458 (58.95%), Query Frame = 1
Query: 1924 YGLK-RNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIPT-DILKELENNFSXXXXXXXXXXXXXXXXXXP--------KILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSF-KGSAENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFN--------XXXXXXXXXXXXXXXXXXRREKEKQMPVMSKTTSEEDSGVIDNLLAVLKSGDGALSPKRRKPKS 3240
            YG+K + +Y+PE  MK+ NW+KI    LSEN  WL +KE+     D+  +L  NF+T++ V K           P        +ILD KTAQN+SI LGS RM YE ++  ILE++  +L++++I+ L+K+LPE + + ++AEL + Y DL E EQF   +S++K L+PRL SILF+L F++ IN +K        A  E+ KSE   ++LE+VL +GNYMNSGSRN QS+GF++NFLCK+  TK      +L+HF+A+I      +  +  ++L +++ A++++     S L  ++  +  +E  +K F +   ++D+F EKMT F  T +EQ     T    M + ++++  YF F+S T  IEE F D+  F+T F+EA + N        + ++    +    +   ER++K+KQ+  ++K   E  +GV+DNLL  L+SG      ++R P++
Sbjct:  624 YGMKQKKMYKPEVSMKRINWSKIEPTELSENCFWLRVKEDKFENPDLFAKLALNFATQIKVQKNAEALEEKKTGPTKKKVKELRILDPKTAQNLSIFLGSYRMPYEDIRNVILEVNEDMLSEALIQNLVKHLPEQKILNELAELKNEYDDLCEPEQFGVVMSSVKMLQPRLSSILFKLTFEEHINNIKPSIIAVTLACEELKKSESFNRLLELVLLVGNYMNSGSRNAQSLGFKINFLCKIRDTKSADQKTTLLHFIADICEEKYRDILKFPEELEHVESASKVSAQILKSNLASMEQQIVHLERDIKKFPQAENQHDKFVEKMTSFTKTAREQYEKLSTMHNNMMKLYENLGEYFIFDSKTVSIEEFFGDLNNFRTLFLEAVRENNKRREMEEKTRRAKLAKEKAEQEKLERQKKKKQLIDINKEGDE--TGVMDNLLEALQSGAAFRDRRKRIPRN 1079          

HSP 2 Score: 124.02 bits (310), Expect = 6.988e-28
Identity = 112/408 (27.45%), Postives = 203/408 (49.75%), Query Frame = 1
Query:  193 SLSENEINDKFEKLLDDMNIPIDKRSVIREKTQEQKLVMLKSCITSQIKPVTY-------------YVELLKQIISEKLSESKICENLDQIRICLNSNPVSWIKEFDNKTNDGXXXXXXXXXXXXXXAD----SSIVCLKCFRAFANCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILTILTFFDYKSYQNVMD----ALFRAAKLNNYENRFVPLIESAKKNAQMENENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQVFDELLCNPNLKLTHEQINQFLXXXXXXXXXXXXXXXTIIRAFGDASDIFRIINRSVSNTKCEVNFRSILANLLIIRED-PIRDDLFRFIDEIVQEIILQDDSGFCPDPTLKKFDKINLKKFYDG 1350
            +LSE E+ D FEK+++DMN+  +K++ +R K    K  M+   I++  K                 YV  L+  IS++    K+   L+ +R+ L SNPVSW+  F ++    L   L  L    +  +    +    ++C +AF N  +GL +++  + + L +AR + P+  ++M    EI+ IL+       +N++D    A+  AA+ NN E RF P++E  +    ++     L +A ++FIN +++ P+       + D  +R+HLR EF+ +GL  +  +L    N +L   Q+  F    E++  E++ +   I     D ++++ ++   + +T  E  F SIL + L+IR D  IR   ++ I+E V +I+L   SG  PD   ++   I+L    D 
Sbjct:  100 NLSEKEVLDLFEKMMEDMNLNEEKKAPLRNKDFTTKREMVVQYISATAKSGGLKNSKHECTLSSQEYVHELRSGISDE----KLLNCLESLRVSLTSNPVSWVNNFGHEGLGLLLDELEKLLDKKQQENIDKKNQYKLIQCLKAFMNNKFGLQRILGDERSLLLLARAIDPKQPNMM---TEIVKILSAICIVGEENILDKLLGAITTAAERNNRE-RFSPIVEGLENQEALQ-----LQVACMQFINALVTSPY-------ELD--FRIHLRNEFLRSGLKTMLPDLKEKENDELDI-QLKVFDENKEDDLTELSHRLNDIRAEMDDMNEVYHLLYNMLKDTAAENYFLSILQHFLLIRNDYYIRPQYYKIIEECVSQIVLH-CSGMDPDFKYRQRLDIDLTHLIDS 483          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Human
Match: DIAPH2 (diaphanous related formin 2 [Source:HGNC Symbol;Acc:HGNC:2877])

HSP 1 Score: 282.337 bits (721), Expect = 1.826e-78
Identity = 168/458 (36.68%), Postives = 270/458 (58.95%), Query Frame = 1
Query: 1924 YGLK-RNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIPT-DILKELENNFSXXXXXXXXXXXXXXXXXXP--------KILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSF-KGSAENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFN--------XXXXXXXXXXXXXXXXXXRREKEKQMPVMSKTTSEEDSGVIDNLLAVLKSGDGALSPKRRKPKS 3240
            YG+K + +Y+PE  MK+ NW+KI    LSEN  WL +KE+     D+  +L  NF+T++ V K           P        +ILD KTAQN+SI LGS RM YE ++  ILE++  +L++++I+ L+K+LPE + + ++AEL + Y DL E EQF   +S++K L+PRL SILF+L F++ IN +K        A  E+ KSE   ++LE+VL +GNYMNSGSRN QS+GF++NFLCK+  TK      +L+HF+A+I      +  +  ++L +++ A++++     S L  ++  +  +E  +K F +   ++D+F EKMT F  T +EQ     T    M + ++++  YF F+S T  IEE F D+  F+T F+EA + N        + ++    +    +   ER++K+KQ+  ++K   E  +GV+DNLL  L+SG      ++R P++
Sbjct:  631 YGMKQKKMYKPEVSMKRINWSKIEPTELSENCFWLRVKEDKFENPDLFAKLALNFATQIKVQKNAEALEEKKTGPTKKKVKELRILDPKTAQNLSIFLGSYRMPYEDIRNVILEVNEDMLSEALIQNLVKHLPEQKILNELAELKNEYDDLCEPEQFGVVMSSVKMLQPRLSSILFKLTFEEHINNIKPSIIAVTLACEELKKSESFNRLLELVLLVGNYMNSGSRNAQSLGFKINFLCKIRDTKSADQKTTLLHFIADICEEKYRDILKFPEELEHVESASKVSAQILKSNLASMEQQIVHLERDIKKFPQAENQHDKFVEKMTIFTKTAREQYEKLSTMHNNMMKLYENLGEYFIFDSKTVSIEEFFGDLNNFRTLFLEAVRENNKRREMEEKTRRAKLAKEKAEQEKLERQKKKKQLIDINKEGDE--TGVMDNLLEALQSGAAFRDRRKRIPRN 1086          

HSP 2 Score: 124.02 bits (310), Expect = 7.152e-28
Identity = 112/411 (27.25%), Postives = 208/411 (50.61%), Query Frame = 1
Query:  193 SLSENEINDKFEKLLDDMNIPIDKRSVIREK--TQEQKLV----------MLKSCITSQIKPVTYYVELLKQIISEKL----SESKICENLDQIRICLNSNPVSWIKEFDNKTNDGXXXXXXXXXXXXXXAD----SSIVCLKCFRAFANCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILTILTFFDYKSYQNVMD----ALFRAAKLNNYENRFVPLIESAKKNAQMENENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQVFDELLCNPNLKLTHEQINQFLXXXXXXXXXXXXXXXTIIRAFGDASDIFRIINRSVSNTKCEVNFRSILANLLIIRED-PIRDDLFRFIDEIVQEIILQDDSGFCPDPTLKKFDKINLKKFYDG 1350
            +LSE E+ D FEK+++DMN+  +K++ +R K  T ++++V          ++ S +T  +K   +   L  Q    +L    S+ K+   L+ +R+ L SNPVSW+  F ++    L   L  L    +  +    +    ++C +AF N  +GL +++  + + L +AR + P+  ++M    EI+ IL+       +N++D    A+  AA+ NN E RF P++E  +    ++     L +A ++FIN +++ P+       + D  +R+HLR EF+ +GL  +  +L    N +L   Q+  F    E++  E++ +   I     D ++++ ++   + +T  E  F SIL + L+IR D  IR   ++ I+E V +I+L   SG  PD   ++   I+L    D 
Sbjct:  100 NLSEKEVLDLFEKMMEDMNLNEEKKAPLRNKDFTTKREMVVQYISATAKSIVGSKVTGGLKNSKHECTLSSQEYVHELRSGISDEKLLNCLESLRVSLTSNPVSWVNNFGHEGLGLLLDELEKLLDKKQQENIDKKNQYKLIQCLKAFMNNKFGLQRILGDERSLLLLARAIDPKQPNMM---TEIVKILSAICIVGEENILDKLLGAITTAAERNNRE-RFSPIVEGLENQEALQ-----LQVACMQFINALVTSPY-------ELD--FRIHLRNEFLRSGLKTMLPDLKEKENDELDI-QLKVFDENKEDDLTELSHRLNDIRAEMDDMNEVYHLLYNMLKDTAAENYFLSILQHFLLIRNDYYIRPQYYKIIEECVSQIVLH-CSGMDPDFKYRQRLDIDLTHLIDS 490          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Human
Match: DIAPH2 (diaphanous related formin 2 [Source:HGNC Symbol;Acc:HGNC:2877])

HSP 1 Score: 281.952 bits (720), Expect = 2.014e-78
Identity = 168/458 (36.68%), Postives = 270/458 (58.95%), Query Frame = 1
Query: 1924 YGLK-RNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIPT-DILKELENNFSXXXXXXXXXXXXXXXXXXP--------KILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSF-KGSAENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFN--------XXXXXXXXXXXXXXXXXXRREKEKQMPVMSKTTSEEDSGVIDNLLAVLKSGDGALSPKRRKPKS 3240
            YG+K + +Y+PE  MK+ NW+KI    LSEN  WL +KE+     D+  +L  NF+T++ V K           P        +ILD KTAQN+SI LGS RM YE ++  ILE++  +L++++I+ L+K+LPE + + ++AEL + Y DL E EQF   +S++K L+PRL SILF+L F++ IN +K        A  E+ KSE   ++LE+VL +GNYMNSGSRN QS+GF++NFLCK+  TK      +L+HF+A+I      +  +  ++L +++ A++++     S L  ++  +  +E  +K F +   ++D+F EKMT F  T +EQ     T    M + ++++  YF F+S T  IEE F D+  F+T F+EA + N        + ++    +    +   ER++K+KQ+  ++K   E  +GV+DNLL  L+SG      ++R P++
Sbjct:  624 YGMKQKKMYKPEVSMKRINWSKIEPTELSENCFWLRVKEDKFENPDLFAKLALNFATQIKVQKNAEALEEKKTGPTKKKVKELRILDPKTAQNLSIFLGSYRMPYEDIRNVILEVNEDMLSEALIQNLVKHLPEQKILNELAELKNEYDDLCEPEQFGVVMSSVKMLQPRLSSILFKLTFEEHINNIKPSIIAVTLACEELKKSESFNRLLELVLLVGNYMNSGSRNAQSLGFKINFLCKIRDTKSADQKTTLLHFIADICEEKYRDILKFPEELEHVESASKVSAQILKSNLASMEQQIVHLERDIKKFPQAENQHDKFVEKMTIFTKTAREQYEKLSTMHNNMMKLYENLGEYFIFDSKTVSIEEFFGDLNNFRTLFLEAVRENNKRREMEEKTRRAKLAKEKAEQEKLERQKKKKQLIDINKEGDE--TGVMDNLLEALQSGAAFRDRRKRIPRN 1079          

HSP 2 Score: 123.635 bits (309), Expect = 8.011e-28
Identity = 112/408 (27.45%), Postives = 203/408 (49.75%), Query Frame = 1
Query:  193 SLSENEINDKFEKLLDDMNIPIDKRSVIREKTQEQKLVMLKSCITSQIKPVTY-------------YVELLKQIISEKLSESKICENLDQIRICLNSNPVSWIKEFDNKTNDGXXXXXXXXXXXXXXAD----SSIVCLKCFRAFANCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILTILTFFDYKSYQNVMD----ALFRAAKLNNYENRFVPLIESAKKNAQMENENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQVFDELLCNPNLKLTHEQINQFLXXXXXXXXXXXXXXXTIIRAFGDASDIFRIINRSVSNTKCEVNFRSILANLLIIRED-PIRDDLFRFIDEIVQEIILQDDSGFCPDPTLKKFDKINLKKFYDG 1350
            +LSE E+ D FEK+++DMN+  +K++ +R K    K  M+   I++  K                 YV  L+  IS++    K+   L+ +R+ L SNPVSW+  F ++    L   L  L    +  +    +    ++C +AF N  +GL +++  + + L +AR + P+  ++M    EI+ IL+       +N++D    A+  AA+ NN E RF P++E  +    ++     L +A ++FIN +++ P+       + D  +R+HLR EF+ +GL  +  +L    N +L   Q+  F    E++  E++ +   I     D ++++ ++   + +T  E  F SIL + L+IR D  IR   ++ I+E V +I+L   SG  PD   ++   I+L    D 
Sbjct:  100 NLSEKEVLDLFEKMMEDMNLNEEKKAPLRNKDFTTKREMVVQYISATAKSGGLKNSKHECTLSSQEYVHELRSGISDE----KLLNCLESLRVSLTSNPVSWVNNFGHEGLGLLLDELEKLLDKKQQENIDKKNQYKLIQCLKAFMNNKFGLQRILGDERSLLLLARAIDPKQPNMM---TEIVKILSAICIVGEENILDKLLGAITTAAERNNRE-RFSPIVEGLENQEALQ-----LQVACMQFINALVTSPY-------ELD--FRIHLRNEFLRSGLKTMLPDLKEKENDELDI-QLKVFDENKEDDLTELSHRLNDIRAEMDDMNEVYHLLYNMLKDTAAENYFLSILQHFLLIRNDYYIRPQYYKIIEECVSQIVLH-CSGMDPDFKYRQRLDIDLTHLIDS 483          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Celegans
Match: cyk-1 (CYtoKinesis defect [Source:UniProtKB/TrEMBL;Acc:Q7JP75])

HSP 1 Score: 163.31 bits (412), Expect = 2.684e-40
Identity = 117/394 (29.70%), Postives = 192/394 (48.73%), Query Frame = 1
Query: 1897 PKPPSTLEKYGLKRNVYQPEQPMKKANW--NKINEKILSENSVWLSIKEETIPTD-ILKELENNFSXXXXXXXXX-----XXXXXXXXXPKILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLP-ETEQMQKIAELGDV-YKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQS-IGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELG-KDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSFKGSAENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHK 3042
            P  P  +  Y   + V + + PM+K  W  + IN + +   S W+   EE + +D +   L   F+TK              K  V     I D K  Q + IL GS++M + +LK AILE++  +LT   +EQL   +P E E + K+  +    ++++ E EQF  +L  I+ L  RL+ +LF+++F + +NE+K        A  E+  SE  +  L++VL+ GN+M   ++N  S   F++  L +L  TKD  N  +L+H L E + R     A     D  +  +++R+  D    T+   +  +K +EN LK +K   E D F EKM PF     ++     +   KM   ++S+  Y+ FN   Y +EE F D+  F  ++  A K
Sbjct:  795 PMAP-VIPDYLPPKKVPKVDGPMRKFPWGAHTINPRDIPRESFWVGTNEEQLTSDRMFDRLRTKFATKPAANSGTLGGVLNSKKKVKTAQVIHDDKLLQKLGILQGSIKMSHSELKLAILEVNEKVLTVGFLEQLRSAMPVEKELIDKLRAVNKAQFEEMPEGEQFVTRLLQIQGLPLRLDLVLFKMRFSEVLNELKPAMSSVMEACEEVRASEGFRTFLKLVLATGNFMGGATKNYSSAYAFDMRMLTRLVDTKDVDNRHTLLHHLIEEMKRIDPRRARFALTDFHHCIESSRVNADEIRKTVQLTENNIKKLENCLKVYKIQGERDLFDEKMRPFHEKAVKEFSTVSSMCGKMKNDWESLVKYYAFNDKKYPMEEFFADIRTFSEQYSNAWK 1187          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Celegans
Match: cyk-1 (CYtoKinesis defect [Source:UniProtKB/TrEMBL;Acc:Q7JP75])

HSP 1 Score: 162.925 bits (411), Expect = 3.029e-40
Identity = 117/394 (29.70%), Postives = 192/394 (48.73%), Query Frame = 1
Query: 1897 PKPPSTLEKYGLKRNVYQPEQPMKKANW--NKINEKILSENSVWLSIKEETIPTD-ILKELENNFSXXXXXXXXX-----XXXXXXXXXPKILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLP-ETEQMQKIAELGDV-YKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQS-IGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELG-KDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSFKGSAENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHK 3042
            P  P  +  Y   + V + + PM+K  W  + IN + +   S W+   EE + +D +   L   F+TK              K  V     I D K  Q + IL GS++M + +LK AILE++  +LT   +EQL   +P E E + K+  +    ++++ E EQF  +L  I+ L  RL+ +LF+++F + +NE+K        A  E+  SE  +  L++VL+ GN+M   ++N  S   F++  L +L  TKD  N  +L+H L E + R     A     D  +  +++R+  D    T+   +  +K +EN LK +K   E D F EKM PF     ++     +   KM   ++S+  Y+ FN   Y +EE F D+  F  ++  A K
Sbjct:  795 PMAP-VIPDYLPPKKVPKVDGPMRKFPWGAHTINPRDIPRESFWVGTNEEQLTSDRMFDRLRTKFATKPAANSGTLGGVLNSKKKVKTAQVIHDDKLLQKLGILQGSIKMSHSELKLAILEVNEKVLTVGFLEQLRSAMPVEKELIDKLRAVNKAQFEEMPEGEQFVTRLLQIQGLPLRLDLVLFKMRFSEVLNELKPAMSSVMEACEEVRASEGFRTFLKLVLATGNFMGGATKNYSSAYAFDMRMLTRLVDTKDVDNRHTLLHHLIEEMKRIDPRRARFALTDFHHCIESSRVNADEIRKTVQLTENNIKKLENCLKVYKIQGERDLFDEKMRPFHEKAVKEFSTVSSMCGKMKNDWESLVKYYAFNDKKYPMEEFFADIRTFSEQYSNAWK 1187          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Celegans
Match: daam-1 (DAAM (Disheveled-Associated Activator of Morphogenesis) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3ASL6])

HSP 1 Score: 126.716 bits (317), Expect = 2.143e-29
Identity = 108/411 (26.28%), Postives = 199/411 (48.42%), Query Frame = 1
Query: 1888 AAIPKPPSTLEKYGLKRNVYQPEQPMKKANWNKIN-EKILSENSVWLSIKEETIPTDI-LKELENNF--SXXXXXXXXXXXXXXXXXXPK-----ILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSI-LTQSMIEQLLKNLPETEQMQKIAELGDVYKD---LIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKT-NNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSFKGSA----------ENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSS--TYKIEELFNDMAKFKTEFIEAHK 3042
              +  PP    K  LK NV +P   MK  NW ++  +K  +  +VW  I +E I   + L EL   F  S+        T+  T+ + P+     ++D +  QN +I+L  L++ ++++KQA++ +D    L + MIEQ+LK +P  E++ +I E    +     L   +++ Y++S+I + + RL  +     F D++  +         A S   ++++ ++IL I+L++GNY+N G RN  + GFE+  + KL+  K+   N+R+L+HFL   I +   +  +  KD + + +A R +   TA+ +  ++  L  +  +L   + +           ENDRF+     F+     +    +    +M   F   + YF ++ S      EE F+ + KF   F E H+
Sbjct:  344 GGLTSPP----KDALK-NVPEPPGNMKTLNWQRLTLDK--TRGTVWDGIDDEKIYKQLDLTELSGCFAASSSHKDEDTDTLYGTINRRPQQANITVIDPRRYQNCTIMLSKLKLSHKEIKQAMMSMDEKCKLPKDMIEQMLKFMPTKEELTQINESVQKHGSPTVLALADRYMYEISSIPRFEQRLRCLNIIRSFHDRVEALVPFIQVVLKATSSCQQNKRFRQILTIILAIGNYLNFGKRNGNAYGFEMASINKLADVKNALRNDRNLLHFLVNFIEKKYPDLTKFKKDFATVTEAARFSQSETAAEIRNLEEALLIVRKELNLLESTTKVELPEHIPPENDRFALVAKAFIEKATAEYHNLDKMFREMKNKFSDCAKYFCYSPSGGVPVPEEFFSVINKFLNTFNEYHQ 747          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Celegans
Match: daam-1 (DAAM (Disheveled-Associated Activator of Morphogenesis) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3ASL6])

HSP 1 Score: 126.716 bits (317), Expect = 2.143e-29
Identity = 108/411 (26.28%), Postives = 199/411 (48.42%), Query Frame = 1
Query: 1888 AAIPKPPSTLEKYGLKRNVYQPEQPMKKANWNKIN-EKILSENSVWLSIKEETIPTDI-LKELENNF--SXXXXXXXXXXXXXXXXXXPK-----ILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSI-LTQSMIEQLLKNLPETEQMQKIAELGDVYKD---LIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKT-NNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSFKGSA----------ENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSS--TYKIEELFNDMAKFKTEFIEAHK 3042
              +  PP    K  LK NV +P   MK  NW ++  +K  +  +VW  I +E I   + L EL   F  S+        T+  T+ + P+     ++D +  QN +I+L  L++ ++++KQA++ +D    L + MIEQ+LK +P  E++ +I E    +     L   +++ Y++S+I + + RL  +     F D++  +         A S   ++++ ++IL I+L++GNY+N G RN  + GFE+  + KL+  K+   N+R+L+HFL   I +   +  +  KD + + +A R +   TA+ +  ++  L  +  +L   + +           ENDRF+     F+     +    +    +M   F   + YF ++ S      EE F+ + KF   F E H+
Sbjct:  344 GGLTSPP----KDALK-NVPEPPGNMKTLNWQRLTLDK--TRGTVWDGIDDEKIYKQLDLTELSGCFAASSSHKDEDTDTLYGTINRRPQQANITVIDPRRYQNCTIMLSKLKLSHKEIKQAMMSMDEKCKLPKDMIEQMLKFMPTKEELTQINESVQKHGSPTVLALADRYMYEISSIPRFEQRLRCLNIIRSFHDRVEALVPFIQVVLKATSSCQQNKRFRQILTIILAIGNYLNFGKRNGNAYGFEMASINKLADVKNALRNDRNLLHFLVNFIEKKYPDLTKFKKDFATVTEAARFSQSETAAEIRNLEEALLIVRKELNLLESTTKVELPEHIPPENDRFALVAKAFIEKATAEYHNLDKMFREMKNKFSDCAKYFCYSPSGGVPVPEEFFSVINKFLNTFNEYHQ 747          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Celegans
Match: daam-1 (DAAM (Disheveled-Associated Activator of Morphogenesis) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3ASL6])

HSP 1 Score: 127.102 bits (318), Expect = 2.288e-29
Identity = 108/411 (26.28%), Postives = 199/411 (48.42%), Query Frame = 1
Query: 1888 AAIPKPPSTLEKYGLKRNVYQPEQPMKKANWNKIN-EKILSENSVWLSIKEETIPTDI-LKELENNF--SXXXXXXXXXXXXXXXXXXPK-----ILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSI-LTQSMIEQLLKNLPETEQMQKIAELGDVYKD---LIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDK-TNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSFKGSA----------ENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSS--TYKIEELFNDMAKFKTEFIEAHK 3042
              +  PP    K  LK NV +P   MK  NW ++  +K  +  +VW  I +E I   + L EL   F  S+        T+  T+ + P+     ++D +  QN +I+L  L++ ++++KQA++ +D    L + MIEQ+LK +P  E++ +I E    +     L   +++ Y++S+I + + RL  +     F D++  +         A S   ++++ ++IL I+L++GNY+N G RN  + GFE+  + KL+  K+   N+R+L+HFL   I +   +  +  KD + + +A R +   TA+ +  ++  L  +  +L   + +           ENDRF+     F+     +    +    +M   F   + YF ++ S      EE F+ + KF   F E H+
Sbjct:  513 GGLTSPP----KDALK-NVPEPPGNMKTLNWQRLTLDK--TRGTVWDGIDDEKIYKQLDLTELSGCFAASSSHKDEDTDTLYGTINRRPQQANITVIDPRRYQNCTIMLSKLKLSHKEIKQAMMSMDEKCKLPKDMIEQMLKFMPTKEELTQINESVQKHGSPTVLALADRYMYEISSIPRFEQRLRCLNIIRSFHDRVEALVPFIQVVLKATSSCQQNKRFRQILTIILAIGNYLNFGKRNGNAYGFEMASINKLADVKNALRNDRNLLHFLVNFIEKKYPDLTKFKKDFATVTEAARFSQSETAAEIRNLEEALLIVRKELNLLESTTKVELPEHIPPENDRFALVAKAFIEKATAEYHNLDKMFREMKNKFSDCAKYFCYSPSGGVPVPEEFFSVINKFLNTFNEYHQ 916          

HSP 2 Score: 55.8398 bits (133), Expect = 1.985e-7
Identity = 72/372 (19.35%), Postives = 155/372 (41.67%), Query Frame = 1
Query:  196 LSENEINDKFEKLLDDMNIPIDKRSVIREKTQEQKLVMLKSCITSQIKPVTYYVELLKQIISEKLSESKICENLDQIRICLNSNPVSWIKEFDNKTNDGXXXXXXXXXXXXXXADS-SIVCLKCFRAFANCGYGLLKLMASDNAYLF-IARCLRPQNIHLMYVAVEILTILTFFDYKSYQNVMDALFRAAKLNNYENRFVPLIESAKKNAQMENENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQVFDELLCNPNLKLTHEQINQF----------LXXXXXXXXXXXXXXXTIIRAFGDASDIFRIINRSVSNTKCEVNFRSILANLLIIREDPIRDDLFRFIDEIVQEIILQ 1275
            L   +I+  FE L+ ++ +  +K+  +   + E+K+ +L S    Q +  ++++  LK +    + +S     L ++ I L +   S+++ F + +   L   L        T +  ++  L   RA  N   G + ++  +   L  IAR +  ++     VA+EIL+ L F   + +  V+ A+   + L     RF  L+    +    + + + +  A    IN ++         +A+    YR HLR E +  G+    ++     + +L  + I+ F          L+      +       +    F     +   ++  +++++   +F S+L +L ++  D     L+R  D I+Q + LQ
Sbjct:   40 LDPAKIDKDFECLVKELGLNEEKQQEMHNYSMEKKMSLLVSQHCLQTEDASHFIGFLKNLQQSFVIDSNTIRQLQELVISLRTQNYSYLESFISSSGLKLLTELLNQCHQQYTLEQPALFFLYALRALLNSPNGRVAVLNDEQHVLVSIARAVDFRDFKCKIVAIEILSGLCFIPDEGHIQVLRAITEVSTLLGERTRFQTLVSDLHRTYSTDRDTDRVRTAIFGLINALLR------TGAAENCAIYRQHLRSELLMLGMSTTLEQCREGASQRL-EDHIDLFEMMRKEDEISLAGSCTSSDISMSSETSSPIDFESVVGMAEALHIKLNHSQALPHFHSLLQHLFMVPSDDQHVPLWRLFDLILQHLTLQ 404          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Fly
Match: dia (gene:FBgn0011202 transcript:FBtr0081410)

HSP 1 Score: 249.595 bits (636), Expect = 6.502e-68
Identity = 157/473 (33.19%), Postives = 271/473 (57.29%), Query Frame = 1
Query: 1924 YGLK-RNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIPTD-ILKELENNFSXXXXXXXXXXXXXXXXXXPK------ILDGKTAQNISILLG-SLR-MEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSFK-GSAENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFNXXXXXXXXXXXXXXXXXXRREKEKQ------MPVMSKTTSEEDSGVIDNLLAVLKSGDG----ALSPKRRKPKSKDARRQLNRSRSR 3279
            +GLK +  +  + PMK+ANW  I    +S+ + W+  +E+ +  D  L EL   FS+K V  ++K          K      +LD KTAQN++I+LG SL+ + YE++K  +L  DT IL+ ++++QL++ LP  E ++++ E+    + L   EQF   +  IK+L PRL ++ F+L + D + ++K       AA  EI  S+K  KILE++L LGNYMNSGS+N+ + GFE+++L KLS+TKD  N ++L+H+LA+++ +   +      DLS+++KA+R+ +DA    + ++ + +K +E  L++ K    ++D+FSE M  F    ++Q+ +    Q +M + ++ +S Y+ F+ S Y +EE F D+  FK  F  AH  N   +   E+  + +  +E+  +E+Q        V+     +   GV+D+LL  L++G          +R++P   + R QL+RSRSR
Sbjct:  597 HGLKPKKKWDVKNPMKRANWKAIVPAKMSDKAFWVKCQEDKLAQDDFLAELAVKFSSKPVKKEQKDAVDKPTTLTKKNVDLRVLDSKTAQNLAIMLGGSLKHLSYEQIKICLLRCDTDILSSNILQQLIQYLPPPEHLKRLQEIKAKGEPLPPIEQFAATIGEIKRLSPRLHNLNFKLTYADMVQDIKPDIVAGTAACEEIRNSKKFSKILELILLLGNYMNSGSKNEAAFGFEISYLTKLSNTKDADNKQTLLHYLADLVEKKFPDALNFYDDLSHVNKASRVNMDAIQKAMRQMNSAVKNLETDLQNNKVPQCDDDKFSEVMGKFAEECRQQVDVLGKMQLQMEKLYKDLSEYYAFDPSKYTMEEFFADIKTFKDAFQAAHNDNVRVREELEKKRRLQEAREQSAREQQERQQRKKAVVDMDAPQTQEGVMDSLLEALQTGSAFGQRNRQARRQRPAGAERRAQLSRSRSR 1069          

HSP 2 Score: 110.153 bits (274), Expect = 6.418e-24
Identity = 111/393 (28.24%), Postives = 192/393 (48.85%), Query Frame = 1
Query:  196 LSENEINDKFEKLLDDMNIPIDKRSVIREKTQE--QKLVM--------LKSCITSQIKPVTYYVELLKQIISEKLSESKICENLDQIRICLNSNPVSWIKEFDNKTNDGXXXXXXXXXXXXXXADSSIVCLKCFRAFANCGYGLLKLMASD--NAYLFIARCLRPQNIHLMYVAVEIL-TILTFFDYKSYQNVMDALFR-AAKLNNYENRFVPLIESAKKNAQMENENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQVFDELL------CNPNLKLTHEQINQFLXXXXXXXXXXXXXXXTIIRAFGDASDIFRIINRSVSNTKCEVNFRSILANLLIIRED-PIRDDLFRFIDEIVQEIILQDDSGFCPDPTLK 1311
            LS  E++ KF ++++DMNIP DKR  +  K++E  QK++M        L+    S+ +    YVE L+   + + S  K+ + ++ +R+ L SNP+SWIKEF       +  LLA               ++C +A  N  +GL  ++  D  +  L +A+ L P+    M  A+++L +    ++   Y+ V+ A+   AA       RF P++++   + Q ++    L+  ++ FIN + + P          D  +RLHLR E +  GL    DE         N NL+  H +I  F    E++ EE  ++ + +     DA+D F ++   V++T  E  F SIL +LL IR+D   R   ++ I+E + +I+     G+C DP  +
Sbjct:   62 LSVAELDAKFLEIIEDMNIPKDKREPLLAKSKEERQKMIMWHLKGKNSLERSANSRFEKPIDYVEYLQ---NGEHSTHKVYQCVESLRVALTSNPISWIKEFGVAGIGTIEKLLARSKNNASYEKIEFEAIRCLKAIMNNTWGLNVVLNPDQHSVVLLLAQSLDPRKPQTMCEALKLLASFCIVYERNGYEKVLRAITTIAATSFKASERFRPIVDALFASDQ-QDPKRDLACHSLIFINTLTNTP---------TDLNFRLHLRCEIMRMGLYDRLDEFTKIVEASNNENLQ-QHFKI--FNEIREDDFEEFVQRFDNVTFNMDDATDCFDVLKNLVTDTTSEPYFLSILQHLLYIRDDFYFRPAYYQLIEECISQIVFH--KGYC-DPNFE 435          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Fly
Match: dia (gene:FBgn0011202 transcript:FBtr0335145)

HSP 1 Score: 249.595 bits (636), Expect = 6.502e-68
Identity = 157/473 (33.19%), Postives = 271/473 (57.29%), Query Frame = 1
Query: 1924 YGLK-RNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIPTD-ILKELENNFSXXXXXXXXXXXXXXXXXXPK------ILDGKTAQNISILLG-SLR-MEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSFK-GSAENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFNXXXXXXXXXXXXXXXXXXRREKEKQ------MPVMSKTTSEEDSGVIDNLLAVLKSGDG----ALSPKRRKPKSKDARRQLNRSRSR 3279
            +GLK +  +  + PMK+ANW  I    +S+ + W+  +E+ +  D  L EL   FS+K V  ++K          K      +LD KTAQN++I+LG SL+ + YE++K  +L  DT IL+ ++++QL++ LP  E ++++ E+    + L   EQF   +  IK+L PRL ++ F+L + D + ++K       AA  EI  S+K  KILE++L LGNYMNSGS+N+ + GFE+++L KLS+TKD  N ++L+H+LA+++ +   +      DLS+++KA+R+ +DA    + ++ + +K +E  L++ K    ++D+FSE M  F    ++Q+ +    Q +M + ++ +S Y+ F+ S Y +EE F D+  FK  F  AH  N   +   E+  + +  +E+  +E+Q        V+     +   GV+D+LL  L++G          +R++P   + R QL+RSRSR
Sbjct:  597 HGLKPKKKWDVKNPMKRANWKAIVPAKMSDKAFWVKCQEDKLAQDDFLAELAVKFSSKPVKKEQKDAVDKPTTLTKKNVDLRVLDSKTAQNLAIMLGGSLKHLSYEQIKICLLRCDTDILSSNILQQLIQYLPPPEHLKRLQEIKAKGEPLPPIEQFAATIGEIKRLSPRLHNLNFKLTYADMVQDIKPDIVAGTAACEEIRNSKKFSKILELILLLGNYMNSGSKNEAAFGFEISYLTKLSNTKDADNKQTLLHYLADLVEKKFPDALNFYDDLSHVNKASRVNMDAIQKAMRQMNSAVKNLETDLQNNKVPQCDDDKFSEVMGKFAEECRQQVDVLGKMQLQMEKLYKDLSEYYAFDPSKYTMEEFFADIKTFKDAFQAAHNDNVRVREELEKKRRLQEAREQSAREQQERQQRKKAVVDMDAPQTQEGVMDSLLEALQTGSAFGQRNRQARRQRPAGAERRAQLSRSRSR 1069          

HSP 2 Score: 110.153 bits (274), Expect = 6.418e-24
Identity = 111/393 (28.24%), Postives = 192/393 (48.85%), Query Frame = 1
Query:  196 LSENEINDKFEKLLDDMNIPIDKRSVIREKTQE--QKLVM--------LKSCITSQIKPVTYYVELLKQIISEKLSESKICENLDQIRICLNSNPVSWIKEFDNKTNDGXXXXXXXXXXXXXXADSSIVCLKCFRAFANCGYGLLKLMASD--NAYLFIARCLRPQNIHLMYVAVEIL-TILTFFDYKSYQNVMDALFR-AAKLNNYENRFVPLIESAKKNAQMENENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQVFDELL------CNPNLKLTHEQINQFLXXXXXXXXXXXXXXXTIIRAFGDASDIFRIINRSVSNTKCEVNFRSILANLLIIRED-PIRDDLFRFIDEIVQEIILQDDSGFCPDPTLK 1311
            LS  E++ KF ++++DMNIP DKR  +  K++E  QK++M        L+    S+ +    YVE L+   + + S  K+ + ++ +R+ L SNP+SWIKEF       +  LLA               ++C +A  N  +GL  ++  D  +  L +A+ L P+    M  A+++L +    ++   Y+ V+ A+   AA       RF P++++   + Q ++    L+  ++ FIN + + P          D  +RLHLR E +  GL    DE         N NL+  H +I  F    E++ EE  ++ + +     DA+D F ++   V++T  E  F SIL +LL IR+D   R   ++ I+E + +I+     G+C DP  +
Sbjct:   62 LSVAELDAKFLEIIEDMNIPKDKREPLLAKSKEERQKMIMWHLKGKNSLERSANSRFEKPIDYVEYLQ---NGEHSTHKVYQCVESLRVALTSNPISWIKEFGVAGIGTIEKLLARSKNNASYEKIEFEAIRCLKAIMNNTWGLNVVLNPDQHSVVLLLAQSLDPRKPQTMCEALKLLASFCIVYERNGYEKVLRAITTIAATSFKASERFRPIVDALFASDQ-QDPKRDLACHSLIFINTLTNTP---------TDLNFRLHLRCEIMRMGLYDRLDEFTKIVEASNNENLQ-QHFKI--FNEIREDDFEEFVQRFDNVTFNMDDATDCFDVLKNLVTDTTSEPYFLSILQHLLYIRDDFYFRPAYYQLIEECISQIVFH--KGYC-DPNFE 435          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Fly
Match: dia (gene:FBgn0011202 transcript:FBtr0081411)

HSP 1 Score: 249.595 bits (636), Expect = 6.502e-68
Identity = 157/473 (33.19%), Postives = 271/473 (57.29%), Query Frame = 1
Query: 1924 YGLK-RNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIPTD-ILKELENNFSXXXXXXXXXXXXXXXXXXPK------ILDGKTAQNISILLG-SLR-MEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSFK-GSAENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFNXXXXXXXXXXXXXXXXXXRREKEKQ------MPVMSKTTSEEDSGVIDNLLAVLKSGDG----ALSPKRRKPKSKDARRQLNRSRSR 3279
            +GLK +  +  + PMK+ANW  I    +S+ + W+  +E+ +  D  L EL   FS+K V  ++K          K      +LD KTAQN++I+LG SL+ + YE++K  +L  DT IL+ ++++QL++ LP  E ++++ E+    + L   EQF   +  IK+L PRL ++ F+L + D + ++K       AA  EI  S+K  KILE++L LGNYMNSGS+N+ + GFE+++L KLS+TKD  N ++L+H+LA+++ +   +      DLS+++KA+R+ +DA    + ++ + +K +E  L++ K    ++D+FSE M  F    ++Q+ +    Q +M + ++ +S Y+ F+ S Y +EE F D+  FK  F  AH  N   +   E+  + +  +E+  +E+Q        V+     +   GV+D+LL  L++G          +R++P   + R QL+RSRSR
Sbjct:  597 HGLKPKKKWDVKNPMKRANWKAIVPAKMSDKAFWVKCQEDKLAQDDFLAELAVKFSSKPVKKEQKDAVDKPTTLTKKNVDLRVLDSKTAQNLAIMLGGSLKHLSYEQIKICLLRCDTDILSSNILQQLIQYLPPPEHLKRLQEIKAKGEPLPPIEQFAATIGEIKRLSPRLHNLNFKLTYADMVQDIKPDIVAGTAACEEIRNSKKFSKILELILLLGNYMNSGSKNEAAFGFEISYLTKLSNTKDADNKQTLLHYLADLVEKKFPDALNFYDDLSHVNKASRVNMDAIQKAMRQMNSAVKNLETDLQNNKVPQCDDDKFSEVMGKFAEECRQQVDVLGKMQLQMEKLYKDLSEYYAFDPSKYTMEEFFADIKTFKDAFQAAHNDNVRVREELEKKRRLQEAREQSAREQQERQQRKKAVVDMDAPQTQEGVMDSLLEALQTGSAFGQRNRQARRQRPAGAERRAQLSRSRSR 1069          

HSP 2 Score: 110.153 bits (274), Expect = 6.418e-24
Identity = 111/393 (28.24%), Postives = 192/393 (48.85%), Query Frame = 1
Query:  196 LSENEINDKFEKLLDDMNIPIDKRSVIREKTQE--QKLVM--------LKSCITSQIKPVTYYVELLKQIISEKLSESKICENLDQIRICLNSNPVSWIKEFDNKTNDGXXXXXXXXXXXXXXADSSIVCLKCFRAFANCGYGLLKLMASD--NAYLFIARCLRPQNIHLMYVAVEIL-TILTFFDYKSYQNVMDALFR-AAKLNNYENRFVPLIESAKKNAQMENENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQVFDELL------CNPNLKLTHEQINQFLXXXXXXXXXXXXXXXTIIRAFGDASDIFRIINRSVSNTKCEVNFRSILANLLIIRED-PIRDDLFRFIDEIVQEIILQDDSGFCPDPTLK 1311
            LS  E++ KF ++++DMNIP DKR  +  K++E  QK++M        L+    S+ +    YVE L+   + + S  K+ + ++ +R+ L SNP+SWIKEF       +  LLA               ++C +A  N  +GL  ++  D  +  L +A+ L P+    M  A+++L +    ++   Y+ V+ A+   AA       RF P++++   + Q ++    L+  ++ FIN + + P          D  +RLHLR E +  GL    DE         N NL+  H +I  F    E++ EE  ++ + +     DA+D F ++   V++T  E  F SIL +LL IR+D   R   ++ I+E + +I+     G+C DP  +
Sbjct:   62 LSVAELDAKFLEIIEDMNIPKDKREPLLAKSKEERQKMIMWHLKGKNSLERSANSRFEKPIDYVEYLQ---NGEHSTHKVYQCVESLRVALTSNPISWIKEFGVAGIGTIEKLLARSKNNASYEKIEFEAIRCLKAIMNNTWGLNVVLNPDQHSVVLLLAQSLDPRKPQTMCEALKLLASFCIVYERNGYEKVLRAITTIAATSFKASERFRPIVDALFASDQ-QDPKRDLACHSLIFINTLTNTP---------TDLNFRLHLRCEIMRMGLYDRLDEFTKIVEASNNENLQ-QHFKI--FNEIREDDFEEFVQRFDNVTFNMDDATDCFDVLKNLVTDTTSEPYFLSILQHLLYIRDDFYFRPAYYQLIEECISQIVFH--KGYC-DPNFE 435          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Fly
Match: dia (gene:FBgn0011202 transcript:FBtr0305961)

HSP 1 Score: 249.595 bits (636), Expect = 7.286e-68
Identity = 157/473 (33.19%), Postives = 271/473 (57.29%), Query Frame = 1
Query: 1924 YGLK-RNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIPTD-ILKELENNFSXXXXXXXXXXXXXXXXXXPK------ILDGKTAQNISILLG-SLR-MEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSFK-GSAENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFNXXXXXXXXXXXXXXXXXXRREKEKQ------MPVMSKTTSEEDSGVIDNLLAVLKSGDG----ALSPKRRKPKSKDARRQLNRSRSR 3279
            +GLK +  +  + PMK+ANW  I    +S+ + W+  +E+ +  D  L EL   FS+K V  ++K          K      +LD KTAQN++I+LG SL+ + YE++K  +L  DT IL+ ++++QL++ LP  E ++++ E+    + L   EQF   +  IK+L PRL ++ F+L + D + ++K       AA  EI  S+K  KILE++L LGNYMNSGS+N+ + GFE+++L KLS+TKD  N ++L+H+LA+++ +   +      DLS+++KA+R+ +DA    + ++ + +K +E  L++ K    ++D+FSE M  F    ++Q+ +    Q +M + ++ +S Y+ F+ S Y +EE F D+  FK  F  AH  N   +   E+  + +  +E+  +E+Q        V+     +   GV+D+LL  L++G          +R++P   + R QL+RSRSR
Sbjct:  604 HGLKPKKKWDVKNPMKRANWKAIVPAKMSDKAFWVKCQEDKLAQDDFLAELAVKFSSKPVKKEQKDAVDKPTTLTKKNVDLRVLDSKTAQNLAIMLGGSLKHLSYEQIKICLLRCDTDILSSNILQQLIQYLPPPEHLKRLQEIKAKGEPLPPIEQFAATIGEIKRLSPRLHNLNFKLTYADMVQDIKPDIVAGTAACEEIRNSKKFSKILELILLLGNYMNSGSKNEAAFGFEISYLTKLSNTKDADNKQTLLHYLADLVEKKFPDALNFYDDLSHVNKASRVNMDAIQKAMRQMNSAVKNLETDLQNNKVPQCDDDKFSEVMGKFAEECRQQVDVLGKMQLQMEKLYKDLSEYYAFDPSKYTMEEFFADIKTFKDAFQAAHNDNVRVREELEKKRRLQEAREQSAREQQERQQRKKAVVDMDAPQTQEGVMDSLLEALQTGSAFGQRNRQARRQRPAGAERRAQLSRSRSR 1076          

HSP 2 Score: 110.153 bits (274), Expect = 6.180e-24
Identity = 111/390 (28.46%), Postives = 191/390 (48.97%), Query Frame = 1
Query:  196 LSENEINDKFEKLLDDMNIPIDKRSVIREKTQE--QKLVM--------LKSCITSQIKPVTYYVELLKQIISEKLSESKICENLDQIRICLNSNPVSWIKEFDNKTNDGXXXXXXXXXXXXXXADSSIVCLKCFRAFANCGYGLLKLMASD--NAYLFIARCLRPQNIHLMYVAVEIL-TILTFFDYKSYQNVMDALFR-AAKLNNYENRFVPLIESAKKNAQMENENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQVFDELL------CNPNLKLTHEQINQFLXXXXXXXXXXXXXXXTIIRAFGDASDIFRIINRSVSNTKCEVNFRSILANLLIIRED-PIRDDLFRFIDEIVQEIILQDDSGFCPDP 1302
            LS  E++ KF ++++DMNIP DKR  +  K++E  QK++M        L+    S+ +    YVE L+   + + S  K+ + ++ +R+ L SNP+SWIKEF       +  LLA               ++C +A  N  +GL  ++  D  +  L +A+ L P+    M  A+++L +    ++   Y+ V+ A+   AA       RF P++++   + Q ++    L+  ++ FIN + + P          D  +RLHLR E +  GL    DE         N NL+  H +I  F    E++ EE  ++ + +     DA+D F ++   V++T  E  F SIL +LL IR+D   R   ++ I+E + +I+     G+C DP
Sbjct:   69 LSVAELDAKFLEIIEDMNIPKDKREPLLAKSKEERQKMIMWHLKGKNSLERSANSRFEKPIDYVEYLQ---NGEHSTHKVYQCVESLRVALTSNPISWIKEFGVAGIGTIEKLLARSKNNASYEKIEFEAIRCLKAIMNNTWGLNVVLNPDQHSVVLLLAQSLDPRKPQTMCEALKLLASFCIVYERNGYEKVLRAITTIAATSFKASERFRPIVDALFASDQ-QDPKRDLACHSLIFINTLTNTP---------TDLNFRLHLRCEIMRMGLYDRLDEFTKIVEASNNENLQ-QHFKI--FNEIREDDFEEFVQRFDNVTFNMDDATDCFDVLKNLVTDTTSEPYFLSILQHLLYIRDDFYFRPAYYQLIEECISQIVFH--KGYC-DP 439          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Fly
Match: DAAM (gene:FBgn0025641 transcript:FBtr0342731)

HSP 1 Score: 146.362 bits (368), Expect = 4.377e-35
Identity = 114/401 (28.43%), Postives = 196/401 (48.88%), Query Frame = 1
Query: 1897 PKPPSTLEKYGL-KRNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIPTDI-LKELENNFSXXXXXXXXXX----------XXXXXXXXPKILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQ-SMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDK-TNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSFKGSA---ENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFN 3048
            P PP    K  L K+NV QP  P+K  NW+K+ +  L + +VW  + E  +  ++ L+ ++  FS         T           K    K   ++DG+ AQN +ILL  L+M   ++ +AIL +D++   Q  M+EQLLK  P  E+   + E  +  + L   ++F Y++S I   + RL+S+ ++ +F   IN++  +      A  E+ +S +++K+LE+VL+LGNYMN G+R   S GF L  L +L+ TK       +L+H+L ++I R   +  +L  D+ ++ +A++++L      +  ++TGL  +  +++  + S    + DRF   M  F      +    E     M   F      F  + S  + +E F     F   F EA   N
Sbjct:  631 PAPP----KVDLPKKNVPQPTNPLKSFNWSKLPDAKL-QGTVWSELDESKLYNNMELESIDKLFSAYQKNGVSATDGSYEDLRVTGKAAKQKVLSVIDGRRAQNCTILLSKLKMSDMEISKAILSMDSNEQLQLDMVEQLLKFTPSAEERALLDEHSEDIESLARADRFLYEISKIPHYEQRLKSLHYKKRFMLTINDLVPRITSVMEASREVARSRRLRKLLELVLALGNYMNRGARGNAS-GFRLASLNRLADTKSSAAKGTTLLHYLVQVIERKFKDLLKLEDDIPHVREASKVSLGEMDKDIQMLRTGLADVAREIEFHRSSGPAQQGDRFLPVMREFHAQASVRFAELEDKFQDMKTRFDRAVRLFGEDGSVLQPDEFFGIFDSFLAAFAEARHDN 1025          

HSP 2 Score: 54.6842 bits (130), Expect = 5.914e-7
Identity = 38/151 (25.17%), Postives = 65/151 (43.05%), Query Frame = 1
Query:  556 LKCFRAFANCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILTILTFFDYKSYQNVMDALFRAAKLNNYENRFVPLIESAKKNAQMENENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQVFDELLCNPN 1008
            + C +A  N   G   ++A   A   IAR L   NI     A+EIL  +       ++ V+ A+           RF  ++    ++     +N +L  A + F+N +++          Q +  +RLHLR EF+  G+  V D+L  + N
Sbjct:  188 IGCIKALMNNSMGRAHVLAHPTAIDTIARSLAADNIRTKIAALEILGAVCLVP-GGHRKVLQAMLHFQVFATERTRFQSIVNDLDRSTYAYRDNVNLKTALMSFVNAVLN------YGPGQENLEFRLHLRYEFLMLGIQPVIDKLRTHEN 331          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Zebrafish
Match: diaph2 (diaphanous-related formin 2 [Source:ZFIN;Acc:ZDB-GENE-090115-1])

HSP 1 Score: 268.855 bits (686), Expect = 3.314e-74
Identity = 159/473 (33.62%), Postives = 270/473 (57.08%), Query Frame = 1
Query: 1924 YGLK-RNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIPTDILKELENNFSXXXXXXXXXXXXXXXXXXPKILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSF-KGSAENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFNXXXXXXX--------XXXXXXXXXXXRREKEKQMPVMSKTTSEEDSGVIDNLLAVLKSGDGALSPKRRKPKSKDARRQLNRSRSRGEFNENMSNNL 3312
            YGL  +  Y+P+  MK+ NW+KI  + ++EN  WL +KEE      +    +   +        T      KE +ILD KTAQN+SI LGS R+ YE+++  +L++D   L++++I+ L+KNLPE +++  +AEL + Y++L E EQF   +S++K L+PRL  ILF+L F++++N ++        A  E+ KSE    +LE+VL +GNYMNSGSRN Q+ GF ++FLCKL  TK    N +L+HFLAE          +   +L +++ A+++A     ++L  ++  ++ +EN +++F K   + D+F EKM+ F    +EQ     T    M + ++++ +YF F+  T  IE+ F D+A F+  F++A + N +K+ +E         +    +   ER++K+KQ+  M+K   E  +GV+D+L+  L+SG      ++R P++ D     +  R  G  ++N    L
Sbjct:  593 YGLAPKKTYKPDSIMKRVNWSKIVPQEMAENCFWLKVKEERFENTDMFSELSLSFSSKSRDDRMTQFKKKAKELRILDAKTAQNLSIFLGSFRLPYEEIRDIVLQVDEERLSEALIQNLIKNLPEQKELSNLAELKNEYEELCESEQFGIVMSSVKMLRPRLNGILFKLTFEEQVNNIRPDIMNVTFACEEVKKSEGFHMLLEMVLLVGNYMNSGSRNAQTFGFNISFLCKLRDTKSTDQNTTLLHFLAEKCEEKYPEMLKFPDELEHVESASKVAAQTLKASLDIMERHIQRLENDIQNFPKTDDKQDKFVEKMSGFSKHSREQYEKLSTMHKNMQKLYENLGSYFAFDPHTVSIEDFFGDLANFRNLFMDAVRENHKKREMEEKIKRAKIAKEKAEREKIERQQKKKQLIDMNKEGDE--TGVMDSLMEALQSGAAFRDRRKRTPRNGDQSPSCSAPRWPGANHDNRRTGL 1063          

HSP 2 Score: 132.109 bits (331), Expect = 1.215e-30
Identity = 118/402 (29.35%), Postives = 198/402 (49.25%), Query Frame = 1
Query:  193 SLSENEINDKFEKLLDDMNIPIDKRSVIREKTQEQKLVMLKSCITSQIKPVTY--------------------YVELLKQIISEKLSESKICENLDQIRICLNSNPVSWIKEFDNKTNDGXXXXXXXXXXXXXXAD----SSIVCLKCFRAFANCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILTILTFFDYKSYQNVMD----ALFRAAKLNNYENRFVPLIESAKKNAQMEN-ENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQVFDELLCNPNLKLTHE---QINQFLXXXXXXXXXXXXXXXTIIRAFGDASDIFRIINRSVSNTKCEVNFRSILANLLIIRED-PIRDDLFRFIDEIVQEIILQDDSGFCPD 1299
            +LSE EI D FEK+++DMN+  ++++ +R K    K  M+   I++  K +T                     YV  L+  ISE     K+   L+ +R+ L SNPVSW+  F ++    L   L  L    +  +    +    ++C +AF N  YGL +++  + + L +AR + P+  ++M   V+IL+ +        +N++D    A+  AA+ NN E RF P++E       +EN E + L +A ++ IN +++ P     D   F    R+HLR EF+  GL ++       P LK T E   Q+  F    E +  E++ + + I     D  +++ +++  V +T  E  F SIL +LL+IR D  IR   ++ I+E V +I+L   SG  PD
Sbjct:   56 NLSEKEIVDLFEKMMEDMNLNEERKAPLRGKDLSTKREMVVQYISATAKSITGSKVAGGLRNSKHECTLSSQEYVHELRSGISE----DKLLNCLESLRVSLTSNPVSWVNNFGHEGLGLLLDALERLLDKKQQENIDKKNQHKLIQCLKAFMNNKYGLQRILGDERSLLLLARAIDPKQTNMMTEIVKILSAVCII---GEENILDKILAAMTIAAERNNKE-RFAPIVEG------LENHEAQQLQVACMQLINALVTSP-----DDLDF----RIHLRNEFLRCGLKKIL------PELKETEELDIQLKVFNENKEEDSIELSHRLDDIRAEMDDMGEVYHLLSNMVKDTGSEPYFLSILQHLLLIRNDYYIRPQYYKVIEECVSQIVLH-RSGMDPD 427          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Zebrafish
Match: diaph3 (diaphanous-related formin 3 [Source:ZFIN;Acc:ZDB-GENE-040801-144])

HSP 1 Score: 249.595 bits (636), Expect = 3.475e-70
Identity = 171/495 (34.55%), Postives = 269/495 (54.34%), Query Frame = 1
Query: 1924 YGLK-RNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIPT-DILKELENNFSXXXXXXXXXXXXXXXXXXPK------ILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSFKGS-AENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFNXXXXXXXXXXXXXXXXXXRREKEKQMPVMSK------TTSEEDSGVIDNLLAVLKSGDG-----------------ALSPKRRKPKSKDARRQ-----LNRSRSRGEFNEN 3297
            +GLK +  ++P+  MK+ NW+KI+ + LSEN  W+  KE+     D+L  L   F T+ V  +E+          K      +LD K AQN+SI LGS RM YE++++ ILE+D   LT+ MI+ L+K+LPE EQ+  + +    Y +L E EQF   +S++K+L+PRL SILF+L+F++++N ++       AA  E+ KS+   ++LE++L  GN+MN+GSRN QS G+ L+ LCKL  TK      +L+HFLAEI         +   DL ++D+A+R++ +    +L +++  L  +E  L +F  +  + D F  KM  F T  ++Q        + M   + ++  YF  +     +EELF D++ F+  F++A K N  +K  EE+  KA++ KE+ E+EK+   M K       T  + +GV+D LL  L+SG                     SP  ++P  KD   +     L RSRSR   N N
Sbjct:  115 FGLKPKKEFKPDTSMKRLNWSKISPQELSENCFWVIAKEDRYENEDLLTRLSVTFGTQRVARREEEDLEEKKCIKKRVKELKVLDPKIAQNLSIFLGSFRMPYEEIRRMILEVDEDQLTEPMIQNLVKHLPEQEQLNALVKYKSEYANLSEPEQFGVVMSSVKRLRPRLNSILFKLQFEEQVNHLRPDIMAVNAACDEVRKSKSFSRLLELILLTGNFMNAGSRNAQSFGYNLSSLCKLKDTKSTDQKSTLLHFLAEICEEKFPEVLKFVDDLQHVDRASRVSAENLEKSLKQMEKHLLQLEKDLDTFSSTDDQQDLFHSKMASFSTQARDQYQKLVVMHSNMVTLYLNMLEYFAIDPKKTSVEELFTDLSNFRAMFMQAMKENIRRKEAEEKQRKARIAKEKAEREKKERQMKKKRLLEVNTENDQTGVMDCLLEALQSGAAFRDRRKRAPRPRGEPTQTFSPSPQRPVLKDCHHENMKASLQRSRSRQNINLN 609          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Zebrafish
Match: diaph3 (diaphanous-related formin 3 [Source:ZFIN;Acc:ZDB-GENE-040801-144])

HSP 1 Score: 238.424 bits (607), Expect = 4.043e-64
Identity = 167/501 (33.33%), Postives = 271/501 (54.09%), Query Frame = 1
Query: 1924 YGLK-RNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIPT-DILKELENNFSXXXXXXXXXXXXXXXXXXPK------ILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSFKGS-AENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFNXXXXXXXXXXXXXXXXXXRREKEKQMPVMSK------TTSEEDSGVIDNLLAVLKSGDGALSPKRRKPKSKDARRQLNRSRSRGEFNENMSNNLIEIAS*NSLYSIIRNCHIRHSKS 3381
            +GLK +  ++P+  MK+ NW+KI+ + LSEN  W+  KE+     D+L  L   F T+ V  +E+          K      +LD K AQN+SI LGS RM YE++++ ILE+D   LT+ MI+ L+K+LPE EQ+  + +    Y +L E EQF   +S++K+L+PRL SILF+L+F++++N ++       AA  E+ KS+   ++LE++L  GN+MN+GSRN QS G+ L+ LCKL  TK      +L+HFLAEI         +   DL ++D+A+R++ +    +L +++  L  +E  L +F  +  + D F  KM       ++Q        + M   + ++  YF  +     +EELF D++ F+  F++A K N  +K  EE+  KA++ KE+ E+EK+   M K       T  + +GV+D LL  L+SG      ++R P            R RGE  +  S         +    ++++CH   +KS
Sbjct:  598 FGLKPKKEFKPDTSMKRLNWSKISPQELSENCFWVIAKEDRYENEDLLTRLSVTFGTQRVARREEEDLEEKKCIKKRVKELKVLDPKIAQNLSIFLGSFRMPYEEIRRMILEVDEDQLTEPMIQNLVKHLPEQEQLNALVKYKSEYANLSEPEQFGVVMSSVKRLRPRLNSILFKLQFEEQVNHLRPDIMAVNAACDEVRKSKSFSRLLELILLTGNFMNAGSRNAQSFGYNLSSLCKLKDTKSTDQKSTLLHFLAEICEEKFPEVLKFVDDLQHVDRASRVSAENLEKSLKQMEKHLLQLEKDLDTFSSTDDQQDLFHSKMAISFLHARDQYQKLVVMHSNMVTLYLNMLEYFAIDPKKTSVEELFTDLSNFRAMFMQAMKENIRRKEAEEKQRKARIAKEKAEREKKERQMKKKRLLEVNTENDQTGVMDCLLEALQSGAAFRDRRKRAP------------RPRGEPTQTFSP--------SPQRPVLKDCHHGKNKS 1078          

HSP 2 Score: 112.849 bits (281), Expect = 1.167e-24
Identity = 112/396 (28.28%), Postives = 187/396 (47.22%), Query Frame = 1
Query:  199 SENEINDKFEKLLDDMNIPIDKRSVIREKTQEQKLVM-LKSCIT----------SQIKPVTYYVELLKQIISEKLSESKICENLDQIRICLNSNPVSWIKEFDNK----TNDGXXXXXXXXXXXXXXADSSIVCLKCFRAFANCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILT-ILTFFDYKSYQNVMDALFRAAKLNNYENRFVPLIESAKKNAQMENENESLSLATIRFINVIISPPFLNPNDSAQFDEY-YRLHLRREFVNNGLMQVFDELLCNPN------LKLTHEQINQFLXXXXXXXXXXXXXXXTIIRAFGDASDIFRIINRSVSNTKCEVNFRSILANLLIIREDPI-RDDLFRFIDEIVQEIILQDDSGFCPDPTLKK 1314
            SE EI   FEK+++DMN+  +K++ +REK    K  M L+  +T          SQI P  +  EL      E+L     C  LD +R+ L SNPVSW++ F ++      D L  LL           S    ++C +AF N  YGL +++  + +   +A+ + P    +M   V++L+ I    +  + + V++A+  A +      RF P+++       +   +  L +A ++ IN +++ P          DE  +RLH+R EF+  GL ++   L    N      LK+  E   + + E+ +  E+        IR   D  D+F ++  SV ++  E  F SIL +LL++R D   R   F+ I+E V +I+L   SG  PD   +K
Sbjct:   93 SEKEILALFEKMMEDMNLNEEKKAPLREKDLNTKREMVLQYVVTAAKTGSLRSSSQISPQEFLSELKSGATDERLF---AC--LDSLRVSLTSNPVSWVQSFGHEGLGLLLDTLEKLLLKKHQEKVDKKSQHKVIQCLKAFMNNKYGLERILGEETSLALLAQAIDPCQPAMMTDVVKLLSAICIVGEENTLEKVLEAITTATEGRGVA-RFNPIVQG------LSVRSVQLQVACMQLINALVTSP----------DELDFRLHIRNEFMRCGLREILPSLSVVKNDALDIQLKVFEEHKEEDMIEFSHRLED--------IRMHTDIGDVFNVLYCSVKDSAAESYFLSILQHLLLVRNDYFTRPQYFKIIEECVSQIVLH-RSGTDPDFGYRK 457          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Zebrafish
Match: diaph2 (diaphanous-related formin 2 [Source:ZFIN;Acc:ZDB-GENE-090115-1])

HSP 1 Score: 211.846 bits (538), Expect = 7.337e-56
Identity = 124/324 (38.27%), Postives = 201/324 (62.04%), Query Frame = 1
Query: 1924 YGLK-RNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIP-TDILKELENNFSXXXXXXXXXXXXXXXXXXPK-------ILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSF-KGSAENDRFSEKMT 2865
            YGL  +  Y+P+  MK+ NW+KI  + ++EN  WL +KEE    TD+  EL  +FS+K  V K+       + + K       ILD KTAQN+SI LGS R+ YE+++  +L++D   L++++I+ L+KNLPE +++  +AEL + Y++L E EQF   +S++K L+PRL  ILF+L F++++N ++        A  E+ KSE    +LE+VL +GNYMNSGSRN Q+ GF ++FLCKL  TK    N +L+HFLAE          +   +L +++ A+++A     ++L  ++  ++ +EN +++F K   + D+F EKM+
Sbjct:  607 YGLAPKKTYKPDSIMKRVNWSKIVPQEMAENCFWLKVKEERFENTDMFSELSLSFSSKSRVKKDVEETDDRMTQFKKKAKELRILDAKTAQNLSIFLGSFRLPYEEIRDIVLQVDEERLSEALIQNLIKNLPEQKELSNLAELKNEYEELCESEQFGIVMSSVKMLRPRLNGILFKLTFEEQVNNIRPDIMNVTFACEEVKKSEGFHMLLEMVLLVGNYMNSGSRNAQTFGFNISFLCKLRDTKSTDQNTTLLHFLAEKCEEKYPEMLKFPDELEHVESASKVAAQTLKASLDIMERHIQRLENDIQNFPKTDDKQDKFVEKMS 930          

HSP 2 Score: 129.798 bits (325), Expect = 5.769e-30
Identity = 117/401 (29.18%), Postives = 197/401 (49.13%), Query Frame = 1
Query:  193 SLSENEINDKFEKLLDDMNIPIDKRSVIREKTQEQKLVMLKSCITSQIKPVTY--------------------YVELLKQIISEKLSESKICENLDQIRICLNSNPVSWIKEFDNKTNDGXXXXXXXXXXXXXXAD----SSIVCLKCFRAFANCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILTILTFFDYKSYQNVMD----ALFRAAKLNNYENRFVPLIESAKKNAQMENENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQVFDELLCNPNLKLTHE---QINQFLXXXXXXXXXXXXXXXTIIRAFGDASDIFRIINRSVSNTKCEVNFRSILANLLIIRED-PIRDDLFRFIDEIVQEIILQDDSGFCPD 1299
            +LSE EI D FEK+++DMN+  ++++ +R K    K  M+   I++  K +T                     YV  L+  ISE     K+   L+ +R+ L SNPVSW+  F ++    L   L  L    +  +    +    ++C +AF N  YGL +++  + + L +AR + P+  ++M    EI+ IL+       +N++D    A+  AA+ NN E RF P++E  +      +E + L +A ++ IN +++ P     D   F    R+HLR EF+  GL ++       P LK T E   Q+  F    E +  E++ + + I     D  +++ +++  V +T  E  F SIL +LL+IR D  IR   ++ I+E V +I+L   SG  PD
Sbjct:   70 NLSEKEIVDLFEKMMEDMNLNEERKAPLRGKDLSTKREMVVQYISATAKSITGSKVAGGLRNSKHECTLSSQEYVHELRSGISE----DKLLNCLESLRVSLTSNPVSWVNNFGHEGLGLLLDALERLLDKKQQENIDKKNQHKLIQCLKAFMNNKYGLQRILGDERSLLLLARAIDPKQTNMM---TEIVKILSAVCIIGEENILDKILAAMTIAAERNNKE-RFAPIVEGLEN-----HEAQQLQVACMQLINALVTSP-----DDLDF----RIHLRNEFLRCGLKKIL------PELKETEELDIQLKVFNENKEEDSIELSHRLDDIRAEMDDMGEVYHLLSNMVKDTGSEPYFLSILQHLLLIRNDYYIRPQYYKVIEECVSQIVLH-RSGMDPD 441          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Zebrafish
Match: CABZ01057928.1 (protein diaphanous homolog 1-like [Source:NCBI gene;Acc:101882228])

HSP 1 Score: 196.438 bits (498), Expect = 8.850e-56
Identity = 99/272 (36.40%), Postives = 170/272 (62.50%), Query Frame = 1
Query: 2215 LKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSF-KGSAENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEF 3027
            +K  ILE++ ++LT++M++ LLK LPE EQ+  ++E+ D Y++L E EQF   +S++K+LKPRL +ILF+L+F++++N VK       AA  E+ KSE   K+LEI L LGN++N+GSRN ++ GF +++LCKL  TK     ++L+HFLAE             ++L +++KA++++ +    +L ++   +K++E  +++F    ++ D+F EKMT FV+T +E     +     M + ++ +  YF F+      EE F D+  F+T F
Sbjct:    1 MKTVILEVNETLLTENMVQSLLKLLPEQEQLNTLSEMKDEYEELAESEQFGVVISSVKRLKPRLTAILFKLQFEEQVNNVKPDVVAVTAACEELRKSESFAKLLEITLLLGNFLNAGSRNAKAFGFSVSYLCKLRDTKSADQKQTLLHFLAETCQEQYPEVMTFPEELIHVEKASKVSAETLQKSLDQMGKQIKSLEKDIETFPPPQSDKDKFVEKMTSFVSTARENFEKLQLLHENMEKQYEDLGKYFVFDPKKMTPEEFFGDLNNFRTMF 272          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Xenopus
Match: DIAPH2 (diaphanous related formin 2 [Source:NCBI gene;Acc:100485481])

HSP 1 Score: 264.618 bits (675), Expect = 8.601e-73
Identity = 167/458 (36.46%), Postives = 268/458 (58.52%), Query Frame = 1
Query: 1924 YGLK-RNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIPT-DILKELENNFSXXXXXXXXXXXX--------XXXXXXPKILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSF-KGSAENDRFSEKMTP--FVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFNXXXXXXXXXXXXXXXXXXRREKE------KQMPVMSKTTSEEDSGVIDNLLAVLKSGDGALSPKRRKPKS 3240
            +G+K + +Y+PE  MK+ NW+K+  + ++E  +W+  KE+     +I   L   F+T +   K                VKE ++LD KTAQN+SI LGS RM YE++K  ILE+D   L++S+I+ L+KNLPE +++  +++L   Y+DL E EQF   +S IK L+ RL  ILF+L FD+ I+ +K        A  E+ KSE  KKI+E+VL +GNYMNSGSRN QS+GF ++FLCK+  TK      +L+HFLAEI         +   +L +++ A++++     S+L  ++  +K +E  +K+F K    ND+F EKMT   F    +EQ          MN+ + ++  Y TF++    +EE F D++ F+T F+EA K N +++ +EE+  +AK+ KE+ E+E      K+  ++      +++GV+D+LL  L+SG      ++R PK+
Sbjct:  573 FGMKPKKIYKPETNMKRINWSKVEPQDITETCIWVKAKEDHFENPEIFTRLSQMFATHMKAKKATEQAEENKPTLIKKKVKELRVLDSKTAQNLSIFLGSYRMSYEEIKSMILEVDEEKLSESLIQNLIKNLPEQKELSALSQLKSEYEDLCEPEQFGVVMSTIKMLRSRLNGILFKLTFDEHISNIKPDIIAVTLACEELKKSESFKKIVELVLLVGNYMNSGSRNAQSLGFNVSFLCKIRDTKSSDQKTTLLHFLAEICEERFKEILKFPDELEHVESASKVSAQNLKSSLDAMEHQIKRLEGDIKNFTKTDNPNDKFVEKMTTYIFAKGAREQYEKLSNMYNHMNKLYDNLGDYLTFDAKAVSVEEFFGDLSSFRTLFLEAVKENNKRREMEEKMKRAKIAKEKAEREKLERQHKKKQLIDINKEGDETGVMDSLLEALQSGAAFRDRRKRTPKT 1030          

HSP 2 Score: 120.553 bits (301), Expect = 7.179e-27
Identity = 116/413 (28.09%), Postives = 196/413 (47.46%), Query Frame = 1
Query:  193 SLSENEINDKFEKLLDDMNIPIDKRSVIREKTQEQKLVMLKSCITSQIKPVTY-------------YVELLKQIISEKLSESKICENLDQIRICLNSNPVSWIKEFDNKTNDGXXXXXXXXXXXXXXADS-----SIVCLKCFRAFANCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILTILTFFDYKSYQNVMDALFR----AAKLNNYENRFVPLIESAKKNAQMEN-ENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQ------------------VFDELLCNPNLKLTHEQINQFLXXXXXXXXXXXXXXXTIIRAFGDAS--DIFRIINRSVSNTKCEVNFRSILANLLIIRED-PIRDDLFRFIDEIVQEIILQDDSGFCPD 1299
            +LSE EI D FEK+++DMN+  ++++ +R+K   +K  M+   I++  K                 YV  L+  I+++    K+   L+ +R+ L SNPVSW+  F ++   GL L +       +  +S         ++C +AF N  YGL ++++ D + L +AR + P+  ++M    EIL IL+        N++D L      AA+++N E RF P++E+      +EN E   L  + ++FIN +++ P        + D  +R+HLR EF+  GL Q                  VFDE      L+L+H   +                    IRA  +     ++ ++   + +T  E  F+SIL + L+IR D  IR   ++ IDE V +++LQ  SG  PD
Sbjct:   59 NLSEKEIMDLFEKMMEDMNLNEERKAPLRQKDLTRKHEMVVQYISATAKSGGLKNSKHECTLSSQEYVHELRSGITDE----KLLNCLESLRVSLTSNPVSWVNNFGHE-GLGLLLDVLEKLLDKKQQESIDKKNQHKLIQCLKAFMNNKYGLQRILSEDRSLLLLARAIDPKQANMM---TEILKILSAICIIGEDNILDKLLEAITTAAEIHNKE-RFAPIVEA------LENHEAFQLQASCMQFINALLTSP-------EELD--FRIHLRNEFLRCGLKQILPELKEKENEELDIQLKVFDENKEEDLLELSHRLRD--------------------IRAEMEYPFIQLYHLLYNMLKDTASETYFQSILQHFLLIRNDYYIRPQYYKVIDECVGQVVLQ-CSGMDPD 426          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Xenopus
Match: DIAPH2 (diaphanous related formin 2 [Source:NCBI gene;Acc:100485481])

HSP 1 Score: 259.225 bits (661), Expect = 4.295e-71
Identity = 165/456 (36.18%), Postives = 267/456 (58.55%), Query Frame = 1
Query: 1924 YGLK-RNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIPT-DILKELENNFSXXXXXXXXXXXX--------XXXXXXPKILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSF-KGSAENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFNXXXXXXXXXXXXXXXXXXRREKE------KQMPVMSKTTSEEDSGVIDNLLAVLKSGDGALSPKRRKPKS 3240
            +G+K + +Y+PE  MK+ NW+K+  + ++E  +W+  KE+     +I   L   F+T +   K                VKE ++LD KTAQN+SI LGS RM YE++K  ILE+D   L++S+I+ L+KNLPE +++  +++L   Y+DL E EQF   +S IK L+ RL  ILF+L FD+ I+ +K        A  E+ KSE  KKI+E+VL +GNYMNSGSRN QS+GF ++FLCK+  TK      +L+HFLAEI         +   +L +++ A++++     S+L  ++  +K +E  +K+F K    ND+F EKM+      +EQ          MN+ + ++  Y TF++    +EE F D++ F+T F+EA K N +++ +EE+  +AK+ KE+ E+E      K+  ++      +++GV+D+LL  L+SG      ++R PK+
Sbjct:  563 FGMKPKKIYKPETNMKRINWSKVEPQDITETCIWVKAKEDHFENPEIFTRLSQMFATHMKAKKATEQAEENKPTLIKKKVKELRVLDSKTAQNLSIFLGSYRMSYEEIKSMILEVDEEKLSESLIQNLIKNLPEQKELSALSQLKSEYEDLCEPEQFGVVMSTIKMLRSRLNGILFKLTFDEHISNIKPDIIAVTLACEELKKSESFKKIVELVLLVGNYMNSGSRNAQSLGFNVSFLCKIRDTKSSDQKTTLLHFLAEICEERFKEILKFPDELEHVESASKVSAQNLKSSLDAMEHQIKRLEGDIKNFTKTDNPNDKFVEKMS-ISFLYREQYEKLSNMYNHMNKLYDNLGDYLTFDAKAVSVEEFFGDLSSFRTLFLEAVKENNKRREMEEKMKRAKIAKEKAEREKLERQHKKKQLIDINKEGDETGVMDSLLEALQSGAAFRDRRKRTPKT 1017          

HSP 2 Score: 120.168 bits (300), Expect = 9.157e-27
Identity = 113/412 (27.43%), Postives = 195/412 (47.33%), Query Frame = 1
Query:  193 SLSENEINDKFEKLLDDMNIPIDKRSVIREKTQEQKLVMLKSCITSQIKPVTY-------------YVELLKQIISEKLSESKICENLDQIRICLNSNPVSWIKEFDNKTNDGXXXXXXXXXXXXXXADS-----SIVCLKCFRAFANCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILTILTFFDYKSYQNVMDALFR----AAKLNNYENRFVPLIESAKKNAQMENENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQ------------------VFDELLCNPNLKLTHEQINQFLXXXXXXXXXXXXXXXTIIRAFGDAS--DIFRIINRSVSNTKCEVNFRSILANLLIIRED-PIRDDLFRFIDEIVQEIILQDDSGFCPD 1299
            +LSE EI D FEK+++DMN+  ++++ +R+K   +K  M+   I++  K                 YV  L+  I+++    K+   L+ +R+ L SNPVSW+  F ++   GL L +       +  +S         ++C +AF N  YGL ++++ D + L +AR + P+  ++M    EIL IL+        N++D L      AA+++N E RF P++E+ + +   +     L  + ++FIN +++ P        + D  +R+HLR EF+  GL Q                  VFDE      L+L+H   +                    IRA  +     ++ ++   + +T  E  F+SIL + L+IR D  IR   ++ IDE V +++LQ  SG  PD
Sbjct:   49 NLSEKEIMDLFEKMMEDMNLNEERKAPLRQKDLTRKHEMVVQYISATAKSGGLKNSKHECTLSSQEYVHELRSGITDE----KLLNCLESLRVSLTSNPVSWVNNFGHE-GLGLLLDVLEKLLDKKQQESIDKKNQHKLIQCLKAFMNNKYGLQRILSEDRSLLLLARAIDPKQANMM---TEILKILSAICIIGEDNILDKLLEAITTAAEIHNKE-RFAPIVEALENHEAFQ-----LQASCMQFINALLTSP-------EELD--FRIHLRNEFLRCGLKQILPELKEKENEELDIQLKVFDENKEEDLLELSHRLRD--------------------IRAEMEYPFIQLYHLLYNMLKDTASETYFQSILQHFLLIRNDYYIRPQYYKVIDECVGQVVLQ-CSGMDPD 416          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Xenopus
Match: atrn (attractin [Source:Xenbase;Acc:XB-GENE-953934])

HSP 1 Score: 243.432 bits (620), Expect = 1.767e-65
Identity = 164/477 (34.38%), Postives = 267/477 (55.97%), Query Frame = 1
Query: 1903 PPSTLEKYGLK-RNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIP-TDILKELENNFSXXXXXXXXXXXXXXXXXXPKILD--------GKTAQNI-SILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSFKGSAE-NDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFNXXXXXXXXXXXXXXXXXXRREKE------KQMPVMSKTTSEEDSGVIDNLLAVLKSGDGALSPKRRKPKSKDARRQLNRSRSR 3279
            PP     +GLK +  ++PE  MK+ NW KI    ++E+  WL+ KEE     ++  +LEN FS +        +        KIL+        G     I +I LGS R+ YE++K+ ILEID + L++SM++ L+KN+P   Q+  +A L   Y  L E EQF   +S++KKL PRL +ILF+L+F++++N +K        A  EI KS+   K+LEIVL +GNYMN+GSRN Q+ GF L+ LCKL  TK    N +L+HFLA+I ++   +     +D+  +DKA++++ +    T+ +++  L+ +E  L++F  S + +D+F  K++  V   +E++         M++ +Q +  Y+  +S    +EE F D+  F+T F++A K N  +K  EE+  + K  KE  EKE      K+  ++ K    E++GV+D+LL  L+SG      ++R P+ KD    ++ S  R
Sbjct:  541 PPMQSLPFGLKPKKEFKPEVVMKRLNWQKITPNEMTESCFWLTAKEEGYEDKELFFQLENTFSCQRKGGYCFIITEKKEISFKILNYVIKMESMGDRLSVIRTIFLGSYRLPYEEIKKIILEIDETQLSESMVQNLIKNMPAQTQLNSLANLKSEYLSLSEPEQFGVVMSSVKKLIPRLNAILFRLQFEEQVNNIKPDIMAVSEACEEIKKSKSFGKLLEIVLLIGNYMNAGSRNAQTFGFCLSSLCKLKDTKSADQNTTLLHFLADICDKRFPDIKIFVEDVQTVDKASKVSAENLEKTMKQMERQLQQLEKDLETFPLSDDAHDKFVTKISFVVCWYEEKL---SRMYENMDKLYQGLMEYYVLDSKKVSVEEFFTDVNNFRTMFMQASKENIRRKEAEEKQKRVKQAKEMAEKEKLERQLKKKRLLEKNREGEETGVMDSLLEALQSGAAFRDRRKRTPRPKDWHENISPSSER 1014          

HSP 2 Score: 93.9745 bits (232), Expect = 9.895e-19
Identity = 105/386 (27.20%), Postives = 174/386 (45.08%), Query Frame = 1
Query:  196 LSENEINDKFEKLLDDMNIPIDKRSVIREKTQEQKLVMLKSCITS-----------QIKPVTYYVELLKQIISEKLSESKICENLDQIRICLNSNPVSWIKEFDNKTNDGXXXXXXXXXXXXXXADSSIVCLKCFRAFANCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILT-ILTFFDYKSYQNVMDALFRAAKLNNYENRFVPLIESAKKNAQMENENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQVFDELLCNPNLKLTHEQINQFLXXXXXXXXXXXXXXXTIIRAFGDASDIFRIINRSVSNTKCEVNFRSILANLLIIREDPI-RDDLFRFIDEIVQEIILQDDSGFCPDPTLKK 1314
            LSE E+   FEK+++DMN+  +K++ +REK    K  M+   I++           QI P  +  EL      E+L        LD +R+ L SNPVSW++ F +     L  +L  +          I    CF  F    YGL +++  + +   +A+ + P+  ++M   V++L+ I    +  + + V++A+  AA+      RF P++     N         L +A ++ IN +++ P     D   F    RLH+R EF+ +GL ++  +L    N  L   Q+  F             K E +I       DI   +    +N   E  F SIL +LL+IR D   +   F+ I+E + +I+L   SG  PD T +K
Sbjct:   63 LSEKEVLPLFEKMMEDMNLNEEKKAPLREKDFATKKEMVLQYISTASKAGSLRSSRQISPQEFIHELKSGAADERL-----VSYLDSLRVSLTSNPVSWVESFGHDGLGLLLDILERMVNGKRYV--LIFSCPCFCLFQ---YGLERILGEERSLSLLAKAMDPKQANMMTDVVKLLSAICIVGEENTLEKVLEAITAAAEERGI-IRFSPIVGGLHHNLI------QLQVACMQLINALVTSP-----DDLDF----RLHIRNEFMRSGLKEILPQLKHVKNDALDI-QLRVF----------EEHKEEDMIEFSHRLDDIRSEMEYPYTN--AEGYFLSILQHLLLIRNDYFAKPQYFKIIEESISQIVLH-RSGIDPDFTYRK 408          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Xenopus
Match: DIAPH1 (diaphanous related formin 1 [Source:NCBI gene;Acc:733754])

HSP 1 Score: 237.654 bits (605), Expect = 2.139e-65
Identity = 160/465 (34.41%), Postives = 257/465 (55.27%), Query Frame = 1
Query: 1924 YGL--KRNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIPT-DILKELENNFSXXXXXXXXXXXXXXXXXXP------KILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSFKGSA-ENDRFSEKMT-PFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFNXXXXXXXXXXXXXXXXXXRREKE------KQMPVMSKTTSEEDSGVIDNLLAVLKSGDGALSPKRRKPKSKDARRQLNR 3267
            +GL  K+N Y+PE  +K+ NW+KI    LSE S W   KE+     ++  ++   FS+++   K +        +       K+LD KTAQN+SI LGS RM YE++K  IL+++  +LT+SM+  L+K LPE +Q+Q + E  + YKDL E EQF   + ++ +L+PRL +ILF+L F+++I  +K       AA  E+ K +    +LEI L +GN+MN+GSRN  + GF+++FLCKL  TK      +L+HFL E       +  +   ++ +++KA+R++ +     L ++K  +  ++  + SF  +  E D+F EKMT  F   + +           M   FQ +  YF F+     IEE F D+  F+  F+ A K N++++  EE+  +AKL KE+ EKE      K+  ++      +++GV+D+LL  L S  GA   ++R P      RQ NR
Sbjct:  231 FGLAPKKN-YKPEVQLKRPNWSKITPAELSEKSFWTQTKEDRFEKEELFAKITLTFSSQIKSKKAEDGDDKKAAQKKKTKELKVLDSKTAQNLSIFLGSFRMPYEEIKNVILQVNEEVLTESMVSNLIKQLPEPDQLQMLTEFKNEYKDLAEPEQFGVVMCSVPRLRPRLNAILFKLLFNEQIENIKPDIVSVTAACEEVQKCQSFASLLEITLLVGNFMNAGSRNADAYGFDISFLCKLKDTKSADQKTTLLHFLVETCENDYPDVLKFPDEMVHVEKASRVSAETLQKNLDQMKKQIADLQRDIDSFPPTEDEKDKFVEKMTISFYYKLIKIYTKLCMMHENMLSLFQDLGKYFVFDPKKTSIEEFFADLQNFRNMFLHALKENQKRREAEEKMKRAKLAKEKAEKERLEKQQKKEQLIDMNAEGDETGVMDSLLEALNS--GAAFRRKRGP------RQANR 686          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Xenopus
Match: atrn (attractin [Source:Xenbase;Acc:XB-GENE-953934])

HSP 1 Score: 241.891 bits (616), Expect = 6.032e-65
Identity = 163/467 (34.90%), Postives = 267/467 (57.17%), Query Frame = 1
Query: 1903 PPSTLEKYGLK-RNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIP-TDILKELENNFSXXXXXXXXXXXXXXXXXXPKILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSFKGSAENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFNXXXXXXXXXXXXXXXXXXRREKE------KQMPVMSKTTSEEDSGVIDNLLAVLKSGDGALSPKRRKPKSKDARRQLNRSRSR 3279
            PP     +GLK +  ++PE  MK+ NW KI    ++E+  WL+ KEE     ++  +LEN FS +  V + K       ++ +I         SI LGS R+ YE++K+ ILEID + L++SM++ L+KN+P   Q+  +A L   Y  L E EQF   +S++KKL PRL +ILF+L+F++++N +K        A  EI KS+   K+LEIVL +GNYMN+GSRN Q+ GF L+ LCKL  TK    N +L+HFLA+I ++   +     +D+  +DKA++++ +    T+ +++  L+ +E  L++F  S   D   +K   FVT +++   ++  ++  M++ +Q +  Y+  +S    +EE F D+  F+T F++A K N  +K  EE+  + K  KE  EKE      K+  ++ K    E++GV+D+LL  L+SG      ++R P+ KD    ++ S  R
Sbjct:  606 PPMQSLPFGLKPKKEFKPEVVMKRLNWQKITPNEMTESCFWLTAKEEGYEDKELFFQLENTFSCQRKVYRIKESTKLTPRKERIK--------SIFLGSYRLPYEEIKKIILEIDETQLSESMVQNLIKNMPAQTQLNSLANLKSEYLSLSEPEQFGVVMSSVKKLIPRLNAILFRLQFEEQVNNIKPDIMAVSEACEEIKKSKSFGKLLEIVLLIGNYMNAGSRNAQTFGFCLSSLCKLKDTKSADQNTTLLHFLADICDKRFPDIKIFVEDVQTVDKASKVSAENLEKTMKQMERQLQQLEKDLETFPLS---DDAHDK---FVTKIEQFKKLSRMYEN-MDKLYQGLMEYYVLDSKKVSVEEFFTDVNNFRTMFMQASKENIRRKEAEEKQKRVKQAKEMAEKEKLERQLKKKRLLEKNREGEETGVMDSLLEALQSGAAFRDRRKRTPRPKDWHENISPSSER 1057          

HSP 2 Score: 120.553 bits (301), Expect = 6.519e-27
Identity = 113/401 (28.18%), Postives = 193/401 (48.13%), Query Frame = 1
Query:  196 LSENEINDKFEKLLDDMNIPIDKRSVIREKTQEQKLVMLKSCITS-----------QIKPVTYYVELLKQIISEKLSESKICENLDQIRICLNSNPVSWIKEFDNKTNDGXXXXXXXX--XXXXXXADSSIV--CLKCFRAFANCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILT-ILTFFDYKSYQNVMDALFRAAKLNNYENRFVPLIESAKKNAQMENENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQVFDELLCNPNLKL----------THEQINQFLXXXXXXXXXXXXXXXTIIRA-FGDASDIFRIINRSVSNTKCEVNFRSILANLLIIREDPI-RDDLFRFIDEIVQEIILQDDSGFCPDPTLKK 1314
            LSE E+   FEK+++DMN+  +K++ +REK    K  M+   I++           QI P  +  EL      E+L        LD +R+ L SNPVSW++ F +     L  +L  +     TE  +  I    ++C +AF N  YGL +++  + +   +A+ + P+  ++M   V++L+ I    +  + + V++A+  AA+      RF P++     N         L +A ++ IN +++ P     D   F    RLH+R EF+ +GL ++  +L    N  L            E + +F    ++   E+     TI++    DASD+F ++  SV +T  E  F SIL +LL+IR D   +   F+ I+E + +I+L   SG  PD T +K
Sbjct:   91 LSEKEVLPLFEKMMEDMNLNEEKKAPLREKDFATKKEMVLQYISTASKAGSLRSSRQISPQEFIHELKSGAADERL-----VSYLDSLRVSLTSNPVSWVESFGHDGLGLLLDILERMVNGKRTEKIEKRIQHKAIQCLKAFMNNKYGLERILGEERSLSLLAKAMDPKQANMMTDVVKLLSAICIVGEENTLEKVLEAITAAAEERGI-IRFSPIVGGLHHNLI------QLQVACMQLINALVTSP-----DDLDF----RLHIRNEFMRSGLKEILPQLKHVKNDALDIQLRVFEEHKEEDMIEFSHRLDDIRSEMEYPCVTILKWNITDASDVFNMVWNSVRDTNAEGYFLSILQHLLLIRNDYFAKPQYFKIIEESISQIVLH-RSGIDPDFTYRK 469          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Mouse
Match: Diaph2 (diaphanous related formin 2 [Source:MGI Symbol;Acc:MGI:1858500])

HSP 1 Score: 295.049 bits (754), Expect = 5.562e-83
Identity = 181/472 (38.35%), Postives = 284/472 (60.17%), Query Frame = 1
Query: 1924 YGLK-RNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIP-TDILKELENNFSXXXXXXXXXXXXXXXXXXP--------KILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSF-KGSAENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFNXXXXXXXXXXXXXXXXX--------XRREKEKQMPVMSKTTSEEDSGVIDNLLAVLKSGDGALSPKRRKPKSKDARR-QLNRSRSR 3279
            YG+K + +Y+P+ PMK+ NW+KI  K LSEN VWL +KEE     D+  +L   F +++   +           P        +ILD KTAQN+SI LGS RM YE++K  ILE++  +L++++I+ L+K LP+   ++++A+L   Y DL E EQF   +S +K L+PRL SILF+L F++ +N +K        A  E+ KSE  K++LE++L +GNYMNSGSRN QS+GF++NFLCK+  TK      +L+HFLAEI +    +  +   +L +++ A +++     S L  ++  +  +E  +K+F    + +D+F EKM  F    +EQ     T  + M + ++S+  YF F+ +T  +EE F D+  F+T F+EA K N ++K +EE++ +AKL K        ER++K+KQ+  ++K   E  +GV+DNLL  L+SG      ++R P++ D RR  L RSRSR
Sbjct:  625 YGMKQKKLYKPDIPMKRINWSKIEPKELSENCVWLKLKEEKYENADLFAKLALTFPSQMKGQRNTEAAEENRSGPPKKKVKELRILDTKTAQNLSIFLGSYRMPYEEIKNIILEVNEEMLSEALIQNLVKYLPDQNALRELAQLKSEYDDLCEPEQFGVVMSTVKMLRPRLTSILFKLTFEEHVNNIKPSIIAVTLACEELKKSESFKRLLELILLVGNYMNSGSRNAQSLGFKINFLCKIKDTKSADQKSTLLHFLAEICDEKYRDILKFPDELEHVESAGKVSAQILKSNLVAMEQSILHLEKNIKNFPPAESHHDKFVEKMMSFTQNAREQYDKLSTMHSNMLKLYESLGEYFIFDPNTVNMEEFFGDLNTFRTLFLEALKENHKRKEMEEKSRRAKLAKEKAEQEKLERQKKKKQLIDINKEGDE--TGVMDNLLEALQSGAAFRDRRKRIPRNPDNRRPPLERSRSR 1094          

HSP 2 Score: 120.939 bits (302), Expect = 3.498e-27
Identity = 110/392 (28.06%), Postives = 192/392 (48.98%), Query Frame = 1
Query:  196 LSENEINDKFEKLLDDMNIPIDKRSVIREKTQEQKLVMLKSCITSQIKPVTY-------------YVELLKQIISEKLSESKICENLDQIRICLNSNPVSWIKEFDNKTN----DGXXXXXXXXXXXXXXADSSIVCLKCFRAFANCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILTILTFFDYKSYQNVMDALF----RAAKLNNYENRFVPLIESAKKNAQMENENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQVFDEL--LCNPNLKLTHEQINQFLXXXXXXXXXXXXXXXTIIRAFGDASDIFRIINRSVSNTKCEVNFRSILANLLIIRED-PIRDDLFRFIDEIVQEIILQDDSGFCPD 1299
            LSE E+ D FEK+++DMN+  +K++ +R+K    K  M+   I++  K                 YV  L+  IS++    K+   L+ +R+ L S+PVSW+  F  +      D L  LL           +    ++C +AF N  +GL +++  + + L +AR + P+  ++M    EI+ IL+       +N++D L      AA+LNN E RF P++E  + N  +      L +A ++FIN +++ P         +D  +R+HLR EF+  GL  +   L  + N  L +   Q+  F    E++  E++ +   I     D ++++ ++   + +T  E    SIL + L+IR D  IR   ++ I+E V +I+L   SG  PD
Sbjct:  104 LSEKEVLDLFEKMMEDMNLNEEKKAPLRKKDFSIKREMVVQYISATSKSGGLKNSKHEFTLSSQEYVHELRSGISDE----KLLNCLESLRVSLTSHPVSWVNNFGYEGLGVLLDVLEKLLDKKQQENIDKKNQYKVIQCLKAFMNNKFGLQRILGDERSLLLLARAIDPKQQNMM---TEIVKILSAICIVGEENILDKLLGGITAAAELNNRE-RFSPIVEGLENNEALH-----LQVACMQFINALVTSP---------YDLDFRIHLRNEFLRCGLKAMLPTLKEIENEGLDI---QLRVFEENKEDDLSELSHRLNDIRAEMDDINEVYHLLYNMLKDTAAEPYLLSILQHFLLIRNDYYIRPQYYKIIEECVSQIVLH-CSGMDPD 469          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Mouse
Match: Diaph2 (diaphanous related formin 2 [Source:MGI Symbol;Acc:MGI:1858500])

HSP 1 Score: 294.664 bits (753), Expect = 7.008e-83
Identity = 181/472 (38.35%), Postives = 284/472 (60.17%), Query Frame = 1
Query: 1924 YGLK-RNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIP-TDILKELENNFSXXXXXXXXXXXXXXXXXXP--------KILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSF-KGSAENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFNXXXXXXXXXXXXXXXXX--------XRREKEKQMPVMSKTTSEEDSGVIDNLLAVLKSGDGALSPKRRKPKSKDARR-QLNRSRSR 3279
            YG+K + +Y+P+ PMK+ NW+KI  K LSEN VWL +KEE     D+  +L   F +++   +           P        +ILD KTAQN+SI LGS RM YE++K  ILE++  +L++++I+ L+K LP+   ++++A+L   Y DL E EQF   +S +K L+PRL SILF+L F++ +N +K        A  E+ KSE  K++LE++L +GNYMNSGSRN QS+GF++NFLCK+  TK      +L+HFLAEI +    +  +   +L +++ A +++     S L  ++  +  +E  +K+F    + +D+F EKM  F    +EQ     T  + M + ++S+  YF F+ +T  +EE F D+  F+T F+EA K N ++K +EE++ +AKL K        ER++K+KQ+  ++K   E  +GV+DNLL  L+SG      ++R P++ D RR  L RSRSR
Sbjct:  621 YGMKQKKLYKPDIPMKRINWSKIEPKELSENCVWLKLKEEKYENADLFAKLALTFPSQMKGQRNTEAAEENRSGPPKKKVKELRILDTKTAQNLSIFLGSYRMPYEEIKNIILEVNEEMLSEALIQNLVKYLPDQNALRELAQLKSEYDDLCEPEQFGVVMSTVKMLRPRLTSILFKLTFEEHVNNIKPSIIAVTLACEELKKSESFKRLLELILLVGNYMNSGSRNAQSLGFKINFLCKIKDTKSADQKSTLLHFLAEICDEKYRDILKFPDELEHVESAGKVSAQILKSNLVAMEQSILHLEKNIKNFPPAESHHDKFVEKMMSFTQNAREQYDKLSTMHSNMLKLYESLGEYFIFDPNTVNMEEFFGDLNTFRTLFLEALKENHKRKEMEEKSRRAKLAKEKAEQEKLERQKKKKQLIDINKEGDE--TGVMDNLLEALQSGAAFRDRRKRIPRNPDNRRPPLERSRSR 1090          

HSP 2 Score: 120.168 bits (300), Expect = 7.142e-27
Identity = 110/399 (27.57%), Postives = 193/399 (48.37%), Query Frame = 1
Query:  196 LSENEINDKFEKLLDDMNIPIDKRSVIREKTQEQKLVMLKSCITSQIKPVTY--------------------YVELLKQIISEKLSESKICENLDQIRICLNSNPVSWIKEFDNKTN----DGXXXXXXXXXXXXXXADSSIVCLKCFRAFANCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILTILTFFDYKSYQNVMDALF----RAAKLNNYENRFVPLIESAKKNAQMENENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQVFDEL--LCNPNLKLTHEQINQFLXXXXXXXXXXXXXXXTIIRAFGDASDIFRIINRSVSNTKCEVNFRSILANLLIIRED-PIRDDLFRFIDEIVQEIILQDDSGFCPD 1299
            LSE E+ D FEK+++DMN+  +K++ +R+K    K  M+   I++  K +                      YV  L+  IS++    K+   L+ +R+ L S+PVSW+  F  +      D L  LL           +    ++C +AF N  +GL +++  + + L +AR + P+  ++M    EI+ IL+       +N++D L      AA+LNN E RF P++E  + N  +      L +A ++FIN +++ P         +D  +R+HLR EF+  GL  +   L  + N  L +   Q+  F    E++  E++ +   I     D ++++ ++   + +T  E    SIL + L+IR D  IR   ++ I+E V +I+L   SG  PD
Sbjct:   93 LSEKEVLDLFEKMMEDMNLNEEKKAPLRKKDFSIKREMVVQYISATSKSIVGSKVLGGLKNSKHEFTLSSQEYVHELRSGISDE----KLLNCLESLRVSLTSHPVSWVNNFGYEGLGVLLDVLEKLLDKKQQENIDKKNQYKVIQCLKAFMNNKFGLQRILGDERSLLLLARAIDPKQQNMM---TEIVKILSAICIVGEENILDKLLGGITAAAELNNRE-RFSPIVEGLENNEALH-----LQVACMQFINALVTSP---------YDLDFRIHLRNEFLRCGLKAMLPTLKEIENEGLDI---QLRVFEENKEDDLSELSHRLNDIRAEMDDINEVYHLLYNMLKDTAAEPYLLSILQHFLLIRNDYYIRPQYYKIIEECVSQIVLH-CSGMDPD 465          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Mouse
Match: Diaph2 (diaphanous related formin 2 [Source:MGI Symbol;Acc:MGI:1858500])

HSP 1 Score: 293.893 bits (751), Expect = 1.514e-82
Identity = 181/472 (38.35%), Postives = 284/472 (60.17%), Query Frame = 1
Query: 1924 YGLK-RNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIP-TDILKELENNFSXXXXXXXXXXXXXXXXXXP--------KILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSF-KGSAENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFNXXXXXXXXXXXXXXXXX--------XRREKEKQMPVMSKTTSEEDSGVIDNLLAVLKSGDGALSPKRRKPKSKDARR-QLNRSRSR 3279
            YG+K + +Y+P+ PMK+ NW+KI  K LSEN VWL +KEE     D+  +L   F +++   +           P        +ILD KTAQN+SI LGS RM YE++K  ILE++  +L++++I+ L+K LP+   ++++A+L   Y DL E EQF   +S +K L+PRL SILF+L F++ +N +K        A  E+ KSE  K++LE++L +GNYMNSGSRN QS+GF++NFLCK+  TK      +L+HFLAEI +    +  +   +L +++ A +++     S L  ++  +  +E  +K+F    + +D+F EKM  F    +EQ     T  + M + ++S+  YF F+ +T  +EE F D+  F+T F+EA K N ++K +EE++ +AKL K        ER++K+KQ+  ++K   E  +GV+DNLL  L+SG      ++R P++ D RR  L RSRSR
Sbjct:  625 YGMKQKKLYKPDIPMKRINWSKIEPKELSENCVWLKLKEEKYENADLFAKLALTFPSQMKGQRNTEAAEENRSGPPKKKVKELRILDTKTAQNLSIFLGSYRMPYEEIKNIILEVNEEMLSEALIQNLVKYLPDQNALRELAQLKSEYDDLCEPEQFGVVMSTVKMLRPRLTSILFKLTFEEHVNNIKPSIIAVTLACEELKKSESFKRLLELILLVGNYMNSGSRNAQSLGFKINFLCKIKDTKSADQKSTLLHFLAEICDEKYRDILKFPDELEHVESAGKVSAQILKSNLVAMEQSILHLEKNIKNFPPAESHHDKFVEKMMIFTQNAREQYDKLSTMHSNMLKLYESLGEYFIFDPNTVNMEEFFGDLNTFRTLFLEALKENHKRKEMEEKSRRAKLAKEKAEQEKLERQKKKKQLIDINKEGDE--TGVMDNLLEALQSGAAFRDRRKRIPRNPDNRRPPLERSRSR 1094          

HSP 2 Score: 120.553 bits (301), Expect = 5.315e-27
Identity = 110/392 (28.06%), Postives = 192/392 (48.98%), Query Frame = 1
Query:  196 LSENEINDKFEKLLDDMNIPIDKRSVIREKTQEQKLVMLKSCITSQIKPVTY-------------YVELLKQIISEKLSESKICENLDQIRICLNSNPVSWIKEFDNKTN----DGXXXXXXXXXXXXXXADSSIVCLKCFRAFANCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILTILTFFDYKSYQNVMDALF----RAAKLNNYENRFVPLIESAKKNAQMENENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQVFDEL--LCNPNLKLTHEQINQFLXXXXXXXXXXXXXXXTIIRAFGDASDIFRIINRSVSNTKCEVNFRSILANLLIIRED-PIRDDLFRFIDEIVQEIILQDDSGFCPD 1299
            LSE E+ D FEK+++DMN+  +K++ +R+K    K  M+   I++  K                 YV  L+  IS++    K+   L+ +R+ L S+PVSW+  F  +      D L  LL           +    ++C +AF N  +GL +++  + + L +AR + P+  ++M    EI+ IL+       +N++D L      AA+LNN E RF P++E  + N  +      L +A ++FIN +++ P         +D  +R+HLR EF+  GL  +   L  + N  L +   Q+  F    E++  E++ +   I     D ++++ ++   + +T  E    SIL + L+IR D  IR   ++ I+E V +I+L   SG  PD
Sbjct:  104 LSEKEVLDLFEKMMEDMNLNEEKKAPLRKKDFSIKREMVVQYISATSKSGGLKNSKHEFTLSSQEYVHELRSGISDE----KLLNCLESLRVSLTSHPVSWVNNFGYEGLGVLLDVLEKLLDKKQQENIDKKNQYKVIQCLKAFMNNKFGLQRILGDERSLLLLARAIDPKQQNMM---TEIVKILSAICIVGEENILDKLLGGITAAAELNNRE-RFSPIVEGLENNEALH-----LQVACMQFINALVTSP---------YDLDFRIHLRNEFLRCGLKAMLPTLKEIENEGLDI---QLRVFEENKEDDLSELSHRLNDIRAEMDDINEVYHLLYNMLKDTAAEPYLLSILQHFLLIRNDYYIRPQYYKIIEECVSQIVLH-CSGMDPD 469          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Mouse
Match: Diaph3 (diaphanous related formin 3 [Source:MGI Symbol;Acc:MGI:1927222])

HSP 1 Score: 270.396 bits (690), Expect = 2.669e-74
Identity = 167/462 (36.15%), Postives = 272/462 (58.87%), Query Frame = 1
Query: 1924 YGLK-RNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIPT-DILKELENNFSXXXXXXX------XXXXXXXXXXXPKILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSFKGSAE-NDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFNXXXXXXXXXXXXXXXXXXRREKEK------QMPVMSKTTSEEDSGVIDNLLAVLKSGDGALSPKRRKPKSKDARRQLN 3264
            +GLK +  ++PE  M++ NW KI    +SEN  W+ + E      D+L +LEN F  +    +      EK V    +KE K LD K AQN+SI L S R+ YEK++  ILE+D + L++SMI+ L+K+LP+ EQ++ +++    Y  L E EQF   +SN+K+L+PRL +ILF+L+F++++N +K        A  EI KS+   K+LE+VL +GNYMN+GSRN Q+ GF+L+ LCKL  TK      +L+HFL ++      +      DL+++DKA+R++++     + ++   L+ +E  L++F    + +D+F  KM+ FV +  EQ     T    M + +QS+  Y+  +     +EE FND+  F+T F+ A K N +K+   E+  +A++ KER EKE+      +  ++   T  +++GV+D+LL  L+SG      ++R PK KD R+ L+
Sbjct:  611 FGLKPKKEFKPEISMRRLNWLKIGPNEMSENCFWIKVNENKYENRDLLCKLENTFCCQEKEKRNTNDFDEKKVIKKRMKELKFLDPKIAQNLSIFLSSFRVPYEKIRTMILEVDETQLSESMIQNLIKHLPDEEQLKSLSQFRSDYNSLCEPEQFAVVMSNVKRLRPRLSAILFKLQFEEQVNNIKPDIMAVSTACEEIKKSKGFSKLLELVLLMGNYMNAGSRNAQTFGFDLSSLCKLKDTKSADQKTTLLHFLVDVCEEKHADILHFVDDLAHLDKASRVSVEMLEKNVKQMGRQLQQLEKNLETFPPPEDLHDKFVIKMSSFVISANEQYEKLSTLLGSMTQLYQSIMGYYAVDMKKVSVEEFFNDLNNFRTSFMLALKENIKKREAAEKEKRARIAKERAEKERLERQQEKKRLLEMKTEGDETGVMDSLLEALQSGAAFRDRRKRTPKLKDIRQSLS 1072          

HSP 2 Score: 130.568 bits (327), Expect = 5.074e-30
Identity = 116/407 (28.50%), Postives = 197/407 (48.40%), Query Frame = 1
Query:  193 SLSENEINDKFEKLLDDMNIPIDKRSVIREKTQEQKLVMLKSCITS-----------QIKPVTYYVELLKQIISEKLSESKICENLDQIRICLNSNPVSWIKEFDNKT----NDGXXXXXXXXXXXXXXADSSIVCLKCFRAFANCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILTILTFFDYKS-YQNVMDALFRAAKLNNYENRFVPLIESAKKNAQMENENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQVFDELLCNPNLKLTHE-----QINQFLXXXXXXXXXXXXXXXTIIRAFGDASDIFRIINRSVSNTKCEVNFRSILANLLIIREDP-IRDDLFRFIDEIVQEIILQDDSGFCPDPTLKKFDKINLKKFYD 1347
            +L E+E+   FEK+++DMN+  DK++ +REK    K  M+   I +           QI P  +  EL      E+L        L+ +R+ L S+PVSW++ F ++      D L  L+           +    ++C RA  N  YGL ++M+   +   +A+ + P+   +M   V++L+ +     +S  + V++AL  A +     +RF  ++E  + N+       +L +A ++ IN +++ P          D  +RLHLR EF+  GL ++       PNLK         Q+  F    E +  E   + E I     +ASD++ ++  +V  T+ E +F SIL +LL+IR D  IR+  F+ IDE V +I+L  D G  PD T +K   ++L +F D
Sbjct:   95 ALPESEVLKLFEKMMEDMNLNEDKKAPLREKDFGIKKEMVMQYINTASKTGSLRSSRQISPQEFLHELKMGYTDERL-----FTYLESLRVSLTSHPVSWVQSFGHEGLGLLLDILEKLINGQIQEKVVKKTQHKVIQCLRALMNTQYGLERIMSDKRSLSLLAKAMDPRQPAMMADVVKLLSAVCIVGEESILEEVLEALTSAGEERKI-DRFFSIVEGLRHNSV------NLQVACMQLINALVTSP---------DDLDFRLHLRNEFMRCGLKEIL------PNLKGIKNDGLDIQLKVFDEHKEEDLSEFFHRLEDIRAELDEASDVYSMLWDTVKETRAEGHFLSILQHLLLIRNDRFIREQYFKLIDECVSQIVLHRD-GTDPDFTYRKRLDLDLSQFVD 473          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Mouse
Match: Diaph3 (diaphanous related formin 3 [Source:MGI Symbol;Acc:MGI:1927222])

HSP 1 Score: 269.626 bits (688), Expect = 4.315e-74
Identity = 167/462 (36.15%), Postives = 272/462 (58.87%), Query Frame = 1
Query: 1924 YGLK-RNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIPT-DILKELENNFSXXXXXXX------XXXXXXXXXXXPKILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSFKGSAE-NDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFNXXXXXXXXXXXXXXXXXXRREKEK------QMPVMSKTTSEEDSGVIDNLLAVLKSGDGALSPKRRKPKSKDARRQLN 3264
            +GLK +  ++PE  M++ NW KI    +SEN  W+ + E      D+L +LEN F  +    +      EK V    +KE K LD K AQN+SI L S R+ YEK++  ILE+D + L++SMI+ L+K+LP+ EQ++ +++    Y  L E EQF   +SN+K+L+PRL +ILF+L+F++++N +K        A  EI KS+   K+LE+VL +GNYMN+GSRN Q+ GF+L+ LCKL  TK      +L+HFL ++      +      DL+++DKA+R++++     + ++   L+ +E  L++F    + +D+F  KM+ FV +  EQ     T    M + +QS+  Y+  +     +EE FND+  F+T F+ A K N +K+   E+  +A++ KER EKE+      +  ++   T  +++GV+D+LL  L+SG      ++R PK KD R+ L+
Sbjct:  611 FGLKPKKEFKPEISMRRLNWLKIGPNEMSENCFWIKVNENKYENRDLLCKLENTFCCQEKEKRNTNDFDEKKVIKKRMKELKFLDPKIAQNLSIFLSSFRVPYEKIRTMILEVDETQLSESMIQNLIKHLPDEEQLKSLSQFRSDYNSLCEPEQFAVVMSNVKRLRPRLSAILFKLQFEEQVNNIKPDIMAVSTACEEIKKSKGFSKLLELVLLMGNYMNAGSRNAQTFGFDLSSLCKLKDTKSADQKTTLLHFLVDVCEEKHADILHFVDDLAHLDKASRVSVEMLEKNVKQMGRQLQQLEKNLETFPPPEDLHDKFVIKMSIFVISANEQYEKLSTLLGSMTQLYQSIMGYYAVDMKKVSVEEFFNDLNNFRTSFMLALKENIKKREAAEKEKRARIAKERAEKERLERQQEKKRLLEMKTEGDETGVMDSLLEALQSGAAFRDRRKRTPKLKDIRQSLS 1072          

HSP 2 Score: 130.568 bits (327), Expect = 4.946e-30
Identity = 116/407 (28.50%), Postives = 197/407 (48.40%), Query Frame = 1
Query:  193 SLSENEINDKFEKLLDDMNIPIDKRSVIREKTQEQKLVMLKSCITS-----------QIKPVTYYVELLKQIISEKLSESKICENLDQIRICLNSNPVSWIKEFDNKT----NDGXXXXXXXXXXXXXXADSSIVCLKCFRAFANCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILTILTFFDYKS-YQNVMDALFRAAKLNNYENRFVPLIESAKKNAQMENENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQVFDELLCNPNLKLTHE-----QINQFLXXXXXXXXXXXXXXXTIIRAFGDASDIFRIINRSVSNTKCEVNFRSILANLLIIREDP-IRDDLFRFIDEIVQEIILQDDSGFCPDPTLKKFDKINLKKFYD 1347
            +L E+E+   FEK+++DMN+  DK++ +REK    K  M+   I +           QI P  +  EL      E+L        L+ +R+ L S+PVSW++ F ++      D L  L+           +    ++C RA  N  YGL ++M+   +   +A+ + P+   +M   V++L+ +     +S  + V++AL  A +     +RF  ++E  + N+       +L +A ++ IN +++ P          D  +RLHLR EF+  GL ++       PNLK         Q+  F    E +  E   + E I     +ASD++ ++  +V  T+ E +F SIL +LL+IR D  IR+  F+ IDE V +I+L  D G  PD T +K   ++L +F D
Sbjct:   95 ALPESEVLKLFEKMMEDMNLNEDKKAPLREKDFGIKKEMVMQYINTASKTGSLRSSRQISPQEFLHELKMGYTDERL-----FTYLESLRVSLTSHPVSWVQSFGHEGLGLLLDILEKLINGQIQEKVVKKTQHKVIQCLRALMNTQYGLERIMSDKRSLSLLAKAMDPRQPAMMADVVKLLSAVCIVGEESILEEVLEALTSAGEERKI-DRFFSIVEGLRHNSV------NLQVACMQLINALVTSP---------DDLDFRLHLRNEFMRCGLKEIL------PNLKGIKNDGLDIQLKVFDEHKEEDLSEFFHRLEDIRAELDEASDVYSMLWDTVKETRAEGHFLSILQHLLLIRNDRFIREQYFKLIDECVSQIVLHRD-GTDPDFTYRKRLDLDLSQFVD 473          
BLAST of Protein diaphanous homolog 2 vs. UniProt/SwissProt
Match: sp|O70566|DIAP2_MOUSE (Protein diaphanous homolog 2 OS=Mus musculus OX=10090 GN=Diaph2 PE=1 SV=2)

HSP 1 Score: 294.664 bits (753), Expect = 4.902e-82
Identity = 181/472 (38.35%), Postives = 284/472 (60.17%), Query Frame = 1
Query: 1924 YGLK-RNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIP-TDILKELENNFSXXXXXXXXXXXXXXXXXXP--------KILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSF-KGSAENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFNXXXXXXXXXXXXXXXXX--------XRREKEKQMPVMSKTTSEEDSGVIDNLLAVLKSGDGALSPKRRKPKSKDARR-QLNRSRSR 3279
            YG+K + +Y+P+ PMK+ NW+KI  K LSEN VWL +KEE     D+  +L   F +++   +           P        +ILD KTAQN+SI LGS RM YE++K  ILE++  +L++++I+ L+K LP+   ++++A+L   Y DL E EQF   +S +K L+PRL SILF+L F++ +N +K        A  E+ KSE  K++LE++L +GNYMNSGSRN QS+GF++NFLCK+  TK      +L+HFLAEI +    +  +   +L +++ A +++     S L  ++  +  +E  +K+F    + +D+F EKM  F    +EQ     T  + M + ++S+  YF F+ +T  +EE F D+  F+T F+EA K N ++K +EE++ +AKL K        ER++K+KQ+  ++K   E  +GV+DNLL  L+SG      ++R P++ D RR  L RSRSR
Sbjct:  621 YGMKQKKLYKPDIPMKRINWSKIEPKELSENCVWLKLKEEKYENADLFAKLALTFPSQMKGQRNTEAAEENRSGPPKKKVKELRILDTKTAQNLSIFLGSYRMPYEEIKNIILEVNEEMLSEALIQNLVKYLPDQNALRELAQLKSEYDDLCEPEQFGVVMSTVKMLRPRLTSILFKLTFEEHVNNIKPSIIAVTLACEELKKSESFKRLLELILLVGNYMNSGSRNAQSLGFKINFLCKIKDTKSADQKSTLLHFLAEICDEKYRDILKFPDELEHVESAGKVSAQILKSNLVAMEQSILHLEKNIKNFPPAESHHDKFVEKMMSFTQNAREQYDKLSTMHSNMLKLYESLGEYFIFDPNTVNMEEFFGDLNTFRTLFLEALKENHKRKEMEEKSRRAKLAKEKAEQEKLERQKKKKQLIDINKEGDE--TGVMDNLLEALQSGAAFRDRRKRIPRNPDNRRPPLERSRSR 1090          

HSP 2 Score: 120.168 bits (300), Expect = 4.996e-26
Identity = 110/399 (27.57%), Postives = 193/399 (48.37%), Query Frame = 1
Query:  196 LSENEINDKFEKLLDDMNIPIDKRSVIREKTQEQKLVMLKSCITSQIKPVTY--------------------YVELLKQIISEKLSESKICENLDQIRICLNSNPVSWIKEFDNKTN----DGXXXXXXXXXXXXXXADSSIVCLKCFRAFANCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILTILTFFDYKSYQNVMDALF----RAAKLNNYENRFVPLIESAKKNAQMENENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQVFDEL--LCNPNLKLTHEQINQFLXXXXXXXXXXXXXXXTIIRAFGDASDIFRIINRSVSNTKCEVNFRSILANLLIIRED-PIRDDLFRFIDEIVQEIILQDDSGFCPD 1299
            LSE E+ D FEK+++DMN+  +K++ +R+K    K  M+   I++  K +                      YV  L+  IS++    K+   L+ +R+ L S+PVSW+  F  +      D L  LL           +    ++C +AF N  +GL +++  + + L +AR + P+  ++M    EI+ IL+       +N++D L      AA+LNN E RF P++E  + N  +      L +A ++FIN +++ P         +D  +R+HLR EF+  GL  +   L  + N  L +   Q+  F    E++  E++ +   I     D ++++ ++   + +T  E    SIL + L+IR D  IR   ++ I+E V +I+L   SG  PD
Sbjct:   93 LSEKEVLDLFEKMMEDMNLNEEKKAPLRKKDFSIKREMVVQYISATSKSIVGSKVLGGLKNSKHEFTLSSQEYVHELRSGISDE----KLLNCLESLRVSLTSHPVSWVNNFGYEGLGVLLDVLEKLLDKKQQENIDKKNQYKVIQCLKAFMNNKFGLQRILGDERSLLLLARAIDPKQQNMM---TEIVKILSAICIVGEENILDKLLGGITAAAELNNRE-RFSPIVEGLENNEALH-----LQVACMQFINALVTSP---------YDLDFRIHLRNEFLRCGLKAMLPTLKEIENEGLDI---QLRVFEENKEDDLSELSHRLNDIRAEMDDINEVYHLLYNMLKDTAAEPYLLSILQHFLLIRNDYYIRPQYYKIIEECVSQIVLH-CSGMDPD 465          
BLAST of Protein diaphanous homolog 2 vs. UniProt/SwissProt
Match: sp|O60879|DIAP2_HUMAN (Protein diaphanous homolog 2 OS=Homo sapiens OX=9606 GN=DIAPH2 PE=1 SV=1)

HSP 1 Score: 293.893 bits (751), Expect = 7.943e-82
Identity = 177/472 (37.50%), Postives = 279/472 (59.11%), Query Frame = 1
Query: 1924 YGLK-RNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIPT-DILKELENNFSXXXXXXXXXXXXXXXXXXP--------KILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSF-KGSAENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFN--------XXXXXXXXXXXXXXXXXXRREKEKQMPVMSKTTSEEDSGVIDNLLAVLKSGDGALSPKRRKPKSKDARR-QLNRSRSR 3279
            YG+K + +Y+PE  MK+ NW+KI    LSEN  WL +KE+     D+  +L  NF+T++ V K           P        +ILD KTAQN+SI LGS RM YE ++  ILE++  +L++++I+ L+K+LPE + + ++AEL + Y DL E EQF   +S++K L+PRL SILF+L F++ IN +K        A  E+ KSE   ++LE+VL +GNYMNSGSRN QS+GF++NFLCK+  TK      +L+HF+A+I      +  +  ++L +++ A++++     S L  ++  +  +E  +K F +   ++D+F EKMT F  T +EQ     T    M + ++++  YF F+S T  IEE F D+  F+T F+EA + N        + ++    +    +   ER++K+KQ+  ++K   E  +GV+DNLL  L+SG      ++R P++ D RR  L RSRSR
Sbjct:  624 YGMKQKKMYKPEVSMKRINWSKIEPTELSENCFWLRVKEDKFENPDLFAKLALNFATQIKVQKNAEALEEKKTGPTKKKVKELRILDPKTAQNLSIFLGSYRMPYEDIRNVILEVNEDMLSEALIQNLVKHLPEQKILNELAELKNEYDDLCEPEQFGVVMSSVKMLQPRLSSILFKLTFEEHINNIKPSIIAVTLACEELKKSESFNRLLELVLLVGNYMNSGSRNAQSLGFKINFLCKIRDTKSADQKTTLLHFIADICEEKYRDILKFPEELEHVESASKVSAQILKSNLASMEQQIVHLERDIKKFPQAENQHDKFVEKMTSFTKTAREQYEKLSTMHNNMMKLYENLGEYFIFDSKTVSIEEFFGDLNNFRTLFLEAVRENNKRREMEEKTRRAKLAKEKAEQEKLERQKKKKQLIDINKEGDE--TGVMDNLLEALQSGAAFRDRRKRIPRNPDNRRVPLERSRSR 1093          

HSP 2 Score: 124.405 bits (311), Expect = 2.457e-27
Identity = 112/408 (27.45%), Postives = 203/408 (49.75%), Query Frame = 1
Query:  193 SLSENEINDKFEKLLDDMNIPIDKRSVIREKTQEQKLVMLKSCITSQIKPVTY-------------YVELLKQIISEKLSESKICENLDQIRICLNSNPVSWIKEFDNKTNDGXXXXXXXXXXXXXXAD----SSIVCLKCFRAFANCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILTILTFFDYKSYQNVMD----ALFRAAKLNNYENRFVPLIESAKKNAQMENENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQVFDELLCNPNLKLTHEQINQFLXXXXXXXXXXXXXXXTIIRAFGDASDIFRIINRSVSNTKCEVNFRSILANLLIIRED-PIRDDLFRFIDEIVQEIILQDDSGFCPDPTLKKFDKINLKKFYDG 1350
            +LSE E+ D FEK+++DMN+  +K++ +R K    K  M+   I++  K                 YV  L+  IS++    K+   L+ +R+ L SNPVSW+  F ++    L   L  L    +  +    +    ++C +AF N  +GL +++  + + L +AR + P+  ++M    EI+ IL+       +N++D    A+  AA+ NN E RF P++E  +    ++     L +A ++FIN +++ P+       + D  +R+HLR EF+ +GL  +  +L    N +L   Q+  F    E++  E++ +   I     D ++++ ++   + +T  E  F SIL + L+IR D  IR   ++ I+E V +I+L   SG  PD   ++   I+L    D 
Sbjct:  100 NLSEKEVLDLFEKMMEDMNLNEEKKAPLRNKDFTTKREMVVQYISATAKSGGLKNSKHECTLSSQEYVHELRSGISDE----KLLNCLESLRVSLTSNPVSWVNNFGHEGLGLLLDELEKLLDKKQQENIDKKNQYKLIQCLKAFMNNKFGLQRILGDERSLLLLARAIDPKQPNMM---TEIVKILSAICIVGEENILDKLLGAITTAAERNNRE-RFSPIVEGLENQEALQ-----LQVACMQFINALVTSPY-------ELD--FRIHLRNEFLRSGLKTMLPDLKEKENDELDI-QLKVFDENKEDDLTELSHRLNDIRAEMDDMNEVYHLLYNMLKDTAAENYFLSILQHFLLIRNDYYIRPQYYKIIEECVSQIVLH-CSGMDPDFKYRQRLDIDLTHLIDS 483          
BLAST of Protein diaphanous homolog 2 vs. UniProt/SwissProt
Match: sp|F1LVW7|DIAP3_RAT (Protein diaphanous homolog 3 OS=Rattus norvegicus OX=10116 GN=Diaph3 PE=1 SV=4)

HSP 1 Score: 273.092 bits (697), Expect = 1.843e-74
Identity = 168/462 (36.36%), Postives = 272/462 (58.87%), Query Frame = 1
Query: 1924 YGLK-RNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIPT-DILKELENNFSXXXXXXX------XXXXXXXXXXXPKILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSFKGSAE-NDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFNXXXXXXXXXXXXXXXXXXRREKEK------QMPVMSKTTSEEDSGVIDNLLAVLKSGDGALSPKRRKPKSKDARRQLN 3264
            +GLK +  ++PE  M++ NW KI    +SEN  W+ + E      D+L +LEN F       +      EK V    +KE K LD K AQN+SI L S R+ YEK++  ILE+D + L++SMI+ L+K+LP+ EQ++ +++    Y  L E EQF   +SN+K+L+PRL +ILF+L+F++++N +         A  EI KS+   K+LE+VL +GNYMN+GSRN Q+ GF+L+ LCKL  TK      +L+HFL ++      +      DL+++DKA+R++++    +L ++   L  +E  L++F    + +D+F  KM+ F+ T KE      T    M + +QSV +Y+  ++    +EE FND+  F+T F++A K N  K+   E+  +A++ KER EKE+      +  ++   T  +++GV+D+LL  L+SG      ++R PK KD R+ L+
Sbjct:  612 FGLKPKKEFKPEISMRRLNWLKIGPNEMSENCFWIKVNENKYENKDLLCKLENTFCCLEKEKRDTNDFDEKKVIKKRMKELKFLDPKIAQNLSIFLSSFRVPYEKIRTMILEVDEAQLSESMIQNLMKHLPDEEQLKSLSQFRSDYNSLCEPEQFAVVMSNVKRLRPRLTAILFKLQFEEQVNNINPDIMAVSTACEEIKKSKSFSKLLELVLLMGNYMNAGSRNAQTFGFDLSSLCKLKDTKSADQKTTLLHFLVDVCEEKHPDILPFVDDLAHLDKASRVSVEMLEKSLKQMGRQLLQLEKNLETFPPPEDLHDKFVIKMSSFIITAKEHYGKLSTLLDNMTQLYQSVMSYYAVDTKKVSVEEFFNDLNNFRTSFMQALKENIRKREAAEKEKRARIAKERAEKERLERQQEKKRLLEMKTEGDETGVMDSLLEALQSGAAFRDRRKRTPKLKDIRQSLS 1073          

HSP 2 Score: 142.124 bits (357), Expect = 9.849e-33
Identity = 121/407 (29.73%), Postives = 199/407 (48.89%), Query Frame = 1
Query:  193 SLSENEINDKFEKLLDDMNIPIDKRSVIREKTQEQKLVMLKSCITS-----------QIKPVTYYVELLKQIISEKLSESKICENLDQIRICLNSNPVSWIKEFDNKT----NDGXXXXXXXXXXXXXXADSSIVCLKCFRAFANCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILTILTFFDYKS-YQNVMDALFRAAKLNNYENRFVPLIESAKKNAQMENENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQVFDELLCNPNLKLTHE-----QINQFLXXXXXXXXXXXXXXXTIIRAFGDASDIFRIINRSVSNTKCEVNFRSILANLLIIREDP-IRDDLFRFIDEIVQEIILQDDSGFCPDPTLKKFDKINLKKFYD 1347
            SLSENE+   FEK+++DMN+  DK++ +REK    K  M+   I +           QI P  +  EL      E+L        L+ +R+ L SNPVSW++ F ++      D L  L+           +    ++C RA  N  YGL ++M+ + +   +A+ + P+   +M   V++L+ +     +S  + V++AL  A +     +RF  ++E  + N+        L +A ++ IN +++ P          D  +RLHLR EF+  GL ++       PNLK         Q+  F    E +  E + + E I   F +ASD++ ++  +V  T+ E +F SIL +LL+IR D  IR   F+ IDE V +I+L  D G  PD T +K   ++L +F D
Sbjct:   96 SLSENEVLKLFEKMMEDMNLNEDKKAPLREKDFSIKKEMVMQYINTASKTGSLRSSRQISPQEFIHELKMGYTGERL-----FTYLESLRVSLTSNPVSWVQNFGHEGLGLLLDILEKLINGQIQEKVVKKTQHKVIQCLRALMNTQYGLERIMSDERSLSLLAKAMDPKQPSMMADVVKLLSAVCIVGEESILEEVLEALTSAGEERKI-DRFFSIVEGLRHNSV------QLQVACMQLINALVTSP---------DDLDFRLHLRNEFMRCGLKEIL------PNLKGIKNDGLDIQLKVFDEHKEEDLSEFSHRFEDIRAEFDEASDVYSVVWDTVKETRAEGHFVSILQHLLLIRNDRFIRQQYFKLIDECVSQIVLHRD-GIDPDFTYRKRLDLDLSQFVD 474          
BLAST of Protein diaphanous homolog 2 vs. UniProt/SwissProt
Match: sp|Q9Z207|DIAP3_MOUSE (Protein diaphanous homolog 3 OS=Mus musculus OX=10090 GN=Diaph3 PE=1 SV=1)

HSP 1 Score: 270.396 bits (690), Expect = 1.867e-73
Identity = 167/462 (36.15%), Postives = 272/462 (58.87%), Query Frame = 1
Query: 1924 YGLK-RNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIPT-DILKELENNFSXXXXXXX------XXXXXXXXXXXPKILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSFKGSAE-NDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFNXXXXXXXXXXXXXXXXXXRREKEK------QMPVMSKTTSEEDSGVIDNLLAVLKSGDGALSPKRRKPKSKDARRQLN 3264
            +GLK +  ++PE  M++ NW KI    +SEN  W+ + E      D+L +LEN F  +    +      EK V    +KE K LD K AQN+SI L S R+ YEK++  ILE+D + L++SMI+ L+K+LP+ EQ++ +++    Y  L E EQF   +SN+K+L+PRL +ILF+L+F++++N +K        A  EI KS+   K+LE+VL +GNYMN+GSRN Q+ GF+L+ LCKL  TK      +L+HFL ++      +      DL+++DKA+R++++     + ++   L+ +E  L++F    + +D+F  KM+ FV +  EQ     T    M + +QS+  Y+  +     +EE FND+  F+T F+ A K N +K+   E+  +A++ KER EKE+      +  ++   T  +++GV+D+LL  L+SG      ++R PK KD R+ L+
Sbjct:  611 FGLKPKKEFKPEISMRRLNWLKIGPNEMSENCFWIKVNENKYENRDLLCKLENTFCCQEKEKRNTNDFDEKKVIKKRMKELKFLDPKIAQNLSIFLSSFRVPYEKIRTMILEVDETQLSESMIQNLIKHLPDEEQLKSLSQFRSDYNSLCEPEQFAVVMSNVKRLRPRLSAILFKLQFEEQVNNIKPDIMAVSTACEEIKKSKGFSKLLELVLLMGNYMNAGSRNAQTFGFDLSSLCKLKDTKSADQKTTLLHFLVDVCEEKHADILHFVDDLAHLDKASRVSVEMLEKNVKQMGRQLQQLEKNLETFPPPEDLHDKFVIKMSSFVISANEQYEKLSTLLGSMTQLYQSIMGYYAVDMKKVSVEEFFNDLNNFRTSFMLALKENIKKREAAEKEKRARIAKERAEKERLERQQEKKRLLEMKTEGDETGVMDSLLEALQSGAAFRDRRKRTPKLKDIRQSLS 1072          

HSP 2 Score: 130.568 bits (327), Expect = 3.549e-29
Identity = 116/407 (28.50%), Postives = 197/407 (48.40%), Query Frame = 1
Query:  193 SLSENEINDKFEKLLDDMNIPIDKRSVIREKTQEQKLVMLKSCITS-----------QIKPVTYYVELLKQIISEKLSESKICENLDQIRICLNSNPVSWIKEFDNKT----NDGXXXXXXXXXXXXXXADSSIVCLKCFRAFANCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILTILTFFDYKS-YQNVMDALFRAAKLNNYENRFVPLIESAKKNAQMENENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQVFDELLCNPNLKLTHE-----QINQFLXXXXXXXXXXXXXXXTIIRAFGDASDIFRIINRSVSNTKCEVNFRSILANLLIIREDP-IRDDLFRFIDEIVQEIILQDDSGFCPDPTLKKFDKINLKKFYD 1347
            +L E+E+   FEK+++DMN+  DK++ +REK    K  M+   I +           QI P  +  EL      E+L        L+ +R+ L S+PVSW++ F ++      D L  L+           +    ++C RA  N  YGL ++M+   +   +A+ + P+   +M   V++L+ +     +S  + V++AL  A +     +RF  ++E  + N+       +L +A ++ IN +++ P          D  +RLHLR EF+  GL ++       PNLK         Q+  F    E +  E   + E I     +ASD++ ++  +V  T+ E +F SIL +LL+IR D  IR+  F+ IDE V +I+L  D G  PD T +K   ++L +F D
Sbjct:   95 ALPESEVLKLFEKMMEDMNLNEDKKAPLREKDFGIKKEMVMQYINTASKTGSLRSSRQISPQEFLHELKMGYTDERL-----FTYLESLRVSLTSHPVSWVQSFGHEGLGLLLDILEKLINGQIQEKVVKKTQHKVIQCLRALMNTQYGLERIMSDKRSLSLLAKAMDPRQPAMMADVVKLLSAVCIVGEESILEEVLEALTSAGEERKI-DRFFSIVEGLRHNSV------NLQVACMQLINALVTSP---------DDLDFRLHLRNEFMRCGLKEIL------PNLKGIKNDGLDIQLKVFDEHKEEDLSEFFHRLEDIRAELDEASDVYSMLWDTVKETRAEGHFLSILQHLLLIRNDRFIREQYFKLIDECVSQIVLHRD-GTDPDFTYRKRLDLDLSQFVD 473          
BLAST of Protein diaphanous homolog 2 vs. UniProt/SwissProt
Match: sp|Q9NSV4|DIAP3_HUMAN (Protein diaphanous homolog 3 OS=Homo sapiens OX=9606 GN=DIAPH3 PE=1 SV=4)

HSP 1 Score: 262.692 bits (670), Expect = 6.400e-71
Identity = 162/474 (34.18%), Postives = 266/474 (56.12%), Query Frame = 1
Query: 1903 PPSTLEKYGLK-RNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIP-TDILKELENNFSXXXXXXXXXXXXXXXXXXPK------ILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSFKGSAE-NDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFNXXXXXXXXXXXXXXXXXXRREKE------KQMPVMSKTTSEEDSGVIDNLLAVLKSGDGALSPKRRKPKSKDARRQLNRSRSR 3279
            PP  +  +GLK +  ++PE  M++ NW KI    ++EN  W+ + E      D+L +LEN F  +    +E+          K       LD K AQN+SI L S R+ YE+++  ILE+D + L +SMI+ L+K+LP+ EQ+  +++    Y +L E EQF   +SN+K+L+PRL +ILF+L+F++++N +K        A  EI KS+   K+LE+VL +GNYMN+GSRN Q+ GF L+ LCKL  TK      +L+HFL EI      +      DL  +DKA++++++     L ++   L+ +E +L++F    + +D+F  KM+ FV + KEQ          M + +QS+  Y+  +     +E+   D+  F+T F++A K N +K+  EE+  + ++ KE  E+E      K+  ++   T  +++GV+DNLL  L+SG      ++R P  KD R+ L+    R
Sbjct:  625 PPLPILPFGLKPKKEFKPEISMRRLNWLKIRPHEMTENCFWIKVNENKYENVDLLCKLENTFCCQQKERREEEDIEEKKSIKKKIKELKFLDSKIAQNLSIFLSSFRVPYEEIRMMILEVDETRLAESMIQNLIKHLPDQEQLNSLSQFKSEYSNLCEPEQFVVVMSNVKRLRPRLSAILFKLQFEEQVNNIKPDIMAVSTACEEIKKSKSFSKLLELVLLMGNYMNAGSRNAQTFGFNLSSLCKLKDTKSADQKTTLLHFLVEICEEKYPDILNFVDDLEPLDKASKVSVETLEKNLRQMGRQLQQLEKELETFPPPEDLHDKFVTKMSRFVISAKEQYETLSKLHENMEKLYQSIIGYYAIDVKKVSVEDFLTDLNNFRTTFMQAIKENIKKREAEEKEKRVRIAKELAERERLERQQKKKRLLEMKTEGDETGVMDNLLEALQSGAAFRDRRKRTPMPKDVRQSLSPMSQR 1098          

HSP 2 Score: 132.494 bits (332), Expect = 7.377e-30
Identity = 118/401 (29.43%), Postives = 201/401 (50.12%), Query Frame = 1
Query:  196 LSENEINDKFEKLLDDMNIPIDKRSVIREKTQEQKLVMLKSCITS-----------QIKPVTYYVELLKQIISEKLSESKICENLDQIRICLNSNPVSWIKEFDNKT----NDGXXXXXXXXXXXXXXADSSIVCLKCFRAFANCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILTILTFFDYKS-YQNVMDALFRAAKLNNYENRFVPLIESAKKNAQMENENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQVFDELLCNPNLKLTHEQINQFLXXXXXXXXXXXXXXXTIIRAFGDASDIFRIINRSVSNTKCEVNFRSILANLLIIREDP-IRDDLFRFIDEIVQEIILQDDSGFCPDPTLKKFDKINLKKFYD 1347
            LSENE+ + FEK+++DMN+  DK++ +REK    K  M+   I +           QI P  +  EL      E+L     C  L+ +R+ L SNPVSW++ F ++      D L  L++          +    ++C +A  N  YGL ++M+ + +   +A+ + P++ ++M   V++L+ +     +S  + V++AL  A +     +RF  ++E  + N+        L +A ++ IN +++ P     D   F    RLH+R EF+  GL ++   L C  N  L   Q+  F    E +  E++ + E I     +A D++ ++  +V  T+ E  F SIL +LL+IR D  IR   F+ IDE V +I+L  D G  PD T +K   ++L +F D
Sbjct:  117 LSENELLELFEKMMEDMNLNEDKKAPLREKDFSIKKEMVMQYINTASKTGSLKRSRQISPQEFIHELKMGSADERLV---TC--LESLRVSLTSNPVSWVESFGHEGLGLLLDILEKLISGKIQEKVVKKNQHKVIQCLKALMNTQYGLERIMSEERSLSLLAKAVDPRHPNMMTDVVKLLSAVCIVGEESILEEVLEALTSAGEEKKI-DRFFCIVEGLRHNSV------QLQVACMQLINALVTSP-----DDLDF----RLHIRNEFMRCGLKEILPNLKCIKNDGLDI-QLKVFDEHKEEDLFELSHRLEDIRAELDEAYDVYNMVWSTVKETRAEGYFISILQHLLLIRNDYFIRQQYFKLIDECVSQIVLHRD-GMDPDFTYRKRLDLDLTQFVD 494          
BLAST of Protein diaphanous homolog 2 vs. TrEMBL
Match: U6CNT3 (Protein diaphanous homolog 2 OS=Neovison vison OX=452646 GN=DIAP2 PE=2 SV=1)

HSP 1 Score: 301.597 bits (771), Expect = 4.231e-87
Identity = 183/482 (37.97%), Postives = 287/482 (59.54%), Query Frame = 1
Query: 1894 IPKPPSTLEKYGLK-RNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIPT-DILKELENNFSXXXXXXXXXXXXXXXXXXP--------KILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSFKGSA-ENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFN--------XXXXXXXXXXXXXXXXXXRREKEKQMPVMSKTTSEEDSGVIDNLLAVLKSGDGALSPKRRKPKSKDARR-QLNRSRSR 3279
             P+ P  L  YG+K + +Y+PE PMK+ NW+KI  K LSEN  WL +KE+     D+  +L  NF+T++ V K           P        +ILD KTAQN+SI LGS RM YE +K  ILE++  +L +++I+ L+K+LPE + + ++A+L + Y DL E EQF   +S++K L+PRLE+ILF+L F++ +N +K        A  E+ KSE   ++LE+VL +GNYMNSGSRN QS+GF++NFLCK+  TK      +L+HF+AEI      +  +  ++L +++ A++++     S LT ++  +  +E  +K F  +  ++D+F EKMT F  + ++Q     T    M + ++++  YF F+S T  IEE F D++ F+T F+EA K N        + ++    +    +   ER++K+KQ+  +SK   E  +GV+DNLL  L+SG      ++R P++ D RR  L RSRSR
Sbjct:   28 FPEVPLDL-PYGMKQKKLYKPEVPMKRINWSKIEPKELSENCFWLKVKEDKFENPDLFAKLALNFATQMKVQKNVEASEEKKILPAKKKVKELRILDPKTAQNLSIFLGSYRMPYEDIKNIILEVNEDMLNEALIQNLVKHLPEQKVLSELAQLRNEYHDLCEPEQFGVVMSSVKMLQPRLENILFKLTFEEHVNNIKPSIIAVTLACEELKKSESFNRLLELVLLVGNYMNSGSRNAQSLGFKINFLCKIRDTKSADQKTTLLHFIAEICEEKYRDILKFPEELEHVESASKVSAQILKSNLTAMEQQIINLERDIKKFPETENQHDKFVEKMTSFTKSARDQYEKLFTMHNNMLKLYENLGEYFIFDSKTVSIEEFFGDLSNFRTLFLEAVKENNKRKEMEEKTRRAKLAKEKAEQEKLERQKKKKQLIDISKEGDE--TGVMDNLLEALQSGAAFRDRRKRIPRNPDNRRVPLERSRSR 506          
BLAST of Protein diaphanous homolog 2 vs. TrEMBL
Match: A0A564YK29 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS7230 PE=4 SV=1)

HSP 1 Score: 305.064 bits (780), Expect = 1.551e-83
Identity = 191/511 (37.38%), Postives = 300/511 (58.71%), Query Frame = 1
Query: 1876 AATSAAIPKPPSTLEKYGLK-RNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIPTD-ILKELENNFSXXXXXXXXXXXXXXXXXXP---------------KILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEII-NRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSFKGSAENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKF-------KTEFIEAHKFNXXXXXXXXXXXXXXXXXXRREKEKQMP-VMSKTTSEEDSGVIDNLLAVLKSG-----DGALSPKRR------------KPKSKDARRQLNRSRSR 3279
            +  SA+ P P      +G+K + VY+P+ PMKKANW+K+++K L+E+SVW+ ++E  + +D +L  L  NF+TK               +                K+LDGKTAQ +SILLGSL++ Y++L++ I+EID ++LT  ++EQLLK LPE E + ++ EL   Y +L E EQF  ++  IKKL PRL+SILF+++F ++++E+K        AL E+ +S+ + + +E+VL  GNY+N+GSRN QS+GF L+FL KL+ TKD     +L+HFL  ++ N+   +   L  DLSYID+A+  + DATA+ + E+K    A+EN L+++  +   D +S  M  F+T  ++QI + E+   ++NE +  V+ YF F+ + Y IE L NDM+KF        TE  E  +F E++K L E   + + +K +     ++P  +++  +E+D  VIDNL+  LKSG     DG  +P RR             P +   R+ L R RSR
Sbjct:  519 SGVSASPPLP------FGMKAKPVYKPKLPMKKANWDKVDQKDLAEDSVWVKMQESELASDDLLASLTENFNTKPKKFAGSGDSVAGEGDQSSAGAAAIARKAKHLKVLDGKTAQALSILLGSLKVPYDELRRRIVEIDEALLTPGIVEQLLKALPEQEVINQVVELSGDYDELAEAEQFLCKVGTIKKLLPRLKSILFKMRFQERVDEIKPDIVAVTEALKELRQSKHLVRGIELVLLFGNYLNAGSRNAQSLGFHLSFLPKLTDTKDIVGKSTLLHFLIRVLENKFPDSVFGLTNDLSYIDRASHFSEDATAAAIAEMKRSADALENDLRTYITTDPKDNYSTVMKQFLTEAQQQIEVIESMFKRVNERYTEVAKYFAFDPNKYPIESLLNDMSKFLYSFKRAVTEIQEQKEFEEKQKRLLEERQRREEEKAQLRTTDKVPGGITRKPTEDDGNVIDNLIESLKSGAAFGADGFGAPVRRPRNRHIPPGANMSPAAVALRQNLVRQRSR 1023          

HSP 2 Score: 186.808 bits (473), Expect = 2.327e-44
Identity = 145/412 (35.19%), Postives = 218/412 (52.91%), Query Frame = 1
Query:  199 SENEINDKFEKLLDDMNIPIDKRSVIREKTQEQKLVMLKSCITSQIKPVTYYVELLKQIISEKL-SESKICENLDQIRICLNSNPVSWIKEFDNKTNDGXXXXXXXXXXXXXXADSSIVCLKCFRAFANCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILTILTFFDYKSYQNVMDAL-FRAAKLNNYENRFVPLIESAKKNAQMENENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQVFDEL--LCNPNLKLTHEQINQFLXXXXXXXXXXXXXXXTIIRA-FGDASDIFRIINRSVSNTKCEVNFRSILANLLIIREDPIRDDLFRFIDEIVQEIILQDDSGFCPDPTLKKF-----DKIN-LKKFY------DGSHVEELKRELD 1383
            SE +IN+ FE +L+DMNI  DKR+ + +K  + K+ ML S      K         K++ + KL SE +I + L+ +R+ L +  VSW+KEF+NK N GLNLLL  L+        + + L+C RA  NCGYGL  L+  D A  FI+RCL   ++ LM  ++E+L+ +     K ++ V++ L F +    N+  RF PLI+           N  L+ A ++ INV++S  FL+  ++   D  +R+HLR E  N GL Q   EL    +PN+ + H  I +        D     +   + RA   D   ++R+I RSVSNT  E  F SIL +LL IRE+P R   +  ++ IV +++LQ D G   DP L          +N L + Y       G+ VEEL+++LD
Sbjct:   78 SEEKINELFESMLEDMNISGDKRAPLLDKPLKFKIEMLASSKYGASKTSGSPAHYCKELGNAKLFSEKEISKTLESLRVALLNGRVSWVKEFNNKDNGGLNLLLEFLAPTQNRT-ITYLSLRCVRALGNCGYGLYALVDHDTASTFISRCLNVHDVPLMECSLELLSTMAMCSLKGHEKVLEGLTFCSEFTPNHPPRFEPLIQGLS--------NPDLACACLQLINVLVSARFLS-EETIVLD--HRIHLRLELANLGLNQCLSELDKSTDPNV-INHVGIYRRF---AEADNIELCERFDVARADLNDLEQVYRLIQRSVSNTPSEKIFLSILQHLLFIREEPYRQHYYNLLNGIVAQVVLQTD-GVDIDPALGTLRLDIEGTVNALMEAYKQSDGGSGAKVEELQKKLD 472          
BLAST of Protein diaphanous homolog 2 vs. TrEMBL
Match: A0A0R3S9X8 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS1100 PE=4 SV=1)

HSP 1 Score: 305.064 bits (780), Expect = 2.805e-83
Identity = 191/511 (37.38%), Postives = 300/511 (58.71%), Query Frame = 1
Query: 1876 AATSAAIPKPPSTLEKYGLK-RNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIPTD-ILKELENNFSXXXXXXXXXXXXXXXXXXP---------------KILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEII-NRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSFKGSAENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKF-------KTEFIEAHKFNXXXXXXXXXXXXXXXXXXRREKEKQMP-VMSKTTSEEDSGVIDNLLAVLKSG-----DGALSPKRR------------KPKSKDARRQLNRSRSR 3279
            +  SA+ P P      +G+K + VY+P+ PMKKANW+K+++K L+E+SVW+ ++E  + +D +L  L  NF+TK               +                K+LDGKTAQ +SILLGSL++ Y++L++ I+EID ++LT  ++EQLLK LPE E + ++ EL   Y +L E EQF  ++  IKKL PRL+SILF+++F ++++E+K        AL E+ +S+ + + +E+VL  GNY+N+GSRN QS+GF L+FL KL+ TKD     +L+HFL  ++ N+   +   L  DLSYID+A+  + DATA+ + E+K    A+EN L+++  +   D +S  M  F+T  ++QI + E+   ++NE +  V+ YF F+ + Y IE L NDM+KF        TE  E  +F E++K L E   + + +K +     ++P  +++  +E+D  VIDNL+  LKSG     DG  +P RR             P +   R+ L R RSR
Sbjct:  567 SGVSASPPLP------FGMKAKPVYKPKLPMKKANWDKVDQKDLAEDSVWVKMQESELASDDLLASLTENFNTKPKKFAGSGDSVAGEGDQSSAGAAAIARKAKHLKVLDGKTAQALSILLGSLKVPYDELRRRIVEIDEALLTPGIVEQLLKALPEQEVINQVVELSGDYDELAEAEQFLCKVGTIKKLLPRLKSILFKMRFQERVDEIKPDIVAVTEALKELRQSKHLVRGIELVLLFGNYLNAGSRNAQSLGFHLSFLPKLTDTKDIVGKSTLLHFLIRVLENKFPDSVFGLTNDLSYIDRASHFSEDATAAAIAEMKRSANALENDLRTYITTDPKDNYSTVMKQFLTEAQQQIEVIESMFKRVNERYTEVAKYFAFDPNKYPIESLLNDMSKFLYSFKRAVTEIQEQKEFEEKQKRLLEERQRREEEKAQLRTTDKVPGGITRKPTEDDGNVIDNLIESLKSGAAFGADGFGAPVRRPRNRHIPPGANMSPAAVALRQNLVRQRSR 1071          

HSP 2 Score: 186.422 bits (472), Expect = 3.367e-44
Identity = 145/412 (35.19%), Postives = 218/412 (52.91%), Query Frame = 1
Query:  199 SENEINDKFEKLLDDMNIPIDKRSVIREKTQEQKLVMLKSCITSQIKPVTYYVELLKQIISEKL-SESKICENLDQIRICLNSNPVSWIKEFDNKTNDGXXXXXXXXXXXXXXADSSIVCLKCFRAFANCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILTILTFFDYKSYQNVMDAL-FRAAKLNNYENRFVPLIESAKKNAQMENENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQVFDEL--LCNPNLKLTHEQINQFLXXXXXXXXXXXXXXXTIIRA-FGDASDIFRIINRSVSNTKCEVNFRSILANLLIIREDPIRDDLFRFIDEIVQEIILQDDSGFCPDPTLKKF-----DKIN-LKKFY------DGSHVEELKRELD 1383
            SE +IN+ FE +L+DMNI  DKR+ + +K  + K+ ML S      K         K++ + KL SE +I + L+ +R+ L +  VSW+KEF+NK N GLNLLL  L+        + + L+C RA  NCGYGL  L+  D A  FI+RCL   ++ LM  ++E+L+ +     K ++ V++ L F +    N+  RF PLI+           N  L+ A ++ INV++S  FL+  ++   D  +R+HLR E  N GL Q   EL    +PN+ + H  I +        D     +   + RA   D   ++R+I RSVSNT  E  F SIL +LL IRE+P R   +  ++ IV +++LQ D G   DP L          +N L + Y       G+ VEEL+++LD
Sbjct:   78 SEEKINELFESMLEDMNISGDKRAPLLDKPLKFKIEMLASSKYGASKTSGSPAHYCKELGNAKLFSEKEISKTLESLRVALLNGRVSWVKEFNNKDNGGLNLLLEFLAPTQNRT-ITYLSLRCVRALGNCGYGLYALVDHDTASTFISRCLNVHDVPLMECSLELLSTMAMCSLKGHEKVLEGLTFCSEFTPNHPPRFEPLIQGLS--------NPDLACACLQLINVLVSARFLS-EETIVLD--HRIHLRLELANLGLNQCLSELDKSTDPNV-INHVGIYRRF---AEADNIELCERFDVARADLDDLEQVYRLIQRSVSNTPSEKIFLSILQHLLFIREEPYRQHYYNLLNGIVAQVVLQTD-GVDIDPALGTLRLDIEGTVNALMEAYKQSDGGSGAKVEELQKKLD 472          
BLAST of Protein diaphanous homolog 2 vs. TrEMBL
Match: A0A1S8WZA0 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=X801_04308 PE=4 SV=1)

HSP 1 Score: 292.738 bits (748), Expect = 8.318e-83
Identity = 175/480 (36.46%), Postives = 284/480 (59.17%), Query Frame = 1
Query: 1885 SAAIPKPPSTLEKYGLK-RNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIPTD-ILKELENNFSX----------XXXXXXXXXXXXXXXXXPKILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGK----DLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSFKGSAENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFNXXXXXXXXXXXXXXXXXXRREKEKQM-----PVMSKTTSEEDSGVIDNLLAVLKS----GDGALSPKRRKPKSKDA 3249
            + A+P+ P     +G+K +  Y    PMKKANW+++   +L+E+SVW+ ++E+ + +D + + L + FST                         K  + LDGK AQN+SILLGSL++ +E++++ +L +D ++LT  M+EQL++ LPE   +  I    D + DL + E+F + +  I+ L PRL +ILF++ FD+K+ E+K +  +A+ AL EI  S+ +++ILE+VL LGNYMNSGSRN QS+GF+++FL KL +TKD +N  +L+HF+    N++     EL K    D S++D+A R + D   S++ E+K  L  ++ +L+++K   + D + + MT F  +   ++   ET   +M E F  V+ YF F+ S Y +E LFNDM  F + ++ A K  E ++  + R  KA  ++ERR + ++      P   K  SEE+S VIDNL+  LKS    GDG  +  RR P+++ A
Sbjct:  106 APAVPQLP-----FGMKPKKTYSVGVPMKKANWDQVTPDLLTEDSVWVKLQEDKLESDELFESLTSQFSTKPTKKLLSVDGDSGAGRAAQNAKKTKSLRYLDGKVAQNLSILLGSLKVPHEEIRRRLLILDETLLTSHMVEQLIRALPEPSVIATITAAKDEFNDLADPERFVFLVGQIRALIPRLNTILFKMHFDEKMEELKPEIVDADEALREIHSSKSLRRILELVLLLGNYMNSGSRNAQSLGFQISFLTKLDATKDVSNQLTLLHFVVNYFNKTY---PELAKGFVDDFSHLDRACRFSEDTIRSSIAEMKKSLSGLKKELETYKPQGQEDAYLDVMTKFGESASSRLTQLETMFERMREKFTGVARYFAFDPSKYNMESLFNDMKAFHSAYVGALKDIERQEAAKARERKAAEEQERRNRGREQRSAKGPEAIKRPSEEESNVIDNLMEALKSGAAFGDGGRAGARR-PRNRPA 576          
BLAST of Protein diaphanous homolog 2 vs. TrEMBL
Match: A0A2U3ZTQ1 (protein diaphanous homolog 2 OS=Odobenus rosmarus divergens OX=9708 GN=DIAPH2 PE=4 SV=1)

HSP 1 Score: 297.745 bits (761), Expect = 3.713e-82
Identity = 180/480 (37.50%), Postives = 287/480 (59.79%), Query Frame = 1
Query: 1903 PPSTLE-KYGLK-RNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIPT-DILKELENNFSXXXXXXXXXXXXXXXXXXP--------KILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSFKGSA-ENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFN--------XXXXXXXXXXXXXXXXXXRREKEKQMPVMSKTTSEEDSGVIDNLLAVLKSGDGALSPKRRKPKSKDARR-QLNRSRSR 3279
            P + L+  YG+K + +Y+PE PMK+ NW+KI  K LSEN VWL +KE+     D+  +L  NF+T++   + +         P        +ILD KTAQN+SI LGS RM YE +K  ILE++  +L +++I+ L+K+LPE + + ++A+L   Y  L E EQF   +S++K L+PRLE+ILF+L F++ +N +K        A  E+ KSE   ++LE+VL +GNYMNSGSRN QS+GF++NFLCK+  TK      +L+HF+AEI     ++  +  ++L +++ A++++     S LT ++  +  +E  +K F  +  ++D+F EKMT F  + ++Q     T    M + ++++  YF F+S T  IEE F D++ F+T F+EA K N        + K+    +    +   ER++K+KQ+  ++K   E  +GV+DNLL  L+SG      ++R P++ D RR  L RSRSR
Sbjct:  379 PEAALDLPYGMKQKKIYKPEVPMKRINWSKIEPKELSENCVWLKVKEDKFENPDLFAKLTLNFATQIKEREREEASEEKKILPAKKKVKELRILDPKTAQNLSIFLGSYRMPYEDIKNIILEVNEDMLNEALIQNLVKHLPEQKVLGELAQLRSEYDHLCEPEQFGVVMSSVKMLQPRLENILFKLTFEEHVNNIKPSIIAVTLACEELKKSESFNRLLELVLLVGNYMNSGSRNAQSLGFKINFLCKIRDTKSADQKTTLLHFIAEICEEKYWDILKFPEELEHVESASKVSAQILKSNLTAMEQQIINLERDIKKFPETENQHDKFVEKMTSFTKSARDQYEKLFTMHNNMLKLYENLGEYFIFDSKTVSIEEFFGDLSNFRTLFLEAVKENNKRKEMEEKTKRAKLAKEKAEQEKLERQKKKKQLIDINKEGDE--TGVMDNLLEALQSGAAFRDRRKRIPRNPDNRRVPLERSRSR 856          

HSP 2 Score: 79.7221 bits (195), Expect = 3.277e-11
Identity = 67/245 (27.35%), Postives = 128/245 (52.24%), Query Frame = 1
Query:  580 NCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILTILTFFDYKSYQNVMD----ALFRAAKLNNYENRFVPLIESAKKNAQMENENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQVFDELLCNPNLKLTHEQINQFLXXXXXXXXXXXXXXXTIIRAFGDASDIFRIINRSVSNTKCEVNFRSILANLLIIRED-PIRDDLFRFIDEIVQEIILQDDSGFCPD 1299
            N  +GL +++  + + L +AR + P+  ++M    EI+ IL+       +N++D    A+  AA+ NN E RF P++E  + +  ++     L +A ++FIN +++ P+       + D  +R+HLR EF+ +GL  +  +L    N +L   Q+  F    E++  E++ +   I     D ++++ ++   + +T  E    SIL + L+IR D  +R   ++ I+E V +I+L   SG  PD
Sbjct:    2 NNKFGLQRILGDERSLLLLARAIDPKQPNMM---TEIVKILSAICIVGEENILDKLLGAITTAAERNNRE-RFSPIVEGLENHEALQ-----LQVACMQFINALVTSPY-------ELD--FRIHLRNEFLRSGLKTMLPDLKEKENDELDI-QLKVFDENKEDDLNELSHRLNDIRAEMDDMNEVYHLLYNMLKDTAAENYLLSILQHFLLIRNDYYVRPQYYKIIEECVSQIVLH-CSGMDPD 226          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Cavefish
Match: diaph2 (diaphanous-related formin 2 [Source:ZFIN;Acc:ZDB-GENE-090115-1])

HSP 1 Score: 251.136 bits (640), Expect = 1.751e-68
Identity = 156/452 (34.51%), Postives = 269/452 (59.51%), Query Frame = 1
Query: 1924 YGLK-RNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIPT-DILKELENNFSXXXXXXXXX----XXXXXXXXXPKILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSF-KGSAENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFNXXXXXXXXXXXXXXXXXXR------REKEKQMPVMSKTTSEEDSGVIDNLLAVLKSGDGALSPKRRKPKS 3240
            YGL+ +  Y+P+  MK+ NW+KI  + ++EN  W+ +KEE     D+  EL  +FS+K     E            KE +ILD KTAQN+SI LGS R+ YE+++  +LE+D   L++++I+ L+KNLPE +++  +AEL   Y++L E EQF   +S++K L+PRL  ILF+L F++++N ++        A  E+ KSE   K+LE++L +GNYMNSGSRN Q+ GF ++FLCK+  TK    N +L+HFLAE    +     +   +L +++ A++++     ++L  ++  ++ +EN +++F K   + D+F EK    +   +EQ     T    M + ++S+ +YF F+     IE+ F D+A F+  F++A K N +K+ +EE+  +AKL KE+        ++K+  ++      +++GV+D+L+  L+SG      ++R P++
Sbjct:  566 YGLQPKKTYKPDAAMKRINWSKIVPQEMAENCFWIKVKEEKFENPDLFTELSLSFSSKTRGRAEFLFYFAQFKKKAKELRILDAKTAQNLSIFLGSFRLRYEEIRDIVLEVDEERLSEALIQNLIKNLPEQKELSSLAELKGEYEELCESEQFGIVMSSVKLLRPRLNGILFKLTFEEQVNNIRPDIMNVTFACEEVKKSEGFSKLLEMILLVGNYMNSGSRNAQTFGFNISFLCKIRDTKSADQNTTLLHFLAEKCEENFPEILKFPDELEHVENASKVSAQILKASLDTMERHIQRLENDIQNFPKTDDKQDKFVEK----IKYSREQYEKLSTMHKNMQKLYESLGSYFAFDPHAVSIEDFFGDLANFRMLFLDAVKENHKKREMEEKIKRAKLAKEKAEREKQERQQKKKQLIDMNKEGDETGVMDSLMEALQSGAAFRDRRKRTPRT 1013          

HSP 2 Score: 122.865 bits (307), Expect = 8.702e-28
Identity = 118/400 (29.50%), Postives = 196/400 (49.00%), Query Frame = 1
Query:  193 SLSENEINDKFEKLLDDMNIPIDKRSVIREKTQEQKLVMLKSCITSQIKPVTY-------------YVELLKQIISEKLSESKICENLDQIRICLNSNPVSWIKEFDNKTNDGXXXXXXXXXXXXXXAD----SSIVCLKCFRAFANCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILTILTFFDYKSYQNVMD----ALFRAAKLNNYENRFVPLIESAKKNAQMEN-ENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQVFDELLCNPNLKLTHE---QINQFLXXXXXXXXXXXXXXXTIIRAF-----GDASDIFRIINRSVSNTKCEVNFRSILANLLIIREDP-IRDDLFRFIDEIVQEIILQDDSGFCPD 1299
            +LSE EI D FEK+++DMN+  D+++ +R K    K  M+   I++  K                 YV  L+  I+E+    K+   L+ +R+ L SNPVSW+  F ++    L   L  L    +  +    +    ++C +AF N  YGL +++  + + L +AR + P+   +M    EI+ IL+       +N++D    A+  AA+ NN E RF P++E       +EN E + L  A ++ IN +++ P     D   F    R+HLR EF+  GL ++         LK T E   Q+  F    E +  E++ + +  IR F      D  +++ +++  V +T  E  F SIL +LL+IR D  IR   ++ ++E V +I+L   SG  PD
Sbjct:   47 NLSEKEIVDLFEKMMEDMNLNEDRKAPLRGKDLSTKREMVVQYISATAKSGGLRNSKHECTLSSQEYVHELRSGITEE----KLLNCLESLRVSLTSNPVSWVNNFGHEGLGLLLEALERLLDKKQQENIDKKNQHKLIQCLKAFMNNKYGLQRILGDERSLLLLARAIDPKQPSMM---TEIVKILSAICIIGEENILDKILAAMTIAAERNNKE-RFAPIVEG------LENHEAQQLQTACMQLINALVTSP-----DDLDF----RIHLRNEFLRCGLKKILP-------LKETEELDIQLKVFTENKEEDSIELSHRLDD-IRLFLNSLCTDMGEVYHLLSNMVKDTSSETYFLSILQHLLLIRNDYIIRPQYYKVVEECVSQIVLH-RSGMDPD 414          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Cavefish
Match: ENSAMXT00000048841.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000111.1:974094:1004784:1 gene:ENSAMXG00000043629.1 transcript:ENSAMXT00000048841.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 209.92 bits (533), Expect = 5.881e-59
Identity = 121/372 (32.53%), Postives = 207/372 (55.65%), Query Frame = 1
Query: 2215 LKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSFKGSA-ENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFNXXXXXXXXXXXXXXXXXXRREKEKQM------------------------PVMSKTTSEEDSGVIDNLLAVLKSGDGALSPKRRKPKSKDARR 3255
            +K  ILE++ ++L+++M++ LLK LPE EQ+  ++E+ D Y DL E EQF   +S++KKLK RL +ILF+L+F++++N +K       AA  E+++S+   K+LEI+L +GNYMN+GSRN ++ GF +++LCKL  TK     ++L+HFLA+    +  +      +L +++KA+R++ +     L ++   +K++E  +++F     E D+F EKMT FV T +EQ    E   + M + ++++ TYF F+      EELF D+  FK  F +A   N                ++RRE E++M                         ++      +++G++D LL  L+S  GA   ++R P+    RR
Sbjct:    1 MKNVILEVNETMLSENMVQSLLKLLPEQEQLSVLSEMKDEYDDLAESEQFGVVISSVKKLKQRLSAILFRLQFEEQVNNIKPDVVAITAACEELVQSQNFSKLLEIILLVGNYMNAGSRNAKAFGFSISYLCKLRDTKSADQKQTLLHFLADTCQENYPDVMHFPDELIHLEKASRVSAETLQKNLDQMGKQIKSLEKDIETFPPPQNEKDKFVEKMTSFVATAREQFEKLEMMHSNMQKEYENLGTYFVFDPKKMSPEELFGDLNNFKNMFQQAVIEN----------------QKRRETEEKMRKAKLAREKAEKEKEERQKKMSAGQILDINDDGDETGIMDGLLEALQS--GAAFRRKRGPRQAANRR 354          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Cavefish
Match: daam1b (disheveled-associated activator of morphogenesis 1 [Source:NCBI gene;Acc:103042845])

HSP 1 Score: 168.703 bits (426), Expect = 4.459e-42
Identity = 136/450 (30.22%), Postives = 236/450 (52.44%), Query Frame = 1
Query: 1933 KRNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIPTDI-LKELENNFSXXXXXXXXXXXXXXXXXXPK---ILDGKTAQNISILLGSLRMEYEKLKQAILEID-TSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTN-NRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSFKGSAE--NDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFN----XXXXXXXXXXXXXXXXXXRREKEKQMPVMSKTTSEEDSGVIDNLLAVLKSG---DGALSPKRRKPK 3237
            K+N+ QP  P+K  NW K++E  L E +VW  + +  +   + L ++E  FS      KE        K+ K   ++DG+ AQN +ILL  L++  E++K+AIL +D    L + M+EQ+LK +PE   +  + E       + + ++F Y++S I   + RL+S+ F+ KF ++I E+K +      A  E+L+S  +K++LE+VL+ GNYMN G R   + GF+++ L K++ TK   + N +L+H+L  I+ +      +  +DL  + +A ++ +      +  +++GLK++E++L   K   +   D+F   ++ FVT         E    +  E F+    +F  +S   + +E F    +F   F EA + N      K+  E RA      KE+REKE++    +K   E+D G  D+L++ L+SG   D  LS  +R  K
Sbjct:  604 KKNIPQPSNPLKSFNWAKLSENKL-EGTVWAEMDDSRVFKILDLTDIEKTFSAYQRQQKEAEDDALSSKKVKELSVIDGRRAQNCNILLSRLKLSNEEMKRAILTMDEQEDLPKDMLEQMLKFIPEKSDVDLLEEHKHELDRMAKADRFLYEMSRINHYQQRLQSLYFKKKFAERIAEIKPKVEALTRASKEMLQSRNLKQLLEVVLAFGNYMNKGQRG-NAYGFKVSSLNKIADTKSSIDKNITLLHYLITILEKKYPKVMQFSEDLQNVPEAAKVNMTELEKEINNLRSGLKSVESELDFQKKRPQEVGDKFVSVVSQFVTLASFSFSDVEDSLNEAKELFEKAVKHFGEDSGKMQPDEFFGIFDQFLQSFTEARQENENMRRRKEEEERRARMEAQLKEQREKERK-ARKAKENGEDDGGEFDDLVSALRSGEVFDKDLSKMKRNRK 1050          

HSP 2 Score: 73.559 bits (179), Expect = 1.223e-12
Identity = 57/252 (22.62%), Postives = 119/252 (47.22%), Query Frame = 1
Query:  556 LKCFRAFANCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILTILTFFDYKSYQNVMDALFRAAKLNNYENRFVPLIESAKKNAQMENENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQVFDELLCNPNLKLTHEQINQFLXXXXXXXXXXXXXXXTIIRAFGDASDIFRIINRSVSNTKCEVNFRSILANLLIIREDPIRDDL--FRFIDEIVQEIILQDDSGFCPDPT 1305
            + C +A  N   G   +++   +   IA+ L  +NI      +EI+  +       ++ V++A+    +  +   RF  L+    ++     +  SL  A + FIN ++S        + +    +R+HLR EF+  G+  + D+L  + N  L    ++ F     +++  V+ + E++      AS +F +I + +++T    +F S+L + L++      + +  +  +D IVQ+++LQ+D G  PD T
Sbjct:  182 IGCIKALMNNSQGRAHVLSHPESINIIAQSLATENIKTKVAVLEIMGAVCLVP-GGHKKVLEAMLHYQRFASERTRFQMLLNDLDRSTGRYRDEVSLKTAIMSFINAVLS------QGAGETSLEFRVHLRYEFLMLGIQPIIDKLRSHENSTLDR-HLDYFEMLRNDDELTVSRRFESVHIDTKSASQVFDLIRKKMTHTDAYPHFMSVLHHCLLMPHKRSGNTVQYWLLLDRIVQQMVLQNDKGHDPDVT 425          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Cavefish
Match: daam1b (disheveled-associated activator of morphogenesis 1 [Source:NCBI gene;Acc:103042845])

HSP 1 Score: 163.31 bits (412), Expect = 2.237e-40
Identity = 135/460 (29.35%), Postives = 236/460 (51.30%), Query Frame = 1
Query: 1933 KRNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIPTDI-LKELENNFSXXXXXXXXXXXXXXXXXXPK-------------ILDGKTAQNISILLGSLRMEYEKLKQAILEID-TSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTN-NRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSFKGSAE--NDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFN----XXXXXXXXXXXXXXXXXXRREKEKQMPVMSKTTSEEDSGVIDNLLAVLKSG---DGALSPKRRKPK 3237
            K+N+ QP  P+K  NW K++E  L E +VW  + +  +   + L ++E  FS          V  +  KE +             ++DG+ AQN +ILL  L++  E++K+AIL +D    L + M+EQ+LK +PE   +  + E       + + ++F Y++S I   + RL+S+ F+ KF ++I E+K +      A  E+L+S  +K++LE+VL+ GNYMN G R   + GF+++ L K++ TK   + N +L+H+L  I+ +      +  +DL  + +A ++ +      +  +++GLK++E++L   K   +   D+F   ++ FVT         E    +  E F+    +F  +S   + +E F    +F   F EA + N      K+  E RA      KE+REKE++    +K   E+D G  D+L++ L+SG   D  LS  +R  K
Sbjct:  604 KKNIPQPSNPLKSFNWAKLSENKL-EGTVWAEMDDSRVFKILDLTDIEKTFSAYQRQQDFFMVNNSKQKEAEDDALSSKKVKELSVIDGRRAQNCNILLSRLKLSNEEMKRAILTMDEQEDLPKDMLEQMLKFIPEKSDVDLLEEHKHELDRMAKADRFLYEMSRINHYQQRLQSLYFKKKFAERIAEIKPKVEALTRASKEMLQSRNLKQLLEVVLAFGNYMNKGQRG-NAYGFKVSSLNKIADTKSSIDKNITLLHYLITILEKKYPKVMQFSEDLQNVPEAAKVNMTELEKEINNLRSGLKSVESELDFQKKRPQEVGDKFVSVVSQFVTLASFSFSDVEDSLNEAKELFEKAVKHFGEDSGKMQPDEFFGIFDQFLQSFTEARQENENMRRRKEEEERRARMEAQLKEQREKERK-ARKAKENGEDDGGEFDDLVSALRSGEVFDKDLSKMKRNRK 1060          

HSP 2 Score: 73.559 bits (179), Expect = 1.248e-12
Identity = 57/252 (22.62%), Postives = 119/252 (47.22%), Query Frame = 1
Query:  556 LKCFRAFANCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILTILTFFDYKSYQNVMDALFRAAKLNNYENRFVPLIESAKKNAQMENENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQVFDELLCNPNLKLTHEQINQFLXXXXXXXXXXXXXXXTIIRAFGDASDIFRIINRSVSNTKCEVNFRSILANLLIIREDPIRDDL--FRFIDEIVQEIILQDDSGFCPDPT 1305
            + C +A  N   G   +++   +   IA+ L  +NI      +EI+  +       ++ V++A+    +  +   RF  L+    ++     +  SL  A + FIN ++S        + +    +R+HLR EF+  G+  + D+L  + N  L    ++ F     +++  V+ + E++      AS +F +I + +++T    +F S+L + L++      + +  +  +D IVQ+++LQ+D G  PD T
Sbjct:  182 IGCIKALMNNSQGRAHVLSHPESINIIAQSLATENIKTKVAVLEIMGAVCLVP-GGHKKVLEAMLHYQRFASERTRFQMLLNDLDRSTGRYRDEVSLKTAIMSFINAVLS------QGAGETSLEFRVHLRYEFLMLGIQPIIDKLRSHENSTLDR-HLDYFEMLRNDDELTVSRRFESVHIDTKSASQVFDLIRKKMTHTDAYPHFMSVLHHCLLMPHKRSGNTVQYWLLLDRIVQQMVLQNDKGHDPDVT 425          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Cavefish
Match: daam1a (dishevelled associated activator of morphogenesis 1a [Source:ZFIN;Acc:ZDB-GENE-030911-6])

HSP 1 Score: 151.754 bits (382), Expect = 7.342e-37
Identity = 117/375 (31.20%), Postives = 205/375 (54.67%), Query Frame = 1
Query: 2146 ILDGKTAQNISILLGSLRMEYEKLKQAILEIDTS-ILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTN-NRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSFKGSA--ENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFNX----XXXXXXXXXXXXXXXXXRREKEKQMPVMSKTTSEEDSGVIDNLLAVLKSG---DGALSPKRRKPK 3237
            ++DG+ AQN +ILL  L++  E++K+AIL +D    L + M+EQLLK +PE   +  + E       +   ++F Y++S I   + RL+S+ F+ KF +++ E+K +     AA  E+L+S  ++++LE+VL+LGNYMN G R   + G++++ L K++ TK   + N +L+H+L  I+ +     A   +DL  + +A ++ +      ++ +++GLK++E +L+  K       D+F   ++ F+T         E    +  E FQ    +F  + S+ + ++ F    +F   F EA + NE     K+  E RA      KE+REKE++    +K  SEED G  D+L++ L+SG   D  LS  +R  K
Sbjct:  557 VIDGRRAQNCNILLSRLKLSNEEIKKAILTMDEHEDLPKDMLEQLLKFVPEKSDVDVLEEHKHELDRMARADRFLYEMSRINHYQQRLQSLYFKKKFAERVAEIKPKIEALSAACKEVLQSRNLRQLLEVVLALGNYMNKGQRG-NAYGYKVSSLNKIADTKSSIDKNITLLHYLITILEQKYPKVALFQEDLQNVSEAAKVNMTELEKDISNLRSGLKSVETELEYQKSRPVDSGDKFVSVVSQFITVASFSFSDVEDSLQEAKELFQKAVKHFGEDGSSSQPDDFFGIFDQFLQSFSEAKQENENARKRKEEEERRARIEAQMKEQREKERK-ARKAKENSEED-GEFDDLVSALRSGEVFDKDLSKMKRNRK 928          

HSP 2 Score: 64.6994 bits (156), Expect = 5.055e-10
Identity = 73/332 (21.99%), Postives = 143/332 (43.07%), Query Frame = 1
Query:  349 YYVELLKQIIS-------EKLSESKICENLDQIRICLNSNPVSWIKEFDNKTNDGXXXXXXXXXXXXXXADSSIV---CLKCFRAFANCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILTILTFFDYKSYQNVMDALFRAAKLNNYENRFVPLIESAKKNAQMENENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQVFDELLCNPNLKLTHEQINQFLXXXXXXXXXXXXXXXTIIRAFGDASDIFRIINRSVSNTKCEVNFRSILANLLIIREDPIRDD-----LFRFIDEIVQEIILQDDSGFCPD 1299
            YY++ +  + +       EK  E +  + ++ ++  L + P+ ++  F ++  DGL  +L  L  +      S +    + C +A  N   G   ++A   +   IA+ L   NI                  K+   +++A+    K  +   RF  L+    ++     +  SL  A + FIN ++S        + +    +R+HLR EF+  G+  V D+L  + N  L    +  F      ++  + ++ ET+      AS +F +I + +++T    +F S+L + L +   P +        +  +D IVQ+I+LQ+D G  PD
Sbjct:  105 YYIDQINSMAARKTVLALEKEDEEERNKTIESLKTALRTQPMRFVTRFIDQ--DGLTCILNFLKNMDYETTESQIHTSLIGCIKALMNNSQGRAHVLAHSESINIIAQSLATDNI------------------KTKVAILEAMLHYQKFASERTRFQTLLNDLDRSTGRYRDEVSLKTAIMSFINAVLS------QGAGETSLDFRIHLRYEFLMLGIQPVIDKLRTHENSTLDR-HLEYFEMLRNEDELALAKRFETVHIDTKSASQVFELIRKKINHTDAFPHFISVLQHCLHM---PYKRSGNTVQYWLLLDRIVQQIVLQNDKGHDPD 406          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000125.1 (pep scaffold:Pmarinus_7.0:GL476709:11284:97599:-1 gene:ENSPMAG00000000108.1 transcript:ENSPMAT00000000125.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 258.84 bits (660), Expect = 3.057e-71
Identity = 161/459 (35.08%), Postives = 267/459 (58.17%), Query Frame = 1
Query: 1924 YGLK-RNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIPT-DILKELENNFSXXXXXXXXXXXXXXXXXXP----------KILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSFKGSAE-NDRFSEKMT-PFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFNXXXXXXXXXXXXXXXXXXRREKE-------KQMPVMSKTTSEEDSGVIDNLLAVLKSGDGALSPKRRKPK 3237
            +GL+ +  Y+PE   K+ANW KI  +   ENS W   KEE     D+L +L   F+ +   V+ +  +  V K+           K+LD K+ QN+SI LG+L+M Y ++K+ ILE++   +T+SMI+ L+K LPE +Q++ +A   D Y DL E EQF   + ++ +L+ RL +I F L+F+++++ VK       AA  E+ +S+   ++LEIVL  GNYMN+GSRN Q+ GF +++LCKL  TK     ++L+HFLAE+         +  +DLS+++KA+R++ +     L +++  ++ +E  ++SF  + + ND+F EKMT  F+   +EQ          M   F  +  YF FN+    +EE F D+  F++ F++A K N  ++  EE+  KA+L KER EKE       K++ ++   T  +++GV+D+L+  L+S  GA   ++R P+
Sbjct:  735 FGLQPKKEYKPEISTKRANWAKIRPEEFKENSFWTKAKEERFENPDVLSKLAQTFAAQAAKVRAQKEQEGVEKDKPPSKKKIKELKVLDQKSGQNLSIFLGTLKMPYTEIKKIILEVNEEKITESMIQNLIKQLPEADQLEALAGFKDEYDDLAEAEQFSVVIGSVTRLRSRLTAIQFMLQFEEQVSSVKPDVVAVTAACEEVQQSDAFSRLLEIVLLFGNYMNAGSRNAQTFGFNISYLCKLRDTKSADQKQTLLHFLAEVCEAEYPEVLKFTEDLSHVEKASRVSAENLQKNLKQMENQIEQLEKDIQSFPSTEDKNDKFVEKMTISFMRKAREQYGRLALMFDNMQTLFDGLGEYFVFNTKKVSVEEFFGDLTNFRSMFMQAVKDNVRRREAEEKIQKAQLAKERAEKERLEKQNKKRLLLLKMHTDGDETGVMDSLMEALQS--GAAFKRKRAPR 1191          

HSP 2 Score: 125.946 bits (315), Expect = 2.197e-29
Identity = 113/396 (28.54%), Postives = 188/396 (47.47%), Query Frame = 1
Query:  196 LSENEINDKFEKLLDDMNIPIDKRSVIREKTQEQKLVMLKSCITSQIKPVT------------YYVELLK-QIISEKLSESKICENLDQIRICLNSNPVSWIKEFDNKTN----DGXXXXXXXXXXXXXXADSSIVCLKCFRAFANCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILTILTFFD------YKSYQNVMDALFRAAKLNNYENRFVPLIESAKKNAQMENENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQVFDEL--LCNPNLKLTHEQINQFLXXXXXXXXXXXXXXXTIIRAF--GDASDIFRIINRSVSNTKCEVNFRSILANLLIIRED-PIRDDLFRFIDEIVQEIILQDDSGFCPD 1299
            L+E++I+  FEK+L+DMN+    ++ +R K ++ K  M+   + S  K               Y  EL   + +     + ++   L+ +R+ L SNPVSW++ F ++      D L  L    S         +  ++C RAF N   GL  ++A+ N  L +AR + P++  +M  AV +L+ L+  D       K    V+DAL   A++   E RF P++E       +     SL +A    IN ++  P          D  +R+HLR EF+ NGL +    L  + N  L++   Q+  F  E    D +   +    IRAF   D +D++  ++ +V +T+ E  F SI+ +LL+IR D  +R   FR I+E V +++L    G  PD
Sbjct:   44 LTEDQIHTFFEKMLEDMNLSEAHKAPLRHKDEKTKRDMVLQYMASSSKTGGTHKRDTALSGKDYITELTGLRKMEHDSDQERLLSCLESLRVSLTSNPVSWVELFGDEGLKILLDILQDLQEKQSPNHFDWKIQLEIVRCLRAFMNNKVGLRAMLATHNGVLLLARAVEPRHPSMMVEAVRLLSALSILDEDHFDGAKPSSRVLDALAECAEICEQE-RFQPIVEGLDVKQSL-----SLKIACFILINALVETP---------EDLEFRIHLRNEFMRNGLGKALTHLREIQNEQLEV---QLRVF-DEGREGDFQDFSQRLQDIRAFVCTDINDVYAFLSNTVKDTQAEQPFLSIMQHLLLIRNDFLVRPQYFRLIEECVSQVVLH-RGGVDPD 419          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001778.1 (pep scaffold:Pmarinus_7.0:GL479130:173791:184898:-1 gene:ENSPMAG00000001611.1 transcript:ENSPMAT00000001778.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 186.422 bits (472), Expect = 1.584e-53
Identity = 91/231 (39.39%), Postives = 153/231 (66.23%), Query Frame = 1
Query: 2176 SILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSFKGSAEN-DRFSEKMT 2865
            +I LGS RM+Y+++K  IL +D   +T+SMI+ L+  LPE EQ+  +A L + Y+DL E EQF   +S++K+L+PRL +ILF+L+FD+++  +K       AA  EI +S+   K+LE+VL +GNYMN+GSRN Q+ GF++ FLCKL  TK      +L+HFLA++      +     ++L++++KA+ +A +    +L +++  ++ +E  L++F  + ++ D+F EKMT
Sbjct:    1 AIFLGSFRMDYQEIKSIILSVDEERITESMIQSLINQLPEPEQLSALASLKNEYEDLCEPEQFGVVISSVKRLRPRLNAILFRLQFDEQVANLKPDIVAVSAACEEIRRSDSFSKLLELVLLMGNYMNAGSRNAQTFGFQMGFLCKLKDTKSNDQKLTLLHFLAQMCEEKHPDVLRFTEELTHVEKASTVAAENLQKSLKQMEKQVQQLEGDLRAFSTTDDDTDKFVEKMT 231          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Sea Lamprey
Match: daam1a (dishevelled associated activator of morphogenesis 1a [Source:ZFIN;Acc:ZDB-GENE-030911-6])

HSP 1 Score: 146.747 bits (369), Expect = 4.922e-36
Identity = 107/361 (29.64%), Postives = 192/361 (53.19%), Query Frame = 1
Query: 2146 ILDGKTAQNISILLGSLRMEYEKLKQAILEID-TSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTN-NRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQL--KSFKGSAENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEF----IEAHKFNXXXXXXXXXXXXXXXXXXRREKEKQMPVMSKTTSEEDSGVIDNLLAVLKSGD 3204
            ++DG+ AQN  ILL  L+M  E++K+A++ +D    L + M+EQLLK +PE   +  + E     + +   ++F + +S I   + RL+++ F+ KF +++ E K +      A  E+ +S +++++LE+VL+LGNYMN G R   + GF+++ L K++ TK  T+ N +L+H+L  ++ +   +   +  DL ++ +A ++ L      +  IK GLKA+E +L  +    SA  DRF   M+ F+T         E   ++  E F    ++F       + EE F     F + F    +E       K+  E RA      KE+RE+E++    ++  S E+ G  D+L++ L+SG+
Sbjct:  567 VIDGRRAQNCVILLSKLKMSNEEIKRALMRMDEQEELPKDMLEQLLKFVPEKSDVDVLEEHRHEIERMARADRFLFDMSRIPHYQQRLQALFFKKKFAERLGECKPKVEAILLASREVSRSRRLRQLLELVLALGNYMNKGQRG-NAYGFKISSLNKIADTKSSTDKNINLLHYLIIVVEKKFPDVLGISDDLQHVPEAAKVNLTEMEKEINNIKIGLKAVEAELEFQRTHASAIGDRFISVMSDFITVASFSFSELEDLLSEAKEKFNKSVSHFGEEGGRTQPEEFFGMFDAFLSAFGDSRLELEAMRRRKEEEERRARVEAQLKEQRERERRAK-KARQGSTEEGGEFDDLVSALRSGE 925          

HSP 2 Score: 55.4546 bits (132), Expect = 7.477e-8
Identity = 59/263 (22.43%), Postives = 118/263 (44.87%), Query Frame = 1
Query:  553 CLKCFRAFANCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILTILTFFDYKSYQNVMDALFRAAKLNNYENRFVPLIESAKKNAQMENENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQVFDELLCNPNLKLTHEQINQFLXXXXXXXXXXXXXXXTIIRAFGDASDIFRIINRSVSNTKCEVNFRSILANLLII--REDPIRDDLFRFIDEIVQEIILQDDSGFCPDPTLKKFDKINLK 1335
             + C +A  N   G   ++A   +   I++ L  +N   + V +EIL  +       ++ V+ A+ R  +          LI    +N     +  SL  A + FIN I++        + Q +  +R+HLR EF+  G+  + D+L  + N  L    ++ F      ++ E+ ++ + +      A  +F +I R +  T+   +  SIL + L +  ++  +    ++ +D I+Q+I+LQ + G   DP +   +  N+K
Sbjct:   35 VIGCIKALMNNSQGRAHVLAHPESINVISQSLSSENATKVAV-LEILGAVCLVP-GGHRKVLQAMLRYQQHAAERTLLQTLITELDRNTGKYRDEVSLKTAIMSFINAILNA------GTGQENLEFRVHLRYEFLMLGIQSLVDKLRSHENATLD-RHLDFFEMIRNEDEAELAKRFDMMHIDTKSAGQMFDVIKRKLKFTEAYPHLMSILYHCLHMPYKKSSVMVQHWQLLDRILQQIVLQSERG--DDPDVAPLENFNVK 286          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010867.1 (pep scaffold:Pmarinus_7.0:GL477036:280430:297830:1 gene:ENSPMAG00000009847.1 transcript:ENSPMAT00000010867.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 108.612 bits (270), Expect = 9.687e-25
Identity = 104/387 (26.87%), Postives = 197/387 (50.90%), Query Frame = 1
Query:  196 LSENEINDKFEKLLDDMNIPIDKRSVIREK--TQEQKLVM----------LKSCITSQIKPVTYYVELLKQIISEKLSESKICENLDQIRICLNSNPVSWIKEFDNKTN----DGXXXXXXXXXXXXXXADSSIVCLKCFRAFANCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILTILTFF-DYKSYQNVMDALFRAAKLNNYENRFVPLIESAKKNAQMENENESLSLATIRFINVIISPPFLNPNDSAQFDEY-YRLHLRREFVNNGLMQVFDELLCNPNLKLTHEQINQFLXXXXXXXXXXXXXXXTIIRAFGDASDIFRIINRSVSNTKCEVNFRSILANLLIIREDP-IRDDLFRFIDEIVQEIILQDDSGFCPD 1299
            LSE E+   FEK+++DMN+    ++ +R+K    ++++VM          LKS     +     Y+  L+  I ++    ++   L+ +R+ LNSNPVSW++ F ++      D LN L         T  +    ++C +AF N  YGL+++++ +   L +AR + P    +M  AV++L+ L    + ++++ +++AL +  +  N E RF  +++   +   ++     L +  ++ IN +++            DE  +RLHLR EF+  GL+ +  +L+ + N +    Q+  F    E++  E++ + E I        ++F+I++  V +T  E  F SIL +LL+IR D  +R   ++ I+E V +IIL  + G  PD
Sbjct:   45 LSEKEVLALFEKMMEDMNLNETHKAPLRQKDLVIKREMVMQYINAAAKSGLKSRSDHALTSSQEYIHELRAGIQDE----RLLGCLESLRVSLNSNPVSWVENFGHEGLGLLLDMLNSLQNSHKPENITRKNQHEIVRCLKAFMNNKYGLMRMLSEEQGILLLARAIEPAYPPMMADAVKLLSALCILEEERTHERILEALTQCGEQENRE-RFSTIVKGLGQRQGLQ-----LKVGCMQLINALLTS----------VDELDFRLHLRNEFMRCGLVDILQDLIVS-NDEPQDVQLRVFEENREDDFVELSHRYEDIRFELEYPFEVFQIVSNIVKDTLAEPYFLSILQHLLLIRNDYFVRPQYYKLIEECVSQIILHRN-GVDPD 409          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005288.1 (pep scaffold:Pmarinus_7.0:GL501244:1260:30258:-1 gene:ENSPMAG00000004723.1 transcript:ENSPMAT00000005288.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 106.301 bits (264), Expect = 1.657e-23
Identity = 85/340 (25.00%), Postives = 167/340 (49.12%), Query Frame = 1
Query: 1933 KRNVYQPEQPMKKANWNKINEKILSENSVWLSIKE-ETIPTDILKELENNFSXXXXXXXXXXX-----------------XXXXXXXPKILDGKTAQNISILLGSLRM-EYEKLKQAILEIDTSILTQ-SMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTN-NRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQL--KSFKGSAENDRFSEKMTPFVTTV 2883
            K+ + QP  P+K  NW+K+ E  +S ++VW  I +        L ++E  FS                             +   KE  ++DG+ AQN  ILL  +++  +E ++++    +   L   + + QLLK +PE   +  + E     + +   ++F Y +S I   + R +++ F+ KF +++ E K +      A  E+ +S +++++LE+VL+ GNYMN G R   + GF+++ L K++ TK   + N +L+H+L  I+ +   +   +  DL ++ +A R+ +      +  ++ GLK +E +L  +  +    +D+F   M+ F+T  
Sbjct:  536 KKKIPQPSNPLKSFNWSKLPENKIS-STVWSEIDDLRAFKVLDLADIERMFSAYQRQQTVFRWIRCVQKEMGSNEELLDCGSRKAKELSVIDGRRAQNCVILLSRIKITRFEVVQKSEERCERETLAHDTAVSQLLKFVPEKSDVDLLEEHKHETERMARADRFLYDMSRIPHYQQR-QALYFKKKFAERVAECKPKVEAILLASKELHQSRRLRQLLEVVLAFGNYMNKGQRG-NAYGFKISSLNKIADTKSSIDKNITLLHYLITILEKKYPDVVNIQDDLQHVPEAARVNMLELEKEINLVRGGLKDVEKELDFQRAQPGRPDDKFVSVMSDFITVA 872          

HSP 2 Score: 55.0694 bits (131), Expect = 1.061e-7
Identity = 57/244 (23.36%), Postives = 107/244 (43.85%), Query Frame = 1
Query:  592 GLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILTILTFFDYKSYQNVMDALFRAAKLNNYENRFVPLIESAKKNAQMENENESLSLATIRFINVIISPPFLNPNDSAQFDEY-YRLHLRREFVNNGLMQVFDELLCNPNLKL-THEQINQFLXXXXXXXXXXXXXXXTI-IRAFGDASDIFRIINRSVSNTKCEVNFRSILANLLIIREDPIRDD-----LFRFIDEIVQEIILQDDSGFCPD 1299
            G   ++A   +   IA+ LR +N+      +EIL  +       ++ V+ A+    K      RF  L+    ++     +  SL  A + FIN ++       N  A  D   +R+HLR EF+  G+  V D+L  + N  L  H    + +   +  +         +  ++ G    +F +I + +++T+   +  SIL + L   E P + +      ++ +D I+Q+++LQ D G  PD
Sbjct:  137 GRAHVLAHPASIETIAQSLRTENVRTKVAVLEILGAVCLVP-GGHKRVLQAMLHYQKYAAERTRFQTLVNELDRSTGRYRDEVSLKTAIMSFINAVL-------NAGAGKDNMEFRVHLRYEFLMLGIQPVIDKLRGHDNATLDKHLDFFEMIRNEDEAELAKRFDMTHVDTKSVG---QMFDVIRKKLAHTEAYPHL-SILQHCL---EMPYKRNGTMVQQWQLLDRILQQVVLQSDRGEDPD 365          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Yeast
Match: BNI1 (Formin; polarisome component; nucleates the formation of linear actin filaments, involved in cell processes such as budding and mitotic spindle orientation which require the formation of polarized actin cables; recruited to the division site in a Glc7p/Ref2p dependent manner following release of Bnr1p; functionally redundant with BNR1 [Source:SGD;Acc:S000005215])

HSP 1 Score: 67.0106 bits (162), Expect = 1.849e-11
Identity = 76/303 (25.08%), Postives = 143/303 (47.19%), Query Frame = 1
Query: 1876 AATSAAIPKPPSTLEKYGLKRNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIPTD-----ILKELENNFSXXXXXXXXXXXXXXXXXXPKILDGKTAQNISILLGSLR-MEYEKLKQAILEIDTSIL-TQSMIEQLLK--------NL-----PETEQMQKIAELGDVY------KDLIECEQFCYQLS-NIKK-LKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEII--NRSAFN 2694
            A TS  +P+ PS  EKY       +P + +K+ +W K++    ++NS+W + K E    D     +L +LE  F+ + +       K  + K    L    +Q   I L     +    L + IL  D   L T S++E L K        NL     P +   + +  L D         DL   +Q   QL  N++     R+ ++     ++ + NE+  +  + + A+S + +S+ ++ +  ++L++GN+MN  S+  Q+ GF+L+ L +L+  KD TN+ + ++++ +I+  N  +FN
Sbjct: 1335 AVTSPLLPQSPSLFEKYP------RPHKKLKQLHWEKLD---CTDNSIWGTGKAEKFADDLYEKGVLADLEKAFAAREIKSLASKRKEDLQKI-TFLSRDISQQFGINLHMYSSLSVADLVKKILNCDRDFLQTPSVVEFLSKSEIIEVSVNLARNYAPYSTDWEGVRNLEDAKPPEKDPNDLQRADQIYLQLMVNLESYWGSRMRALTVVTSYEREYNELLAKLRKVDKAVSALQESDNLRNVFNVILAVGNFMNDTSK--QAQGFKLSTLQRLTFIKDTTNSMTFLNYVEKIVRLNYPSFN 1625          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Nematostella
Match: EDO35335 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLQ1])

HSP 1 Score: 246.128 bits (627), Expect = 2.179e-67
Identity = 158/487 (32.44%), Postives = 260/487 (53.39%), Query Frame = 1
Query: 1945 YQPEQPMKKANWNKINEKILSENSVWLSIKEETIP-TDILKELENNFSXXXXXXXXXXXXXXXXXXP--------KILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEII-NRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKS-FKGSAENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFNX---------XXXXXXXXXXXXXXXXXRREKEKQMPVMSKTTSEEDSGVIDNLLAVLKSGDG---ALSPKRRKPKSKDARRQLNRSRSRGEFNENMSNNLIEIAS*NS 3336
            Y+PE  MK+ANW KIN + +++N  W  + EE +   D+L EL   F+ K    K         K          K+LD K+AQN+SI LGSL+  +E++K  IL  D   L++S IE LLK LP  EQM++++ + D   +L E EQF   +S+IKKL+ RL  +LF+ +F +++++ K     A AA  E+  S K  K+LE++L +GNYMN+GSRN+ +IGFE+++L KLSSTK     R+L+HF+A+ + N+ +   A    +L +++ A +++ +    +++ +   L+ IE +L++  + +   DRF + M  F ++ K+Q+ +       M   F+ V  +F  +     +EE F D+  F  ++ +  K N          ++        K +  +   EK K+ P++     +   GV+D L+  L++G        P R+K  +K   R  N SRSR   N  +   L E A+ NS
Sbjct:  500 YKPEAQMKRANWTKINNRNITDNCFWKKVNEEKLEREDMLAELTRTFAAKSAPKKLDNPDGEEKKSVAKKKAKELKVLDPKSAQNLSIFLGSLKSSHEEIKSHILHCDQEKLSESAIESLLKYLPSPEQMEQLSNMKDQISELSEPEQFAVHISDIKKLEQRLNCLLFRTRFPEEMSDTKPGVVNATAACREVKTSPKFAKLLELILLMGNYMNTGSRNEGTIGFEISYLTKLSSTKSVDGQRNLLHFIADAVENKYSSEIAGFENELGHVEAAGKVSEEILGKSISNMSANLRKIEKELEAKQQNTNPEDRFHDAMKEFYSSAKDQVDVLVEMHKNMVTMFKDVLEFFCMDPKKTSMEEFFGDLKTFMDQYSQCKKENMKRQEKEEKEKRAKERAEKEKERKSRMENEKSKRNPLVDMNADDNQEGVLDGLMQALQTGSAFRDPTRPARKKNPAKKGTRPANLSRSRTRSNIPVQKVLAEQAAANS 986          

HSP 2 Score: 114.005 bits (284), Expect = 1.319e-25
Identity = 98/381 (25.72%), Postives = 185/381 (48.56%), Query Frame = 1
Query:  244 MNIPIDKRSVIREKTQEQKLVMLKSCITSQI-------KPVTYYVELLKQIISEKLSESKICENLDQIRICLNSNPVSWIKEFDNKTNDGXXXXXXXXXXXXXXADSSIV--CLKCFRAFANCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILTILTFFDYKSYQNVMDALFRAAKLNNYENRFVPLIESAKKNAQMENENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQVFDEL--LCNPNLKLTHEQINQFLXXXXXXXXXXXXXXXTIIRAFGDASDIFRIINRSVSNTKCEVNFRSILANLLIIREDP-IRDDLFRFIDEIVQEIILQDDSGFCPDPTLKKFDKINLKKFYDG 1350
            MN+    +  IR++    K+ ML S    Q        + ++   + +K++    +S   + + L   R+ L   P+SWI+EF  +    L   L    ++  + +  I   C++C +A+ N  YGL  ++ S++    +AR + P    +M   V+++  +       +   ++A+    +L   + RF  ++++      + +++ SL +A I+FIN +IS P          D  +RLHLR EFV  GL   F +L  L N +L +   Q++ +    +++  E   +   I+  F D  +IF I+N  V +T  +  F SIL +LL+IR+D   R   ++ I+E+V +++L   SG  PD   ++F +I++    +G
Sbjct:    1 MNLSDAHKDPIRKRDMSTKMDMLFSFKRRQFASQQDSSEGMSSPGDYIKELQRSDVSLESLLKTLQSCRVSLTGRPLSWIQEFGGQGMHCLLKHLRNSCSVRGSVEKRIQHECVRCLKAYMNNKYGLQLMLKSEDGLTLLARSMDPNYPSMMTDVVKVMAAVCLV---KHDRAVEAMTVCGELEE-KGRFSKIVDA------LHDDHTSLKVACIQFINALISTPD---------DLDFRLHLRNEFVREGLNDAFQDLRDLENDDLNV---QLDIWEEHRDDDASEFQHRLNNIMVNFEDPGEIFSILNNLVQDTAADNLFLSILQHLLLIRDDVYARPQYYKLIEEVVSQVVLH-RSGVDPDFATRRF-QIDVDPLIEG 357          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Nematostella
Match: EDO32868 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STU3])

HSP 1 Score: 130.183 bits (326), Expect = 1.701e-30
Identity = 118/479 (24.63%), Postives = 230/479 (48.02%), Query Frame = 1
Query: 1936 RNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIPTDI-LKELENNFSXXXXXXXXXXXX-XXXXXXPK---ILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSI-LTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNR-SLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSFKGSAE---NDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEA-HKFNXXXXXXXXXXXXXXXXXXRREKEKQMPVMSKTTS-------------EEDSGVIDNLLAVLKSGD------GALSPKRRKPKSKDARRQLNRSRSRG 3282
            R   +P  P+K  NW+K+ +  + + +VW  I +  +  ++ L++ +  FS       +     T    +PK   ++D + AQN  ILL  L++  E++ +AIL ID    L++ M+EQLLK +P   +   + E      +    ++F Y +S I   + RL+++ F+ KF +++ ++K +      A  E+ +S++++ +LE++L+ GNYMN G+R   + GF+L  L ++  TK   N+R +L+++L  ++ +S  +  +L +DL+ +  A ++ L    S +  ++  LK +E +L       E    D+F + +  FV   +      E    ++ + F      F  +      ++ F     F   F EA H+  E KK  E    K +   E++E+++Q   + K  +              ++ G  D+L++ L++GD        +  +RR    K  R+  ++ R R 
Sbjct:  678 RKTPKPSNPLKSFNWSKLPDSKI-KGTVWTDIDDTKVYNEMDLEDFDRMFSAYQGKENQGIKDFTDSAAKPKELSLIDSRRAQNCGILLTKLKLSDEEITKAILTIDEEEELSKDMVEQLLKYVPTAAEKNLLNENNKEKDNFARADKFLYDMSRIVHYEQRLKALFFKKKFPERMGDLKPKVQAVIMACKEVTRSKRIRTLLEVILAFGNYMNRGARG-NATGFKLASLNRIVDTKSSANSRITLLNYLVTVLEKSYPDVLKLEEDLANVRTAAKVNLAELESEIVALRKELKEVEKELDFQTRKREKIPGDKFVDVIGSFVKVAQFSCCEVEEAWEELKQKFFKAVKLFGEDPKNLSSDQFFGIFNVFLVSFAEAKHQNEEIKKKKEAEERKRRALAEQKERDRQKSAIKKMMTPDKKQSASQKKVNTDNRGEFDDLISALRTGDVFGDEMSKIKGRRRTAPPKVPRKPDSQERERA 1154          

HSP 2 Score: 55.4546 bits (132), Expect = 1.465e-7
Identity = 102/405 (25.19%), Postives = 176/405 (43.46%), Query Frame = 1
Query:  202 ENEINDKFEKLLDDMNIPIDKRSVIREKTQEQK--LVMLKSCIT-----------------------SQIKPVTYYVELLKQIISEKLSESKICEN-------LDQIRICLNSNPVSWIKEFDNKTNDGXXXXXXXXXXXXXXADSSIV---CLKCFRAFANCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILTILTFFDYKSYQNVMDALFRAAKLNNYENRFVPLIESAKKNAQMENENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQVFDELLCNPNLKLTHEQINQFLXXXXXXXXXXXXXXXTIIRAFG-------DASDIFRIINRSVSNTKCEVNFRSILANLLIIRED-PIRDDLFRFIDEIVQEIILQDDSG 1287
            ENE+N KF +L++++++    +  + E   E+K  L + K  +T                       S      +Y++ LK + S+KL   K  E        LD ++  L + P+ ++  F     +GL+ LL  L  +      S +    + CF+A  N  +G   ++A       IA+ L  +NI      +EIL  +       ++  +DA+    K      RF  L+    ++  +  E  +L +A + FIN       L     A++ E+ R+HLR EF+  G+  V ++L    N  LT   +N F       D   NE  + + R FG        AS +  ++ R V +T    +  SIL +LL++  D  +   L++ ID +VQ+++LQ D G
Sbjct:   43 ENELNSKFAELVEELDLTAVHKKAMFELPPEKKWQLYLSKKKVTFGHFTKKGFSLSLIYVSKEQAEHSSTSYPEFYIDQLKSLNSQKLCLMKSDEETEMRSTLLDGLKTALRTQPLRFVHRFVEL--EGLSCLLNFLQNMDYETSQSKIHTAVIGCFKALMNSSHGRAHVLAHPTCIDIIAQSLLTENIKTKIQVLEILGAVCLVP-GGHKKALDAMTHFQKFAEERTRFQTLVNDLDRSTGVYKEEFNLKIAIMSFINAA-----LKYGAGAEYLEF-RVHLRFEFLMLGIQPVIEKLRTMDNATLTR-HLNFF-------DMVRNEDEKELARRFGMPYIDLRSASGMLELLRRKVGHTSAYPHLLSILHHLLLLPNDHSVARRLWQLIDRVVQQVVLQQDDG 430          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Nematostella
Match: EDO36709 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHT8])

HSP 1 Score: 105.531 bits (262), Expect = 7.145e-23
Identity = 78/296 (26.35%), Postives = 149/296 (50.34%), Query Frame = 1
Query: 2146 ILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKI--AELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSFKGSAENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEF 3027
            +LD K +Q I+I L  L      LKQAI+ +D++++ +  +++LL+  P  E+  KI  A+L +    L   EQF   ++++ +L PRL    F+L ++    EV     + + AL E+ K+   K IL  +L++GN++N     ++  GF+L++L K+   KD  + +SL++ L  ++     +  +L  +L  + +++R+  +  A  L  +K   K     L          +   KMT  +T  +E+I I +    ++   F+ +  Y   ++S  K  ++ N+  K  +EF
Sbjct: 1058 VLDVKRSQQINIALTKL-PPIRTLKQAIISMDSTVIDREGVDKLLQMQPLPEEKMKIQEAQLANPDVPLGTAEQFLLTMASLNELAPRLHLWAFKLDYEMLEKEVAEPLMDLKEALEELNKNNTFKHILATLLAIGNFLNG----KKVKGFQLDYLSKVPEVKDTVHKQSLLYHLCCMVMEKFPDTTDLYSELGALHRSSRVDFEVVAENLKNLKENCKRSWEHLSVVAKHDSTKQLKSKMTELLTDAQERITILKVVHRRVMNRFRKMLLYLGVSASITKKTKV-NEFCKIISEF 1347          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Nematostella
Match: EDO48372 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJG2])

HSP 1 Score: 102.064 bits (253), Expect = 1.073e-21
Identity = 107/383 (27.94%), Postives = 184/383 (48.04%), Query Frame = 1
Query: 1963 MKKANWNKINEKILSENSVWLSIKEETIPTDILK--ELENNFSXXXXXXXXXXXXXXXXXXPKILDGKTAQNI--------SILLGSLRMEYEKLKQAILEIDTS-ILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQ--LSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSG-SRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSFKGSA---ENDRFSEKMTPFVTT--VKEQIVIAET---------FQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEF 3027
            +K+ NW K++   L EN+VW  +       ++++  EL+ NFST     +++  K       ++L  K A NI        S+    L ++Y+     + ++D + I +  +     K +P                 L+ C    +   L N+KK   RL+++LF+ +FDDK +EVK        A +E+  S+K++++LE+VL  GNYMN G +R   +  F++++L KL++TK   N  +L++FL + I        ++  DL  +  A +++    A+ + ++   +K I++ L SF+  A   E DRF+E +   +T+   K Q +I ET          Q KMNE F+ V  +F    S    EE F   A F   F
Sbjct:  993 LKRVNWEKLSGVGL-ENTVWAQLGRNERLDNVIEFMELDQNFSTIQQTKEKEPKKPEKP---QVLGPKKAYNILHKVDNIMSMFCSKL-LKYKYFADDVSKMDIADIFSFEITPPYRKTVPYF---------------LLFCTALLHSHVLLNVKK---RLKAMLFRAQFDDKCDEVKPDLEAVIDAAAELRTSDKLQRVLELVLMTGNYMNKGNTRIAGAQAFKISYLTKLNTTKTTDNKSTLLNFLVQKIEERCPELLDVKDDLRTVPIAAKVSGQLLATEVQDLSRRMKGIKDDLISFQALASQKEEDRFTEVVINIITSSLTKCQNIIEETEGKLEELLDLQKKMNEDFRDVVKFFGEKDSKMTTEEFFGIFAAFLVHF 1352          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Nematostella
Match: EDO48258 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJG3])

HSP 1 Score: 83.5741 bits (205), Expect = 2.175e-16
Identity = 94/368 (25.54%), Postives = 178/368 (48.37%), Query Frame = 1
Query: 1966 KKANWNKINEKILSENSVW--LSIKEETIPTDILKELENNFSXXXXXXXXXXXXXXXXXXPKILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIE-CEQFCYQLS-NIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKL---SSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSFKGS--AENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHK 3042
            ++ +W  ++   L++ ++W  LS++E   P     ELE  F  +  V K +  K    ++  IL+ K   NISI L   ++  + +K+ +L   TS L   ++EQLL+ +P   +++ +    +V    +E  E FC +++  +   + R+ ++L + +  D+IN +K        A  EI  S K+   L++VL++GN+MN GS   Q+ GF + FL KL    ST DK  N S + ++   I R     A L  +L +++KA++++       + E++  ++ +E+ L     +   E+ +F E +  F    + Q       + +   +F +   YF   +S     + F  ++ F   F +A K
Sbjct:  255 RRLSWEIVSHSSLNKETIWKRLSVEEVVDPY----ELEMYFGAQATVPKPRHFKKITHRK-TILEHKKILNISITLAHSKLSADDVKKCLLS-GTSDLPSDVLEQLLRFVPSPNEIKALKRQEEVDPSALEGAEVFCLEVAKTVPAYEERIRTMLLKAQLQDRINHIKPYLTTVIEANKEIRNSTKLSDYLQMVLTVGNFMN-GS---QTAGFRVAFLTKLVFIKSTPDK--NVSFLDYITRQIIRKNPELALLTDELLHVEKASKVSFRTLDLDIEELREEVEILEDDLDKIAKTEIHEDSKFMEAIELFTHHARAQFQSLVELRHQAELSFATTLEYFGEETSISS-AQFFGLISTFLCHFKDAVK 609          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Medaka
Match: diaph2 (diaphanous related formin 2 [Source:NCBI gene;Acc:101156584])

HSP 1 Score: 261.151 bits (666), Expect = 1.090e-71
Identity = 166/483 (34.37%), Postives = 284/483 (58.80%), Query Frame = 1
Query: 1885 SAAIPKPPSTLEKYGLK-RNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIPT-DILKELENNFSXXXXXXXXXXXXX--------XXXXXPKILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSF-KGSAENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFNXXXXXXXXXXXXXXXXXXR------REKEKQMPVMSKTTSEEDSGVIDNLLAVLKSGDGALSPKRRKPKSKDARRQLNRSRSRG 3282
            SA + K P     YGL+ +  Y+PE  MK+ NW KI  + +SEN  W+ +KEE     D+  +L   FS++    K+ + +T           KE +ILD KTAQN+SI LGS R+ YE+++  +L++D   L++S+I+ L+KNLPE +++  +AEL   Y++L+E EQF   +S++K L+PRL  ILF+L F+++++ ++        A  E+ KS+   K LE+VL +GNYMN+GSRN Q+ GF ++FLCKL  TK  +++ +L+HFLAE    S         +L +++ A++++ +    +LT ++  ++ +EN +++F K   E D+F +KM+ F    +EQ     T    M + ++S+ +YF F+  +  +E+ F ++A F+  F+EA K N +K+ +EE+  +AKL KE+        ++K+  ++      +++GV+D L+  L+SG      ++R P++ D       SR  G
Sbjct:  565 SAPVVKLP-----YGLEPKKTYKPENVMKRVNWTKIVPQEMSENCFWIKVKEEKFENPDLFAQLSLCFSSQSKAKKDFSDETDDKVPQFKKKAKELRILDAKTAQNLSIFLGSFRLPYEEIRDIVLQVDEERLSESLIQNLIKNLPEQKELNALAELKSEYEELVESEQFGIVMSSVKLLRPRLNGILFKLTFEEQVSNIRPDIMNVTFACEEVKKSDSFSKFLELVLLVGNYMNAGSRNAQTFGFNVSFLCKLRDTKSISHSTTLLHFLAEKCEDSYPEIMRFPDELEHVESASKVSAEILKGSLTSMERHIQRLENDIENFPKTDDEQDKFVDKMSGFSKHAREQYEKLSTMHKNMQKLYESIGSYFAFDPHSVSVEDFFGELANFRMLFMEAVKENHKKREVEEKIKRAKLAKEKAEREKQERQQKKKQLIDMNKEGDETGVMDCLMEALQSGAAFRDRRKRTPRNGDQSPSSPASRWPG 1042          

HSP 2 Score: 115.546 bits (288), Expect = 1.227e-25
Identity = 116/401 (28.93%), Postives = 194/401 (48.38%), Query Frame = 1
Query:  196 LSENEINDKFEKLLDDMNIPIDKRSVIREKTQEQKLVMLKSCITSQIKPVTY--------------------YVELLKQIISEKLSESKICENLDQIRICLNSNPVSWIKEFDNKTNDGXXXXXXXXXXXXXXADS-----SIVCLKCFRAFANCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILTILTFFDYKSYQNVMDALFRA---AKLNNYENRFVPLIESAKKNAQMEN-ENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQVFDELLCNPNLKLTHE---QINQFLXXXXXXXXXXXXXXXTIIRAFGDASDIFRIINRSVSNTKCEVNFRSILANLLIIRED-PIRDDLFRFIDEIVQEIILQDDSGFCPD 1299
            LSE EIND FEK+++DMN+  ++++ +R K    K  M+   I++  K +T                     YV  L+  ISE+    K+   L+ +R+ L SNPVSW+  F ++   GL L         +  +S         ++C +AF N   GL K++  + + L +AR + P+   +M   V+IL+ +        +N++D +  A   A   N + RF P++E       +EN E + L +A ++ IN +++ P     D   F    R+HLR EF+  GL ++       P LK T E   Q+  F    E +  E++ + E I     D ++++ +++  V +T  E    S+L +LL+IR D  IR   ++ I+E V +I+L   SG  PD
Sbjct:   35 LSEKEINDLFEKMMEDMNLNEERKAPLRGKDLSTKREMVVQYISATAKSITGSKVAGGLRNSKHECTLSSQEYVHELRSGISEE----KLLNCLESLRVSLTSNPVSWVNNFGHE-GLGLLLDALEKLLDKKQQESIDKRNQHKLIQCLKAFMNNKDGLQKILGDERSLLLLARAIDPKQTSMMTEIVKILSAVCII---GEENILDKILAAMTIAAERNSKERFAPIVEG------LENHEAQQLQVACMQLINALVTSP-----DDLDF----RIHLRNEFLRCGLKKIL------PELKETEELDIQLKVFNENKEEDSIELSHRLEDIRAEMDDMNEVYHLLSNMVKDTASEPYLLSVLQHLLLIRNDYYIRPQYYKVIEESVAQIVLH-RSGMDPD 405          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Medaka
Match: diaph2 (diaphanous related formin 2 [Source:NCBI gene;Acc:101156584])

HSP 1 Score: 260.766 bits (665), Expect = 1.785e-71
Identity = 166/483 (34.37%), Postives = 284/483 (58.80%), Query Frame = 1
Query: 1885 SAAIPKPPSTLEKYGLK-RNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIPT-DILKELENNFSXXXXXXXXXXXXX--------XXXXXPKILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSF-KGSAENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFNXXXXXXXXXXXXXXXXXXR------REKEKQMPVMSKTTSEEDSGVIDNLLAVLKSGDGALSPKRRKPKSKDARRQLNRSRSRG 3282
            SA + K P     YGL+ +  Y+PE  MK+ NW KI  + +SEN  W+ +KEE     D+  +L   FS++    K+ + +T           KE +ILD KTAQN+SI LGS R+ YE+++  +L++D   L++S+I+ L+KNLPE +++  +AEL   Y++L+E EQF   +S++K L+PRL  ILF+L F+++++ ++        A  E+ KS+   K LE+VL +GNYMN+GSRN Q+ GF ++FLCKL  TK  +++ +L+HFLAE    S         +L +++ A++++ +    +LT ++  ++ +EN +++F K   E D+F +KM+ F    +EQ     T    M + ++S+ +YF F+  +  +E+ F ++A F+  F+EA K N +K+ +EE+  +AKL KE+        ++K+  ++      +++GV+D L+  L+SG      ++R P++ D       SR  G
Sbjct:  615 SAPVVKLP-----YGLEPKKTYKPENVMKRVNWTKIVPQEMSENCFWIKVKEEKFENPDLFAQLSLCFSSQSKAKKDFSDETDDKVPQFKKKAKELRILDAKTAQNLSIFLGSFRLPYEEIRDIVLQVDEERLSESLIQNLIKNLPEQKELNALAELKSEYEELVESEQFGIVMSSVKLLRPRLNGILFKLTFEEQVSNIRPDIMNVTFACEEVKKSDSFSKFLELVLLVGNYMNAGSRNAQTFGFNVSFLCKLRDTKSISHSTTLLHFLAEKCEDSYPEIMRFPDELEHVESASKVSAEILKGSLTSMERHIQRLENDIENFPKTDDEQDKFVDKMSGFSKHAREQYEKLSTMHKNMQKLYESIGSYFAFDPHSVSVEDFFGELANFRMLFMEAVKENHKKREVEEKIKRAKLAKEKAEREKQERQQKKKQLIDMNKEGDETGVMDCLMEALQSGAAFRDRRKRTPRNGDQSPSSPASRWPG 1092          

HSP 2 Score: 116.701 bits (291), Expect = 5.635e-26
Identity = 116/401 (28.93%), Postives = 194/401 (48.38%), Query Frame = 1
Query:  196 LSENEINDKFEKLLDDMNIPIDKRSVIREKTQEQKLVMLKSCITSQIKPVTY--------------------YVELLKQIISEKLSESKICENLDQIRICLNSNPVSWIKEFDNKTNDGXXXXXXXXXXXXXXADS-----SIVCLKCFRAFANCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILTILTFFDYKSYQNVMDALFRA---AKLNNYENRFVPLIESAKKNAQMEN-ENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQVFDELLCNPNLKLTHE---QINQFLXXXXXXXXXXXXXXXTIIRAFGDASDIFRIINRSVSNTKCEVNFRSILANLLIIRED-PIRDDLFRFIDEIVQEIILQDDSGFCPD 1299
            LSE EIND FEK+++DMN+  ++++ +R K    K  M+   I++  K +T                     YV  L+  ISE+    K+   L+ +R+ L SNPVSW+  F ++   GL L         +  +S         ++C +AF N   GL K++  + + L +AR + P+   +M   V+IL+ +        +N++D +  A   A   N + RF P++E       +EN E + L +A ++ IN +++ P     D   F    R+HLR EF+  GL ++       P LK T E   Q+  F    E +  E++ + E I     D ++++ +++  V +T  E    S+L +LL+IR D  IR   ++ I+E V +I+L   SG  PD
Sbjct:   85 LSEKEINDLFEKMMEDMNLNEERKAPLRGKDLSTKREMVVQYISATAKSITGSKVAGGLRNSKHECTLSSQEYVHELRSGISEE----KLLNCLESLRVSLTSNPVSWVNNFGHE-GLGLLLDALEKLLDKKQQESIDKRNQHKLIQCLKAFMNNKDGLQKILGDERSLLLLARAIDPKQTSMMTEIVKILSAVCII---GEENILDKILAAMTIAAERNSKERFAPIVEG------LENHEAQQLQVACMQLINALVTSP-----DDLDF----RIHLRNEFLRCGLKKIL------PELKETEELDIQLKVFNENKEEDSIELSHRLEDIRAEMDDMNEVYHLLSNMVKDTASEPYLLSVLQHLLLIRNDYYIRPQYYKVIEESVAQIVLH-RSGMDPD 455          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Medaka
Match: diaph2 (diaphanous related formin 2 [Source:NCBI gene;Acc:101156584])

HSP 1 Score: 260.766 bits (665), Expect = 2.272e-71
Identity = 166/483 (34.37%), Postives = 284/483 (58.80%), Query Frame = 1
Query: 1885 SAAIPKPPSTLEKYGLK-RNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIPT-DILKELENNFSXXXXXXXXXXXXX--------XXXXXPKILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSF-KGSAENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFNXXXXXXXXXXXXXXXXXXR------REKEKQMPVMSKTTSEEDSGVIDNLLAVLKSGDGALSPKRRKPKSKDARRQLNRSRSRG 3282
            SA + K P     YGL+ +  Y+PE  MK+ NW KI  + +SEN  W+ +KEE     D+  +L   FS++    K+ + +T           KE +ILD KTAQN+SI LGS R+ YE+++  +L++D   L++S+I+ L+KNLPE +++  +AEL   Y++L+E EQF   +S++K L+PRL  ILF+L F+++++ ++        A  E+ KS+   K LE+VL +GNYMN+GSRN Q+ GF ++FLCKL  TK  +++ +L+HFLAE    S         +L +++ A++++ +    +LT ++  ++ +EN +++F K   E D+F +KM+ F    +EQ     T    M + ++S+ +YF F+  +  +E+ F ++A F+  F+EA K N +K+ +EE+  +AKL KE+        ++K+  ++      +++GV+D L+  L+SG      ++R P++ D       SR  G
Sbjct:  629 SAPVVKLP-----YGLEPKKTYKPENVMKRVNWTKIVPQEMSENCFWIKVKEEKFENPDLFAQLSLCFSSQSKAKKDFSDETDDKVPQFKKKAKELRILDAKTAQNLSIFLGSFRLPYEEIRDIVLQVDEERLSESLIQNLIKNLPEQKELNALAELKSEYEELVESEQFGIVMSSVKLLRPRLNGILFKLTFEEQVSNIRPDIMNVTFACEEVKKSDSFSKFLELVLLVGNYMNAGSRNAQTFGFNVSFLCKLRDTKSISHSTTLLHFLAEKCEDSYPEIMRFPDELEHVESASKVSAEILKGSLTSMERHIQRLENDIENFPKTDDEQDKFVDKMSGFSKHAREQYEKLSTMHKNMQKLYESIGSYFAFDPHSVSVEDFFGELANFRMLFMEAVKENHKKREVEEKIKRAKLAKEKAEREKQERQQKKKQLIDMNKEGDETGVMDCLMEALQSGAAFRDRRKRTPRNGDQSPSSPASRWPG 1106          

HSP 2 Score: 115.931 bits (289), Expect = 1.175e-25
Identity = 115/394 (29.19%), Postives = 192/394 (48.73%), Query Frame = 1
Query:  196 LSENEINDKFEKLLDDMNIPIDKRSVIREKTQEQKLVMLKSCITSQIKPVTY-------------YVELLKQIISEKLSESKICENLDQIRICLNSNPVSWIKEFDNKTNDGXXXXXXXXXXXXXXADS-----SIVCLKCFRAFANCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILTILTFFDYKSYQNVMDALFRA---AKLNNYENRFVPLIESAKKNAQMEN-ENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQVFDELLCNPNLKLTHE---QINQFLXXXXXXXXXXXXXXXTIIRAFGDASDIFRIINRSVSNTKCEVNFRSILANLLIIRED-PIRDDLFRFIDEIVQEIILQDDSGFCPD 1299
            LSE EIND FEK+++DMN+  ++++ +R K    K  M+   I++  K                 YV  L+  ISE+    K+   L+ +R+ L SNPVSW+  F ++   GL L         +  +S         ++C +AF N   GL K++  + + L +AR + P+   +M   V+IL+ +        +N++D +  A   A   N + RF P++E       +EN E + L +A ++ IN +++ P     D   F    R+HLR EF+  GL ++       P LK T E   Q+  F    E +  E++ + E I     D ++++ +++  V +T  E    S+L +LL+IR D  IR   ++ I+E V +I+L   SG  PD
Sbjct:   85 LSEKEINDLFEKMMEDMNLNEERKAPLRGKDLSTKREMVVQYISATAKSGGLRNSKHECTLSSQEYVHELRSGISEE----KLLNCLESLRVSLTSNPVSWVNNFGHE-GLGLLLDALEKLLDKKQQESIDKRNQHKLIQCLKAFMNNKDGLQKILGDERSLLLLARAIDPKQTSMMTEIVKILSAVCII---GEENILDKILAAMTIAAERNSKERFAPIVEG------LENHEAQQLQVACMQLINALVTSP-----DDLDF----RIHLRNEFLRCGLKKIL------PELKETEELDIQLKVFNENKEEDSIELSHRLEDIRAEMDDMNEVYHLLSNMVKDTASEPYLLSVLQHLLLIRNDYYIRPQYYKVIEESVAQIVLH-RSGMDPD 448          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Medaka
Match: diaph2 (diaphanous related formin 2 [Source:NCBI gene;Acc:101156584])

HSP 1 Score: 260.766 bits (665), Expect = 2.546e-71
Identity = 166/483 (34.37%), Postives = 284/483 (58.80%), Query Frame = 1
Query: 1885 SAAIPKPPSTLEKYGLK-RNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIPT-DILKELENNFSXXXXXXXXXXXXX--------XXXXXPKILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSF-KGSAENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFNXXXXXXXXXXXXXXXXXXR------REKEKQMPVMSKTTSEEDSGVIDNLLAVLKSGDGALSPKRRKPKSKDARRQLNRSRSRG 3282
            SA + K P     YGL+ +  Y+PE  MK+ NW KI  + +SEN  W+ +KEE     D+  +L   FS++    K+ + +T           KE +ILD KTAQN+SI LGS R+ YE+++  +L++D   L++S+I+ L+KNLPE +++  +AEL   Y++L+E EQF   +S++K L+PRL  ILF+L F+++++ ++        A  E+ KS+   K LE+VL +GNYMN+GSRN Q+ GF ++FLCKL  TK  +++ +L+HFLAE    S         +L +++ A++++ +    +LT ++  ++ +EN +++F K   E D+F +KM+ F    +EQ     T    M + ++S+ +YF F+  +  +E+ F ++A F+  F+EA K N +K+ +EE+  +AKL KE+        ++K+  ++      +++GV+D L+  L+SG      ++R P++ D       SR  G
Sbjct:  636 SAPVVKLP-----YGLEPKKTYKPENVMKRVNWTKIVPQEMSENCFWIKVKEEKFENPDLFAQLSLCFSSQSKAKKDFSDETDDKVPQFKKKAKELRILDAKTAQNLSIFLGSFRLPYEEIRDIVLQVDEERLSESLIQNLIKNLPEQKELNALAELKSEYEELVESEQFGIVMSSVKLLRPRLNGILFKLTFEEQVSNIRPDIMNVTFACEEVKKSDSFSKFLELVLLVGNYMNAGSRNAQTFGFNVSFLCKLRDTKSISHSTTLLHFLAEKCEDSYPEIMRFPDELEHVESASKVSAEILKGSLTSMERHIQRLENDIENFPKTDDEQDKFVDKMSGFSKHAREQYEKLSTMHKNMQKLYESIGSYFAFDPHSVSVEDFFGELANFRMLFMEAVKENHKKREVEEKIKRAKLAKEKAEREKQERQQKKKQLIDMNKEGDETGVMDCLMEALQSGAAFRDRRKRTPRNGDQSPSSPASRWPG 1113          

HSP 2 Score: 117.087 bits (292), Expect = 4.702e-26
Identity = 115/401 (28.68%), Postives = 194/401 (48.38%), Query Frame = 1
Query:  196 LSENEINDKFEKLLDDMNIPIDKRSVIREKTQEQKLVMLKSCITSQIKPVTY--------------------YVELLKQIISEKLSESKICENLDQIRICLNSNPVSWIKEFDNKTNDGXXXXXXXXXXXXXXADS-----SIVCLKCFRAFANCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILTILTFFDYKSYQNVMDALFRA---AKLNNYENRFVPLIESAKKNAQMEN-ENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQVFDELLCNPNLKLTHE---QINQFLXXXXXXXXXXXXXXXTIIRAFGDASDIFRIINRSVSNTKCEVNFRSILANLLIIRED-PIRDDLFRFIDEIVQEIILQDDSGFCPD 1299
            LSE EIND FEK+++DMN+  ++++ +R K    K  M+   I++  K +T                     YV  L+  ISE+    K+   L+ +R+ L SNPVSW+  F ++   GL L         +  +S         ++C +AF N   GL K++  + + L +AR + P+   +M   V+IL+ +        +N++D +  A   A   N + RF P++E       +EN E + L +A ++ IN +++ P          D  +R+HLR EF+  GL ++       P LK T E   Q+  F    E +  E++ + E I     D ++++ +++  V +T  E    S+L +LL+IR D  IR   ++ I+E V +I+L   SG  PD
Sbjct:   85 LSEKEINDLFEKMMEDMNLNEERKAPLRGKDLSTKREMVVQYISATAKSITGSKVAGGLRNSKHECTLSSQEYVHELRSGISEE----KLLNCLESLRVSLTSNPVSWVNNFGHE-GLGLLLDALEKLLDKKQQESIDKRNQHKLIQCLKAFMNNKDGLQKILGDERSLLLLARAIDPKQTSMMTEIVKILSAVCII---GEENILDKILAAMTIAAERNSKERFAPIVEG------LENHEAQQLQVACMQLINALVTSP---------DDLDFRIHLRNEFLRCGLKKIL------PELKETEELDIQLKVFNENKEEDSIELSHRLEDIRAEMDDMNEVYHLLSNMVKDTASEPYLLSVLQHLLLIRNDYYIRPQYYKVIEESVAQIVLH-RSGMDPD 455          
BLAST of Protein diaphanous homolog 2 vs. Ensembl Medaka
Match: diaph2 (diaphanous related formin 2 [Source:NCBI gene;Acc:101156584])

HSP 1 Score: 260.381 bits (664), Expect = 2.653e-71
Identity = 166/483 (34.37%), Postives = 284/483 (58.80%), Query Frame = 1
Query: 1885 SAAIPKPPSTLEKYGLK-RNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIPT-DILKELENNFSXXXXXXXXXXXXX--------XXXXXPKILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSF-KGSAENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFNXXXXXXXXXXXXXXXXXXR------REKEKQMPVMSKTTSEEDSGVIDNLLAVLKSGDGALSPKRRKPKSKDARRQLNRSRSRG 3282
            SA + K P     YGL+ +  Y+PE  MK+ NW KI  + +SEN  W+ +KEE     D+  +L   FS++    K+ + +T           KE +ILD KTAQN+SI LGS R+ YE+++  +L++D   L++S+I+ L+KNLPE +++  +AEL   Y++L+E EQF   +S++K L+PRL  ILF+L F+++++ ++        A  E+ KS+   K LE+VL +GNYMN+GSRN Q+ GF ++FLCKL  TK  +++ +L+HFLAE    S         +L +++ A++++ +    +LT ++  ++ +EN +++F K   E D+F +KM+ F    +EQ     T    M + ++S+ +YF F+  +  +E+ F ++A F+  F+EA K N +K+ +EE+  +AKL KE+        ++K+  ++      +++GV+D L+  L+SG      ++R P++ D       SR  G
Sbjct:  625 SAPVVKLP-----YGLEPKKTYKPENVMKRVNWTKIVPQEMSENCFWIKVKEEKFENPDLFAQLSLCFSSQSKAKKDFSDETDDKVPQFKKKAKELRILDAKTAQNLSIFLGSFRLPYEEIRDIVLQVDEERLSESLIQNLIKNLPEQKELNALAELKSEYEELVESEQFGIVMSSVKLLRPRLNGILFKLTFEEQVSNIRPDIMNVTFACEEVKKSDSFSKFLELVLLVGNYMNAGSRNAQTFGFNVSFLCKLRDTKSISHSTTLLHFLAEKCEDSYPEIMRFPDELEHVESASKVSAEILKGSLTSMERHIQRLENDIENFPKTDDEQDKFVDKMSGFSKHAREQYEKLSTMHKNMQKLYESIGSYFAFDPHSVSVEDFFGELANFRMLFMEAVKENHKKREVEEKIKRAKLAKEKAEREKQERQQKKKQLIDMNKEGDETGVMDCLMEALQSGAAFRDRRKRTPRNGDQSPSSPASRWPG 1102          

HSP 2 Score: 117.087 bits (292), Expect = 4.705e-26
Identity = 116/401 (28.93%), Postives = 194/401 (48.38%), Query Frame = 1
Query:  196 LSENEINDKFEKLLDDMNIPIDKRSVIREKTQEQKLVMLKSCITSQIKPVTY--------------------YVELLKQIISEKLSESKICENLDQIRICLNSNPVSWIKEFDNKTNDGXXXXXXXXXXXXXXADS-----SIVCLKCFRAFANCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILTILTFFDYKSYQNVMDALFRA---AKLNNYENRFVPLIESAKKNAQMEN-ENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQVFDELLCNPNLKLTHE---QINQFLXXXXXXXXXXXXXXXTIIRAFGDASDIFRIINRSVSNTKCEVNFRSILANLLIIRED-PIRDDLFRFIDEIVQEIILQDDSGFCPD 1299
            LSE EIND FEK+++DMN+  ++++ +R K    K  M+   I++  K +T                     YV  L+  ISE+    K+   L+ +R+ L SNPVSW+  F ++   GL L         +  +S         ++C +AF N   GL K++  + + L +AR + P+   +M   V+IL+ +        +N++D +  A   A   N + RF P++E       +EN E + L +A ++ IN +++ P     D   F    R+HLR EF+  GL ++       P LK T E   Q+  F    E +  E++ + E I     D ++++ +++  V +T  E    S+L +LL+IR D  IR   ++ I+E V +I+L   SG  PD
Sbjct:   74 LSEKEINDLFEKMMEDMNLNEERKAPLRGKDLSTKREMVVQYISATAKSITGSKVAGGLRNSKHECTLSSQEYVHELRSGISEE----KLLNCLESLRVSLTSNPVSWVNNFGHE-GLGLLLDALEKLLDKKQQESIDKRNQHKLIQCLKAFMNNKDGLQKILGDERSLLLLARAIDPKQTSMMTEIVKILSAVCII---GEENILDKILAAMTIAAERNSKERFAPIVEG------LENHEAQQLQVACMQLINALVTSP-----DDLDF----RIHLRNEFLRCGLKKIL------PELKETEELDIQLKVFNENKEEDSIELSHRLEDIRAEMDDMNEVYHLLSNMVKDTASEPYLLSVLQHLLLIRNDYYIRPQYYKVIEESVAQIVLH-RSGMDPD 444          
BLAST of Protein diaphanous homolog 2 vs. Planmine SMEST
Match: SMESG000057806.1 (SMESG000057806.1)

HSP 1 Score: 887.1 bits (2291), Expect = 0.000e+0
Identity = 485/485 (100.00%), Postives = 485/485 (100.00%), Query Frame = 1
Query: 1873 RAATSAAIPKPPSTLEKYGLKRNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIPTDILKELENNFSXXXXXXXXXXXXXXXXXXPKILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSFKGSAENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFNXXXXXXXXXXXXXXXXXXRREKEKQMPVMSKTTSEEDSGVIDNLLAVLKSGDGALSPKRRKPKSKDARRQLNRSRSRGEFNENMSNNLIEIAS 3327
            RAATSAAIPKPPSTLEKYGLKRNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIPTDILKELENNFSTKVVVVKEKTVKTTVVKEPKILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSFKGSAENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFNEEKKLLEERALKAKLDKERREKEKQMPVMSKTTSEEDSGVIDNLLAVLKSGDGALSPKRRKPKSKDARRQLNRSRSRGEFNENMSNNLIEIAS
Sbjct:  600 RAATSAAIPKPPSTLEKYGLKRNVYQPEQPMKKANWNKINEKILSENSVWLSIKEETIPTDILKELENNFSTKVVVVKEKTVKTTVVKEPKILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSFKGSAENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFNEEKKLLEERALKAKLDKERREKEKQMPVMSKTTSEEDSGVIDNLLAVLKSGDGALSPKRRKPKSKDARRQLNRSRSRGEFNENMSNNLIEIAS 1084          

HSP 2 Score: 853.588 bits (2204), Expect = 0.000e+0
Identity = 495/495 (100.00%), Postives = 495/495 (100.00%), Query Frame = 1
Query:   82 MDRRDGXXXXXXXXXXXXXXXXXXXXXXXXXXNLSDTSLSENEINDKFEKLLDDMNIPIDKRSVIREKTQEQKLVMLKSCITSQIKPVTYYVELLKQIISEKLSESKICENLDQIRICLNSNPVSWIKEFDNKTNDGXXXXXXXXXXXXXXADSSIVCLKCFRAFANCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILTILTFFDYKSYQNVMDALFRAAKLNNYENRFVPLIESAKKNAQMENENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQVFDELLCNPNLKLTHEQINQFLXXXXXXXXXXXXXXXTIIRAFGDASDIFRIINRSVSNTKCEVNFRSILANLLIIREDPIRDDLFRFIDEIVQEIILQDDSGFCPDPTLKKFDKINLKKFYDGSHVEELKRELDSXXXXXXXXXXXXXXXXTKEKLDDSQTSDAFKKAKDRIENAEMQKNIEKETPRPKDSNANS 1566
            MDRRDGLKKSSFFKTKTKPEKKEKREKETLKPNLSDTSLSENEINDKFEKLLDDMNIPIDKRSVIREKTQEQKLVMLKSCITSQIKPVTYYVELLKQIISEKLSESKICENLDQIRICLNSNPVSWIKEFDNKTNDGLNLLLAVLSTLTETADSSIVCLKCFRAFANCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILTILTFFDYKSYQNVMDALFRAAKLNNYENRFVPLIESAKKNAQMENENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQVFDELLCNPNLKLTHEQINQFLSEYENEDEEVNEKSETIIRAFGDASDIFRIINRSVSNTKCEVNFRSILANLLIIREDPIRDDLFRFIDEIVQEIILQDDSGFCPDPTLKKFDKINLKKFYDGSHVEELKRELDSERLKKDELKIKLELYKTKEKLDDSQTSDAFKKAKDRIENAEMQKNIEKETPRPKDSNANS
Sbjct:    1 MDRRDGLKKSSFFKTKTKPEKKEKREKETLKPNLSDTSLSENEINDKFEKLLDDMNIPIDKRSVIREKTQEQKLVMLKSCITSQIKPVTYYVELLKQIISEKLSESKICENLDQIRICLNSNPVSWIKEFDNKTNDGLNLLLAVLSTLTETADSSIVCLKCFRAFANCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILTILTFFDYKSYQNVMDALFRAAKLNNYENRFVPLIESAKKNAQMENENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQVFDELLCNPNLKLTHEQINQFLSEYENEDEEVNEKSETIIRAFGDASDIFRIINRSVSNTKCEVNFRSILANLLIIREDPIRDDLFRFIDEIVQEIILQDDSGFCPDPTLKKFDKINLKKFYDGSHVEELKRELDSERLKKDELKIKLELYKTKEKLDDSQTSDAFKKAKDRIENAEMQKNIEKETPRPKDSNANS 495          
BLAST of Protein diaphanous homolog 2 vs. Planmine SMEST
Match: SMESG000036976.1 (SMESG000036976.1)

HSP 1 Score: 257.299 bits (656), Expect = 7.366e-71
Identity = 167/467 (35.76%), Postives = 268/467 (57.39%), Query Frame = 1
Query: 1948 QPEQPMKKANWNKINEKILSENSVWLSIKEETIPT-DILKELENNFSXXX----XXXXXXXXXXXXXXXPK------ILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSFKGSAENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFNXXXXXXXXXXXXXXXXXXRREKEK--QMPVMSKTTSEEDSGVIDNLLAVLKSGDGALS---PKRRKPKSKDARRQLNRSRSRGEFNENM 3300
            +P+  MKKANWNK++ K+L  N VW  I +  + T ++L EL   FST+      V  + +   +    PK      +LD K+ QN++IL GS ++  E++K+ ILE+D  +LTQ+ +E LLK+LP  EQ+ K++ + D Y++L E EQF   LS IK L  RL S LF++KF ++I+++K     A  AL+EI  S    KILE++L  GN+MN+ S++ Q++ F +NFL KL  TKD  N  +L+ F+   +            + SY+DKA +++ +   ST+ E+K     +E +LK +K  ++ND +   M  F+  V EQ+ +       +  +F+ ++ Y +F+   Y +EE F+D+  FK  F +A+K  E     E R  KA+ ++ RRE EK  +     K T E+D  V+DNLL  L SG+   +   P++++ K  +    +NRSRSR +F++N+
Sbjct:  526 KPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETINSTIVEMKKMKTDLERELKDYKQQSDNDNYFLVMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEHRRQKAREEQLRREMEKTERHTRQCKATQEDDKKVLDNLLVTLNSGNAFGNRKDPRKKRLKKTENIVVINRSRSRRDFDKNL 992          

HSP 2 Score: 249.21 bits (635), Expect = 3.929e-68
Identity = 144/395 (36.46%), Postives = 244/395 (61.77%), Query Frame = 1
Query:  196 LSENEINDKFEKLLDDMNIPIDKRSVIREKTQEQKLVMLKSCITSQIKPVTYYVELLKQIISEKLSESKICENLDQIRICLNSNPVSWIKEFDNKTNDGXXXXXXXXXXXXXXADSSIVCLKCFRAFANCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILTILTFFDYKSYQNVMDALFRAAKLNNYENRFVPLIESAKKNAQMENENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQVFDELLCNPNLKLTHEQINQFLXXXXXXXXXXXXXXXTI-IRAFGDASD-IFRIINRSVSNTKCEVNFRSILANLLIIREDPIRDDLFRFIDEIVQEIILQDDSGFCPDPTLKKFDKINL----KKFYDGSHVE 1362
            ++E+E  + F K +D+MNI +DKR  +  ++ E K  +L    +S     + Y+  L  I+  + +  KI   LD +R+ LNS+P+S +KEF+N++N+GLN L+ VLS   + A+ S+ CLKC RAF NCGYGLL L+ +  A L+++ CL  Q  +LM +A+E+LT+ TF+ ++S+ NVM+AL+  A++ N+  RF+P+I     +  + N   +L +  ++FINVI++P F + +  +  D YYR+HLR EFV+ GL    D L       +  E I Q++  ++ + ++ +E +  I +       D +++++NR++  T C+ +  SIL +L+II++ PIR +LFR I++++ E+IL  D G C DPTL + D  NL    +KF D ++++
Sbjct:   32 MTESEFEEVFAKFMDEMNIGLDKRGPLLTRSIEDKRKLLSQIHSSSETSPSNYINTLVDIVERQWAIEKIIVKLDSLRVYLNSSPLSRVKEFNNESNNGLNKLVIVLSHYIDNAEISLHCLKCLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFYSFESHANVMEALYLGAQMQNHIQRFIPIINGL--DVGIHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSL-----SNIDDENIKQYILAFQTDTDDEDEYNNKIELEVLLQNRDAVYQLLNRTLCQTNCDSSLTSILKHLVIIKDTPIRYNLFRLINDVISELILHSD-GMCLDPTLNQLDGYNLTDVFEKFNDPNYLQ 418          
BLAST of Protein diaphanous homolog 2 vs. Planmine SMEST
Match: SMESG000025056.1 (SMESG000025056.1)

HSP 1 Score: 206.453 bits (524), Expect = 2.876e-54
Identity = 110/162 (67.90%), Postives = 119/162 (73.46%), Query Frame = 1
Query:  355 VELLKQIISEKLSESKICENLDQIRICLNSNPVSWIKEFDNKTNDGXXXXXXXXXXXXXXADSSIVCLKCFRAFANCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILTILTFFDYKSYQNVMDALFRAAKLNNYENRFVPLIESAKKNAQMENENE 840
            +ELLKQIISEK+ ESKICE+LD+IRICLNSNPVSWIK+F NK NDG                     L  F          +++ ASDN YLFIARCLR QNIHLMYVAVEILTIL FFDYKSYQ VMDALFRAAKLNNYEN FV L+ESAKKNAQMENENE
Sbjct:  813 IELLKQIISEKVLESKICEDLDRIRICLNSNPVSWIKDFSNKINDG---------------------LNVF----------IEINASDNVYLFIARCLRSQNIHLMYVAVEILTILIFFDYKSYQKVMDALFRAAKLNNYENHFVSLLESAKKNAQMENENE 943          
BLAST of Protein diaphanous homolog 2 vs. Planmine SMEST
Match: SMESG000054598.1 (SMESG000054598.1)

HSP 1 Score: 123.635 bits (309), Expect = 3.179e-28
Identity = 99/357 (27.73%), Postives = 180/357 (50.42%), Query Frame = 1
Query: 1963 MKKANWNKINEKILSENSVWLSIKEETIPTD-ILKELENNFSXXXXXXXXXXXXXXXXXXPKILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQ-LKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSFKGSAENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEF 3027
             K+ N   I E  L+E S+WL + + T+ TD I+ +L   F++K     +      ++    +LD K AQN  I L S+ M+ E++  AI +++  ++T  MI +L+  +P+  Q+ K+    D  +DL  CEQF   L  +   K R   I  Q L  +D + EV+       ++  ++L S+K+K +LE+V+ +   MN     ++ +G  L+ L K   TKD  N  +L+ FL E +        ++  DL  +D A+R++ D+  S + +  T LK+++  ++    + ++     +++  V   K  +      Q +++  +Q V  YF  + S Y  E+LF+D+  FK +F
Sbjct:  662 FKRINVTLIPETCLNEKSIWLQLNKTTLSTDKIVGKLFARFASKKAAEFKTKFVKPLI----VLDSKNAQNFEIFLRSVNMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYSSFEKLLSSDKLKSVLEMVVFITQSMNP---EKKIVGITLDSLAKFVDTKDNCNG-NLLEFLVEQLRDLVPESLKVWDDLDSLDSASRISSDSINSVVNQFSTVLKSLQCDIE----NIDSINLRSEISVTVELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQF 1006          
BLAST of Protein diaphanous homolog 2 vs. Planmine SMEST
Match: SMESG000044336.1 (SMESG000044336.1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.072e-14
Identity = 60/207 (28.99%), Postives = 106/207 (51.21%), Query Frame = 1
Query: 2269 EQLLKNLP---ETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSFKGSAEN--DRFSEKMTPFV 2874
            ++LL  LP   ET+  + I   G+    L   ++    LS I +++ +LE+IL+   FD+    ++ +      A   +++S+K+KKILEIVL+ GN MN  SR  ++IGF +  L  L   +   +  SL++++A  I     +      +L Y++ A+R++L    +   E+ TGL  +  +L   K + EN  D    ++  FV
Sbjct:  785 DRLLYQLPSFQETDMYRDIT--GESLNVLANEDRLVALLSCIDRVEMKLEAILYMDAFDETYFALQEKIRTVALACRSVMESQKLKKILEIVLAFGNRMND-SRRGKAIGFRIQSLDMLPECRSPDDKWSLMNYIAFCIEEKFPDLKNFFSELEYVEDASRVSLCNLMAAFEELSTGLDRVAEELSLIKNAVENNPDLIPTRLVNFV 988          
The following BLAST results are available for this feature:
BLAST of Protein diaphanous homolog 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DIAPH21.654e-8237.50diaphanous related formin 2 [Source:HGNC Symbol;Ac... [more]
DIAPH22.716e-8237.50diaphanous related formin 2 [Source:HGNC Symbol;Ac... [more]
DIAPH29.026e-7936.68diaphanous related formin 2 [Source:HGNC Symbol;Ac... [more]
DIAPH21.826e-7836.68diaphanous related formin 2 [Source:HGNC Symbol;Ac... [more]
DIAPH22.014e-7836.68diaphanous related formin 2 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Protein diaphanous homolog 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyk-12.684e-4029.70CYtoKinesis defect [Source:UniProtKB/TrEMBL;Acc:Q... [more]
cyk-13.029e-4029.70CYtoKinesis defect [Source:UniProtKB/TrEMBL;Acc:Q... [more]
daam-12.143e-2926.28DAAM (Disheveled-Associated Activator of Morphogen... [more]
daam-12.143e-2926.28DAAM (Disheveled-Associated Activator of Morphogen... [more]
daam-12.288e-2926.28DAAM (Disheveled-Associated Activator of Morphogen... [more]
back to top
BLAST of Protein diaphanous homolog 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dia6.502e-6833.19gene:FBgn0011202 transcript:FBtr0081410[more]
dia6.502e-6833.19gene:FBgn0011202 transcript:FBtr0335145[more]
dia6.502e-6833.19gene:FBgn0011202 transcript:FBtr0081411[more]
dia7.286e-6833.19gene:FBgn0011202 transcript:FBtr0305961[more]
DAAM4.377e-3528.43gene:FBgn0025641 transcript:FBtr0342731[more]
back to top
BLAST of Protein diaphanous homolog 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
diaph23.314e-7433.62diaphanous-related formin 2 [Source:ZFIN;Acc:ZDB-G... [more]
diaph33.475e-7034.55diaphanous-related formin 3 [Source:ZFIN;Acc:ZDB-G... [more]
diaph34.043e-6433.33diaphanous-related formin 3 [Source:ZFIN;Acc:ZDB-G... [more]
diaph27.337e-5638.27diaphanous-related formin 2 [Source:ZFIN;Acc:ZDB-G... [more]
CABZ01057928.18.850e-5636.40protein diaphanous homolog 1-like [Source:NCBI gen... [more]
back to top
BLAST of Protein diaphanous homolog 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DIAPH28.601e-7336.46diaphanous related formin 2 [Source:NCBI gene;Acc:... [more]
DIAPH24.295e-7136.18diaphanous related formin 2 [Source:NCBI gene;Acc:... [more]
atrn1.767e-6534.38attractin [Source:Xenbase;Acc:XB-GENE-953934][more]
DIAPH12.139e-6534.41diaphanous related formin 1 [Source:NCBI gene;Acc:... [more]
atrn6.032e-6534.90attractin [Source:Xenbase;Acc:XB-GENE-953934][more]
back to top
BLAST of Protein diaphanous homolog 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Diaph25.562e-8338.35diaphanous related formin 2 [Source:MGI Symbol;Acc... [more]
Diaph27.008e-8338.35diaphanous related formin 2 [Source:MGI Symbol;Acc... [more]
Diaph21.514e-8238.35diaphanous related formin 2 [Source:MGI Symbol;Acc... [more]
Diaph32.669e-7436.15diaphanous related formin 3 [Source:MGI Symbol;Acc... [more]
Diaph34.315e-7436.15diaphanous related formin 3 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Protein diaphanous homolog 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O70566|DIAP2_MOUSE4.902e-8238.35Protein diaphanous homolog 2 OS=Mus musculus OX=10... [more]
sp|O60879|DIAP2_HUMAN7.943e-8237.50Protein diaphanous homolog 2 OS=Homo sapiens OX=96... [more]
sp|F1LVW7|DIAP3_RAT1.843e-7436.36Protein diaphanous homolog 3 OS=Rattus norvegicus ... [more]
sp|Q9Z207|DIAP3_MOUSE1.867e-7336.15Protein diaphanous homolog 3 OS=Mus musculus OX=10... [more]
sp|Q9NSV4|DIAP3_HUMAN6.400e-7134.18Protein diaphanous homolog 3 OS=Homo sapiens OX=96... [more]
back to top
BLAST of Protein diaphanous homolog 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
U6CNT34.231e-8737.97Protein diaphanous homolog 2 OS=Neovison vison OX=... [more]
A0A564YK291.551e-8337.38Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A0R3S9X82.805e-8337.38Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A1S8WZA08.318e-8336.46Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A2U3ZTQ13.713e-8237.50protein diaphanous homolog 2 OS=Odobenus rosmarus ... [more]
back to top
BLAST of Protein diaphanous homolog 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
diaph21.751e-6834.51diaphanous-related formin 2 [Source:ZFIN;Acc:ZDB-G... [more]
ENSAMXT00000048841.15.881e-5932.53pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
daam1b4.459e-4230.22disheveled-associated activator of morphogenesis 1... [more]
daam1b2.237e-4029.35disheveled-associated activator of morphogenesis 1... [more]
daam1a7.342e-3731.20dishevelled associated activator of morphogenesis ... [more]
back to top
BLAST of Protein diaphanous homolog 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000125.13.057e-7135.08pep scaffold:Pmarinus_7.0:GL476709:11284:97599:-1 ... [more]
ENSPMAT00000001778.11.584e-5339.39pep scaffold:Pmarinus_7.0:GL479130:173791:184898:-... [more]
daam1a4.922e-3629.64dishevelled associated activator of morphogenesis ... [more]
ENSPMAT00000010867.19.687e-2526.87pep scaffold:Pmarinus_7.0:GL477036:280430:297830:1... [more]
ENSPMAT00000005288.11.657e-2325.00pep scaffold:Pmarinus_7.0:GL501244:1260:30258:-1 g... [more]
back to top
BLAST of Protein diaphanous homolog 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
BNI11.849e-1125.08Formin; polarisome component; nucleates the format... [more]
back to top
BLAST of Protein diaphanous homolog 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO353352.179e-6732.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328681.701e-3024.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO367097.145e-2326.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483721.073e-2127.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482582.175e-1625.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein diaphanous homolog 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
diaph21.090e-7134.37diaphanous related formin 2 [Source:NCBI gene;Acc:... [more]
diaph21.785e-7134.37diaphanous related formin 2 [Source:NCBI gene;Acc:... [more]
diaph22.272e-7134.37diaphanous related formin 2 [Source:NCBI gene;Acc:... [more]
diaph22.546e-7134.37diaphanous related formin 2 [Source:NCBI gene;Acc:... [more]
diaph22.653e-7134.37diaphanous related formin 2 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Protein diaphanous homolog 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000057806.10.000e+0100.00SMESG000057806.1[more]
SMESG000036976.17.366e-7135.76SMESG000036976.1[more]
SMESG000025056.12.876e-5467.90SMESG000025056.1[more]
SMESG000054598.13.179e-2827.73SMESG000054598.1[more]
SMESG000044336.11.072e-1428.99SMESG000044336.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016516 ID=SMED30016516|Name=Protein diaphanous homolog 2|organism=Schmidtea mediterranea sexual|type=transcript|length=3454bp
ATTTACTCTAAAAGTTATTTTTCCTTTATTAATATTTAATTGAATTAATA
ACAATAAATATTCATCACATTGTAATTTATAATGGATCGAAGAGACGGTT
TGAAGAAATCTTCTTTTTTTAAAACTAAAACTAAACCTGAGAAAAAAGAA
AAACGTGAAAAGGAAACATTGAAACCAAATCTAAGTGACACGAGTCTTTC
TGAGAATGAAATTAATGACAAATTTGAAAAATTGCTTGATGATATGAACA
TTCCTATTGACAAACGAAGTGTTATCCGCGAAAAAACACAGGAACAAAAA
TTAGTAATGTTAAAATCTTGTATAACATCACAAATTAAACCTGTTACTTA
TTATGTGGAATTATTAAAACAAATTATATCAGAAAAGCTTTCAGAATCTA
AAATCTGTGAAAATTTAGATCAAATTCGAATTTGTTTGAACAGTAATCCT
GTTTCATGGATTAAGGAATTCGATAATAAAACTAATGATGGATTAAACTT
GCTTCTGGCTGTCCTTAGTACACTGACTGAAACTGCTGACAGTTCAATTG
TTTGTTTAAAATGCTTTCGTGCTTTTGCTAATTGTGGATATGGTTTATTG
AAATTAATGGCAAGTGACAATGCCTATCTATTTATTGCTCGATGTTTGCG
CCCTCAGAATATTCATTTGATGTATGTCGCAGTTGAAATTCTAACAATTC
TCACATTTTTCGATTATAAATCGTATCAAAACGTCATGGATGCCTTATTT
AGAGCGGCTAAATTAAATAACTATGAAAATCGCTTTGTTCCATTAATCGA
AAGTGCCAAAAAAAATGCACAAATGGAAAATGAAAACGAATCACTGAGTT
TGGCCACTATCAGATTTATTAACGTTATTATTTCGCCACCATTTCTGAAT
CCAAACGATTCAGCTCAATTCGATGAGTATTATCGACTTCATTTGCGACG
GGAATTCGTTAACAATGGATTGATGCAAGTGTTCGATGAATTGTTATGCA
ATCCAAATTTGAAATTGACCCATGAACAAATTAATCAATTTTTGTCGGAA
TATGAAAACGAAGATGAAGAAGTCAACGAAAAATCTGAAACGATTATTCG
AGCCTTTGGTGATGCGAGTGACATTTTCCGCATCATCAATCGATCGGTGT
CCAACACGAAATGCGAAGTTAATTTCCGATCGATTCTCGCCAATTTACTC
ATTATTCGAGAAGATCCAATCAGAGATGATTTGTTTCGATTCATAGACGA
AATCGTCCAGGAAATCATATTGCAAGACGATTCCGGATTCTGTCCGGATC
CGACTTTGAAGAAATTCGACAAAATCAATCTCAAAAAATTTTACGATGGA
AGCCATGTTGAGGAATTGAAACGGGAATTGGATTCCGAACGATTGAAAAA
AGATGAATTGAAAATAAAGCTGGAGCTGTACAAGACGAAAGAGAAACTCG
ATGACAGTCAAACAAGTGATGCATTCAAAAAAGCCAAAGACCGTATCGAA
AATGCTGAAATGCAGAAAAATATCGAAAAAGAAACGCCTCGTCCAAAGGA
TAGCAATGCAAATTCACCAGTCGCTCCACCACCCCCGGGGCCACCTCCTC
CTCCAGTTGGAGGATTAGTTGCACCACCACCACCGGGGCCACCTCCTCCT
CCCGTTGGGGGATTAGTTGCTCCACCGCCTCCGGGACCCCCACCTCCTCC
AGTTGGAGGATTAATTGCCCCACCGCCGCCAGGCCCACCACCTCCACCTG
GTGGTGGATCTGCACCTCCACCACCACCTGGTCCACCTCCAGGCGGGGTA
GGCGTCCCACCGCCTCCTCCATTACCACCTGGAGTTGGATGCCCTCCACC
GCCTCCTCCTCCCGGCGGAGCTAGAGCTGCCACGTCAGCAGCTATACCGA
AGCCTCCAAGCACTCTAGAAAAATACGGATTAAAACGGAACGTATATCAA
CCGGAACAACCAATGAAAAAGGCAAATTGGAATAAAATTAATGAAAAAAT
TTTAAGTGAAAATTCCGTTTGGTTGTCTATAAAAGAAGAAACTATCCCAA
CAGACATATTAAAAGAATTGGAGAACAATTTTTCCACTAAAGTAGTCGTT
GTAAAAGAGAAAACAGTTAAAACTACAGTTGTAAAAGAACCGAAAATTCT
TGACGGAAAAACAGCACAAAATATATCGATTTTATTGGGGTCTCTGCGAA
TGGAATATGAGAAATTGAAGCAGGCCATTCTGGAAATCGACACATCCATC
CTGACACAGTCCATGATCGAGCAGCTATTGAAAAATCTCCCAGAAACCGA
ACAGATGCAAAAGATAGCTGAATTGGGAGATGTTTACAAAGACCTAATCG
AGTGTGAACAGTTCTGTTATCAATTATCAAATATCAAAAAGTTGAAGCCT
CGACTGGAATCAATTCTTTTCCAGCTGAAATTCGATGACAAAATAAATGA
AGTCAAAGTCCAATATCATGAAGCGGAAGCCGCACTGAGCGAGATTTTAA
AAAGTGAAAAAGTGAAAAAAATTCTCGAAATCGTTCTTTCTCTTGGCAAC
TACATGAACAGCGGCTCCCGCAACCAGCAGTCGATCGGGTTCGAATTGAA
TTTCCTCTGCAAGCTATCATCGACCAAAGATAAAACCAACAATCGATCGT
TGATTCATTTTCTTGCGGAAATTATCAACCGGAGCGCCTTTAATCCTGCA
GAATTGGGGAAAGATTTGAGCTATATAGACAAGGCCAATCGATTGGCTCT
TGATGCTACTGCCAGCACGCTAACAGAAATCAAAACCGGCTTAAAGGCAA
TTGAAAATCAATTGAAATCGTTCAAAGGTTCCGCTGAAAACGATAGATTT
TCTGAGAAAATGACTCCTTTCGTTACGACAGTGAAAGAACAGATCGTTAT
CGCGGAAACATTTCAAACGAAAATGAATGAGGCTTTTCAGTCGGTGTCGA
CATATTTCACATTCAACTCGTCCACATATAAAATTGAGGAATTATTCAAT
GATATGGCTAAATTCAAAACCGAATTCATTGAAGCGCACAAATTCAACGA
GGAGAAGAAACTGTTGGAAGAGCGAGCATTGAAAGCGAAATTGGACAAGG
AACGTCGAGAAAAAGAAAAGCAAATGCCGGTGATGTCGAAAACAACATCC
GAAGAAGACAGCGGAGTTATTGATAATCTTCTAGCAGTTTTGAAAAGTGG
AGATGGCGCGTTATCTCCTAAACGACGAAAACCGAAAAGCAAAGACGCTC
GTCGCCAGTTGAATCGATCGCGGTCTCGGGGAGAGTTCAACGAGAATATG
TCCAATAATTTGATAGAAATCGCTTCATAGAACTCATTATATTCTATAAT
CCGCAATTGCCATATCAGACATTCCAAATCTATATTTATTAGTGCTTCCA
TTGTAAAAATTGATTGCTTTTTTATATCAAATAAATGTTTTTTTTGTTTT
CAAA
back to top

protein sequence of SMED30016516-orf-1

>SMED30016516-orf-1 ID=SMED30016516-orf-1|Name=SMED30016516-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1083bp
MDRRDGLKKSSFFKTKTKPEKKEKREKETLKPNLSDTSLSENEINDKFEK
LLDDMNIPIDKRSVIREKTQEQKLVMLKSCITSQIKPVTYYVELLKQIIS
EKLSESKICENLDQIRICLNSNPVSWIKEFDNKTNDGLNLLLAVLSTLTE
TADSSIVCLKCFRAFANCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVA
VEILTILTFFDYKSYQNVMDALFRAAKLNNYENRFVPLIESAKKNAQMEN
ENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQV
FDELLCNPNLKLTHEQINQFLSEYENEDEEVNEKSETIIRAFGDASDIFR
IINRSVSNTKCEVNFRSILANLLIIREDPIRDDLFRFIDEIVQEIILQDD
SGFCPDPTLKKFDKINLKKFYDGSHVEELKRELDSERLKKDELKIKLELY
KTKEKLDDSQTSDAFKKAKDRIENAEMQKNIEKETPRPKDSNANSPVAPP
PPGPPPPPVGGLVAPPPPGPPPPPVGGLVAPPPPGPPPPPVGGLIAPPPP
GPPPPPGGGSAPPPPPGPPPGGVGVPPPPPLPPGVGCPPPPPPPGGARAA
TSAAIPKPPSTLEKYGLKRNVYQPEQPMKKANWNKINEKILSENSVWLSI
KEETIPTDILKELENNFSTKVVVVKEKTVKTTVVKEPKILDGKTAQNISI
LLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGD
VYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEA
ALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKD
KTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEI
KTGLKAIENQLKSFKGSAENDRFSEKMTPFVTTVKEQIVIAETFQTKMNE
AFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFNEEKKLLEERAL
KAKLDKERREKEKQMPVMSKTTSEEDSGVIDNLLAVLKSGDGALSPKRRK
PKSKDARRQLNRSRSRGEFNENMSNNLIEIAS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR011989ARM-like
IPR042201FH2_Formin_sf
IPR015425FH2_Formin
IPR010473GTPase-bd
IPR010472FH3_dom
IPR014768GBD/FH3_dom
IPR014767DAD_dom
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0017048Rho GTPase binding
GO:0003779actin binding
GO:0005488binding
GO:0005102signaling receptor binding
Vocabulary: biological process
TermDefinition
GO:0030036actin cytoskeleton organization
GO:0016043cellular component organization
GO:0000910cytokinesis
GO:0007015actin filament organization
GO:0007275multicellular organism development
GO:0007292female gamete generation
GO:0030154cell differentiation
GO:0048477oogenesis
Vocabulary: cellular component
TermDefinition
GO:0005730nucleolus
GO:0005737cytoplasm
GO:0005768endosome
GO:0005769early endosome
GO:0005783endoplasmic reticulum
GO:0005829cytosol
GO:0043231intracellular membrane-bounded organelle
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 426..453
NoneNo IPR availableCOILSCoilCoilcoord: 317..337
NoneNo IPR availableCOILSCoilCoilcoord: 465..485
NoneNo IPR availableCOILSCoilCoilcoord: 987..1016
NoneNo IPR availableGENE3DG3DSA:1.10.20.40coord: 32..83
e-value: 4.3E-6
score: 28.2
NoneNo IPR availableGENE3DG3DSA:1.10.12.80coord: 603..669
e-value: 1.9E-12
score: 49.0
NoneNo IPR availableGENE3DG3DSA:1.10.238.150coord: 334..422
e-value: 4.8E-13
score: 50.7
NoneNo IPR availableGENE3DG3DSA:1.20.58.630coord: 670..771
e-value: 8.9E-30
score: 104.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..37
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..32
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 455..489
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1007..1028
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1068..1084
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 493..564
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1007..1021
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1042..1084
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 455..564
NoneNo IPR availablePANTHERPTHR45691FAMILY NOT NAMEDcoord: 536..1067
coord: 20..558
NoneNo IPR availableSUPERFAMILYSSF101447Formin homology 2 domain (FH2 domain)coord: 633..1002
IPR010472Formin, FH3 domainSMARTSM01139Drf_FH3_2coord: 213..422
e-value: 9.5E-19
score: 78.3
IPR010472Formin, FH3 domainPFAMPF06367Drf_FH3coord: 216..401
e-value: 3.0E-21
score: 75.9
IPR015425Formin, FH2 domainSMARTSM00498it6_sourcecoord: 620..1057
e-value: 2.3E-84
score: 296.3
IPR015425Formin, FH2 domainPFAMPF02181FH2coord: 621..984
e-value: 9.3E-87
score: 291.6
IPR015425Formin, FH2 domainPROSITEPS51444FH2coord: 620..1010
score: 59.219
IPR010473Formin, GTPase-binding domainSMARTSM01140Drf_GBD_2coord: 36..209
e-value: 1.4E-25
score: 101.0
IPR010473Formin, GTPase-binding domainPFAMPF06371Drf_GBDcoord: 39..208
e-value: 3.7E-22
score: 78.8
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 87..333
e-value: 5.0E-37
score: 129.4
IPR042201Formin, FH2 domain superfamilyGENE3DG3DSA:1.20.58.2220coord: 772..1061
e-value: 1.1E-68
score: 233.6
IPR014767Diaphanous autoregulatory (DAD) domainPROSITEPS51231DADcoord: 1025..1052
score: 7.679
IPR014768Rho GTPase-binding/formin homology 3 (GBD/FH3) domainPROSITEPS51232GBD_FH3coord: 36..403
score: 19.926
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 44..400