B-cell receptor-associated protein 31

Overview
NameB-cell receptor-associated protein 31
Smed IDSMED30016492
Length (bp)968
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of B-cell receptor-associated protein 31 (SMED30016492) t-SNE clustered cells

Violin plots show distribution of expression levels for B-cell receptor-associated protein 31 (SMED30016492) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of B-cell receptor-associated protein 31 (SMED30016492) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for B-cell receptor-associated protein 31 (SMED30016492) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016492

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30016492h1SMcG0009876 Contig1500GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30016492h1SMcG0009876 Contig1500GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30016492h1SMcG0009876 Contig1500GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30016492h1SMcG0009876 dd_Smed_v4_1559_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30016492h1SMcG0009876 OX_Smed_1.0.20788ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
testisSMED30016492h1SMcG0009876 SMED30016492smed_20140614PMID:279364
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of B-cell receptor-associated protein 31 vs. Ensembl Human
Match: BCAP31 (B cell receptor associated protein 31 [Source:HGNC Symbol;Acc:HGNC:16695])

HSP 1 Score: 131.339 bits (329), Expect = 3.028e-36
Identity = 91/217 (41.94%), Postives = 127/217 (58.53%), Query Frame = 2
Query:  104 MSLQWVAVAGFLYLEIFIAMLLTLPFISASRWSKVFKSRIVTKFSNYSTFYFNILLIILAVLFLDAIREIVKYNKMEHKLTSGHMHDTESIILMRLFRGQRNLYVSGFSLFLWFVLRRMVVLITTMAHQEAISSAAIKQAHGASEAAKEMMKKNDVTDXXXXXXXXXXXXXXVATRQLGVSEKEIERLELDLETLKKQYVNHNKAYDELLAEHDDLQ 754
            MSLQW AVA FLY E+F+ +LL +PFIS  RW K+FKSR+V    +Y   +F +L++IL +L +DA+REI KY+ +  K+   +         M+LFR QRNLY++GFSL L F+LRR+V LI+  A   A + A  KQA  ASEAAK+ M++ND                    ++    + E+E+ E  +  ++KQ     K YD LL EH  LQ
Sbjct:    1 MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEEND------------------QLKKGAAVDGELEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQ 199          
BLAST of B-cell receptor-associated protein 31 vs. Ensembl Human
Match: BCAP31 (B cell receptor associated protein 31 [Source:HGNC Symbol;Acc:HGNC:16695])

HSP 1 Score: 127.872 bits (320), Expect = 1.413e-34
Identity = 96/234 (41.03%), Postives = 135/234 (57.69%), Query Frame = 2
Query:  104 MSLQWVAVAGFLYLEIFIAMLLTLPFISASRWSKVFKSRIVTKFSNYSTFYFNILLIILAVLFLDAIREIVKYNKMEHKLTSGHMHDTESIILMRLFRGQRNLYVSGFSLFLWFVLRRMVVLITTMAHQEAISSAAIKQAHGASEAAKEMMKKND------VTDXXXXXXXXXXXXXXVATR-----------QLGVSEKEIERLELDLETLKKQYVNHNKAYDELLAEHDDLQ 754
            MSLQW AVA FLY E+F+ +LL +PFIS  RW K+FKSR+V    +Y   +F +L++IL +L +DA+REI KY+ +  K+   +         M+LFR QRNLY++GFSL L F+LRR+V LI+  A   A + A  KQA  ASEAAK+ M++ND        D         + KLE   R           +L  +++++E+ E  +  ++KQ     K YD LL EH  LQ
Sbjct:    1 MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQ 234          
BLAST of B-cell receptor-associated protein 31 vs. Ensembl Human
Match: BCAP31 (B cell receptor associated protein 31 [Source:HGNC Symbol;Acc:HGNC:16695])

HSP 1 Score: 127.872 bits (320), Expect = 1.413e-34
Identity = 96/234 (41.03%), Postives = 135/234 (57.69%), Query Frame = 2
Query:  104 MSLQWVAVAGFLYLEIFIAMLLTLPFISASRWSKVFKSRIVTKFSNYSTFYFNILLIILAVLFLDAIREIVKYNKMEHKLTSGHMHDTESIILMRLFRGQRNLYVSGFSLFLWFVLRRMVVLITTMAHQEAISSAAIKQAHGASEAAKEMMKKND------VTDXXXXXXXXXXXXXXVATR-----------QLGVSEKEIERLELDLETLKKQYVNHNKAYDELLAEHDDLQ 754
            MSLQW AVA FLY E+F+ +LL +PFIS  RW K+FKSR+V    +Y   +F +L++IL +L +DA+REI KY+ +  K+   +         M+LFR QRNLY++GFSL L F+LRR+V LI+  A   A + A  KQA  ASEAAK+ M++ND        D         + KLE   R           +L  +++++E+ E  +  ++KQ     K YD LL EH  LQ
Sbjct:    1 MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQ 234          
BLAST of B-cell receptor-associated protein 31 vs. Ensembl Human
Match: BCAP31 (B cell receptor associated protein 31 [Source:HGNC Symbol;Acc:HGNC:16695])

HSP 1 Score: 127.872 bits (320), Expect = 1.413e-34
Identity = 96/234 (41.03%), Postives = 135/234 (57.69%), Query Frame = 2
Query:  104 MSLQWVAVAGFLYLEIFIAMLLTLPFISASRWSKVFKSRIVTKFSNYSTFYFNILLIILAVLFLDAIREIVKYNKMEHKLTSGHMHDTESIILMRLFRGQRNLYVSGFSLFLWFVLRRMVVLITTMAHQEAISSAAIKQAHGASEAAKEMMKKND------VTDXXXXXXXXXXXXXXVATR-----------QLGVSEKEIERLELDLETLKKQYVNHNKAYDELLAEHDDLQ 754
            MSLQW AVA FLY E+F+ +LL +PFIS  RW K+FKSR+V    +Y   +F +L++IL +L +DA+REI KY+ +  K+   +         M+LFR QRNLY++GFSL L F+LRR+V LI+  A   A + A  KQA  ASEAAK+ M++ND        D         + KLE   R           +L  +++++E+ E  +  ++KQ     K YD LL EH  LQ
Sbjct:    1 MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQ 234          
BLAST of B-cell receptor-associated protein 31 vs. Ensembl Human
Match: BCAP29 (B cell receptor associated protein 29 [Source:NCBI gene;Acc:55973])

HSP 1 Score: 127.487 bits (319), Expect = 1.710e-34
Identity = 90/234 (38.46%), Postives = 133/234 (56.84%), Query Frame = 2
Query:  104 MSLQWVAVAGFLYLEIFIAMLLTLPFISASRWSKVFKSRIVTKFSNYSTFYFNILLIILAVLFLDAIREIVKYNKMEHKL--TSGHMHDTESIILMRLFRGQRNLYVSGFSLFLWFVLRRMVVLITTMAHQEAISSAAIKQAHGASEAAKEMMKKNDVTDXXXXXXXXXXXXXXVATRQLGVSEKEIERLEL------------DLETLKKQYVNHNKAYDELLAEHDDLQNKL 763
            M+LQW AVA FLY EI + ++  LPFI   RW K+F   +  K + +    F  ++I+L VLFLDA+RE+ KY+ + H +  +S    D      M+LFR QRNLY+SGFSLF W VLRR+V LIT +A + +       QA   ++AAK+ M++N+      KS  + +E +  A  +  V ++E  + EL            D+  +K Q    +K YD+LL EH +LQ++L
Sbjct:    1 MTLQWAAVATFLYAEIGLILIFCLPFIPPQRWQKIFSFNVWGKIATFWNKAFLTIIILLIVLFLDAVREVRKYSSV-HTIEKSSTSRPDAYEHTQMKLFRSQRNLYISGFSLFFWLVLRRLVTLITQLAKELSNKGVLKTQAENTNKAAKKFMEENEKLKRILKSHGKDEECVLEAENKKLVEDQEKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKEHSELQDRL 233          
BLAST of B-cell receptor-associated protein 31 vs. Ensembl Celegans
Match: Y54G2A.18 (4D656 [Source:UniProtKB/TrEMBL;Acc:G5EBI0])

HSP 1 Score: 144.436 bits (363), Expect = 8.782e-42
Identity = 84/232 (36.21%), Postives = 127/232 (54.74%), Query Frame = 2
Query:  104 MSLQWVAVAGFLYLEIFIAMLLTLPFISASRWSKVFKSRIVTKFSNYSTFYFNILLIILAVLFLDAIREIVKYNKMEHKLTSGHMHDTESIILMRLFRGQRNLYVSGFSLFLWFVLRRMVVLITTMAHQEAISSAAIKQAHGASEAAKEMMKKNDVTDXXXXXXXXXXXXXXVATRQLGVSEKEIERLELDLETLKKQYVNHNKAYDELLAEHDDLQNKLAELQQSTDSKKD 799
            M+LQW  VAG LY EI I   L LP+I  + WSK+FKSR+ T  + ++  Y      +L +LF D +RE +KYN +E ++  G   ++++   MRLFR QRNLY+SGF+L LW V++R++ L+   A  EA S AA++QA  A++ A+ +M   D  +  +              +Q+   + E++    D +TLKKQ     + +D +     DL    AE     D KKD
Sbjct:    1 MTLQWTIVAGVLYAEIAITFTLLLPWIRPTLWSKLFKSRLFTALAKHAHIYSITFGFVLFILFADGVRETMKYNGLEGQM--GRTAESDATHHMRLFRAQRNLYISGFALLLWLVIQRIMTLLGRAAQLEAASEAAMRQAESATKTARTLMNSADTNEEAAGL-----------AKQIEKLKGELKSANTDRDTLKKQSEGLQREFDRV----SDLLRDSAE--SKGDKKKD 213          
BLAST of B-cell receptor-associated protein 31 vs. Ensembl Fly
Match: CG13887 (gene:FBgn0035165 transcript:FBtr0072583)

HSP 1 Score: 122.479 bits (306), Expect = 5.079e-33
Identity = 80/221 (36.20%), Postives = 128/221 (57.92%), Query Frame = 2
Query:  104 MSLQWVAVAGFLYLEIFIAMLLTLPFISASRWSKVFKSRIVTKFSNYSTFYFNILLIILAVLFLDAIREIVKYNKMEHKLTSGHMH-DTESIILMRLFRGQRNLYVSGFSLFLWFVLRRMVVLITTMAHQEAISSAAIKQAHGASEAAKEMMKKNDVTDXXXXXXXXXXXXXXVATRQLGVSEKEIERLELDLETLKKQYVNHNKAYDELLAEHDDLQNKL 763
            MSL W  +AGFLY EI + +LL LP ++  RW++ FKS+ ++     +  YF +++ IL +  L+AIRE+ KY+ ++    S  +H + E    M+LFR QRN Y+SGF++FL  V+RR+V LI T A+  A S A+ KQA  A+ AA+ +++  +   +K   E     +L     ++     ++ R + D E +K Q  + N+ YD L  E+  LQ K+
Sbjct:    1 MSLVWTLIAGFLYAEIALVLLLVLPVLTPYRWNRFFKSKFLSMLGQQAHIYFLLIMGILVIFLLEAIREMRKYSGLQQ---SNEVHLNVEMQHSMKLFRAQRNFYISGFAIFLALVIRRLVNLICTQANLMAQSEASFKQAQSATAAARSLLENKNTEKAKEAGEDTTLIELNKLRERVQELTSDLNREKKDKEAVKSQAESINREYDRLTEEYSKLQKKI 218          
BLAST of B-cell receptor-associated protein 31 vs. Ensembl Fly
Match: CG13887 (gene:FBgn0035165 transcript:FBtr0345588)

HSP 1 Score: 122.479 bits (306), Expect = 5.079e-33
Identity = 80/221 (36.20%), Postives = 128/221 (57.92%), Query Frame = 2
Query:  104 MSLQWVAVAGFLYLEIFIAMLLTLPFISASRWSKVFKSRIVTKFSNYSTFYFNILLIILAVLFLDAIREIVKYNKMEHKLTSGHMH-DTESIILMRLFRGQRNLYVSGFSLFLWFVLRRMVVLITTMAHQEAISSAAIKQAHGASEAAKEMMKKNDVTDXXXXXXXXXXXXXXVATRQLGVSEKEIERLELDLETLKKQYVNHNKAYDELLAEHDDLQNKL 763
            MSL W  +AGFLY EI + +LL LP ++  RW++ FKS+ ++     +  YF +++ IL +  L+AIRE+ KY+ ++    S  +H + E    M+LFR QRN Y+SGF++FL  V+RR+V LI T A+  A S A+ KQA  A+ AA+ +++  +   +K   E     +L     ++     ++ R + D E +K Q  + N+ YD L  E+  LQ K+
Sbjct:    1 MSLVWTLIAGFLYAEIALVLLLVLPVLTPYRWNRFFKSKFLSMLGQQAHIYFLLIMGILVIFLLEAIREMRKYSGLQQ---SNEVHLNVEMQHSMKLFRAQRNFYISGFAIFLALVIRRLVNLICTQANLMAQSEASFKQAQSATAAARSLLENKNTEKAKEAGEDTTLIELNKLRERVQELTSDLNREKKDKEAVKSQAESINREYDRLTEEYSKLQKKI 218          
BLAST of B-cell receptor-associated protein 31 vs. Ensembl Fly
Match: CG13887 (gene:FBgn0035165 transcript:FBtr0072584)

HSP 1 Score: 122.479 bits (306), Expect = 5.079e-33
Identity = 80/221 (36.20%), Postives = 128/221 (57.92%), Query Frame = 2
Query:  104 MSLQWVAVAGFLYLEIFIAMLLTLPFISASRWSKVFKSRIVTKFSNYSTFYFNILLIILAVLFLDAIREIVKYNKMEHKLTSGHMH-DTESIILMRLFRGQRNLYVSGFSLFLWFVLRRMVVLITTMAHQEAISSAAIKQAHGASEAAKEMMKKNDVTDXXXXXXXXXXXXXXVATRQLGVSEKEIERLELDLETLKKQYVNHNKAYDELLAEHDDLQNKL 763
            MSL W  +AGFLY EI + +LL LP ++  RW++ FKS+ ++     +  YF +++ IL +  L+AIRE+ KY+ ++    S  +H + E    M+LFR QRN Y+SGF++FL  V+RR+V LI T A+  A S A+ KQA  A+ AA+ +++  +   +K   E     +L     ++     ++ R + D E +K Q  + N+ YD L  E+  LQ K+
Sbjct:    1 MSLVWTLIAGFLYAEIALVLLLVLPVLTPYRWNRFFKSKFLSMLGQQAHIYFLLIMGILVIFLLEAIREMRKYSGLQQ---SNEVHLNVEMQHSMKLFRAQRNFYISGFAIFLALVIRRLVNLICTQANLMAQSEASFKQAQSATAAARSLLENKNTEKAKEAGEDTTLIELNKLRERVQELTSDLNREKKDKEAVKSQAESINREYDRLTEEYSKLQKKI 218          
BLAST of B-cell receptor-associated protein 31 vs. Ensembl Fly
Match: CG13887 (gene:FBgn0035165 transcript:FBtr0304797)

HSP 1 Score: 110.538 bits (275), Expect = 4.399e-29
Identity = 64/157 (40.76%), Postives = 100/157 (63.69%), Query Frame = 2
Query:  104 MSLQWVAVAGFLYLEIFIAMLLTLPFISASRWSKVFKSRIVTKFSNYSTFYFNILLIILAVLFLDAIREIVKYNKMEHKLTSGHMH-DTESIILMRLFRGQRNLYVSGFSLFLWFVLRRMVVLITTMAHQEAISSAAIKQAHGASEAAKEMMKKNDV 571
            MSL W  +AGFLY EI + +LL LP ++  RW++ FKS+ ++     +  YF +++ IL +  L+AIRE+ KY+ ++    S  +H + E    M+LFR QRN Y+SGF++FL  V+RR+V LI T A+  A S A+ KQA  A+ AA+ +++  + 
Sbjct:    1 MSLVWTLIAGFLYAEIALVLLLVLPVLTPYRWNRFFKSKFLSMLGQQAHIYFLLIMGILVIFLLEAIREMRKYSGLQQ---SNEVHLNVEMQHSMKLFRAQRNFYISGFAIFLALVIRRLVNLICTQANLMAQSEASFKQAQSATAAARSLLENKNT 154          
BLAST of B-cell receptor-associated protein 31 vs. Ensembl Zebrafish
Match: bcap29 (B cell receptor associated protein 29 [Source:ZFIN;Acc:ZDB-GENE-050522-468])

HSP 1 Score: 151.754 bits (382), Expect = 4.639e-44
Identity = 96/252 (38.10%), Postives = 133/252 (52.78%), Query Frame = 2
Query:  104 MSLQWVAVAGFLYLEIFIAMLLTLPFISASRWSKVFKSRIVTKFSNYSTFYFNILLIILAVLFLDAIREIVKYNKME-------HKLTSGHMHDTESIILMRLFRGQRNLYVSGFSLFLWFVLRRMVVLITTMAHQEAISSAAIKQAHGASEAAKEMMKKNDVTDXXXXXXXXXXXXXXVA------------TRQLGVSEKEIERLELDLETLKKQYVNHNKAYDELLAEHDDLQNKLAELQQSTDSKKDN 802
            M+LQW AVA FLY+EI + +   LPFISA RW K+FK  I ++ S +    F  ++IIL VLFLDA+RE+ KY+  +       H     HMH       M+LFR QRNLY+SGFSLFLW V+RR+V LI+ +A           Q    ++AAK+ M+ N +         E  +K +                +L  S   +++ + DL+T+KKQ     K Y+ LL EH  LQN     Q  +  KK+N
Sbjct:    1 MTLQWTAVATFLYVEIAVLIFFCLPFISAKRWQKIFKWSIWSRLSQFWNKGFLAMIIILIVLFLDALREVRKYSNSDQSKDAKLHPNMFDHMH-------MKLFRAQRNLYISGFSLFLWLVMRRVVTLISQLATAADSCVDLQNQVETTNKAAKKYMEDNQILKQALADAKEGGQKADPEESKRLKEELQRLKEELKTSADALKKSKSDLDTMKKQSDGLTKEYERLLQEHQQLQN-----QMDSGDKKEN 240          
BLAST of B-cell receptor-associated protein 31 vs. Ensembl Zebrafish
Match: bcap31 (B cell receptor associated protein 31 [Source:ZFIN;Acc:ZDB-GENE-030616-63])

HSP 1 Score: 132.494 bits (332), Expect = 1.655e-36
Identity = 100/251 (39.84%), Postives = 139/251 (55.38%), Query Frame = 2
Query:  104 MSLQWVAVAGFLYLEIFIAMLLTLPFISASRWSKVFKSRIVTKFSNYSTFYFNILLIILAVLFLDAIREIVKYNKMEHKLTSGHMHDTESIILMRLFRGQRNLYVSGFSLFLWFVLRRMVVLITTMAHQEAISSAAIKQAHGASEAAKEMMKKN---------------DVTDXXXXXXXXXXXXXXVATRQ----LGVSEKEIERLELDLETLKKQYVNHNKAYDELLAEHDDLQNKLAELQQSTDSKKD 799
            MSLQW AVA FLY E+F  +LL +PFIS  RWSK FKSR+VT  ++Y    F +++ IL  L +DA RE+ KY+  E    S +    E  I M+LFR QRN Y++GF+L L  +LRR+  L++  A   A   A  KQA GA++AAK+ M++N               +V         E K+ L+   RQ    L  ++K +++ + D++ +KKQ  N    YD LL EH  LQ K  + QQ  D K D
Sbjct:    1 MSLQWTAVATFLYAEVFAVLLLCVPFISPKRWSKFFKSRLVTAITSYGNTAFIVIICILVFLLIDAFREVRKYSVAEKVDLSNNPVAIEH-IHMKLFRAQRNEYIAGFALLLCLLLRRLATLLSQQATLMASHEAFQKQAEGANDAAKKYMEENEKLQEKLRQAGIEVPEVGGKAKGGVEEDKKNLKEEVRQLKDELDATKKALQKSDSDVKAMKKQAENLTTEYDRLLEEHARLQAK-CDAQQ--DKKSD 247          
BLAST of B-cell receptor-associated protein 31 vs. Ensembl Xenopus
Match: noc3l (NOC3-like DNA replication regulator [Source:Xenbase;Acc:XB-GENE-5957761])

HSP 1 Score: 140.198 bits (352), Expect = 2.038e-39
Identity = 88/249 (35.34%), Postives = 133/249 (53.41%), Query Frame = 2
Query:  104 MSLQWVAVAGFLYLEIFIAMLLTLPFISASRWSKVFKSRIVTKFSNYSTFYFNILLIILAVLFLDAIREIVKYNKMEHKLTSGHMHDTESI--------ILMRLFRGQRNLYVSGFSLFLWFVLRRMVVLITTMAHQEAISSAAIKQAHGASEAAKEMMKKNDVTDXXXXXXXXXXXXXXVATRQLGVS------EKEIERL-------ELDLETLKKQYVNHNKAYDELLAEHDDLQNKLAELQQSTD 787
            M+ QW AVA FLY E+ + ++L +PFIS  RW K+F+ ++ +K S Y    F  ++++L VLFLDA RE+ KY       ++ H+ D  +         I M+LFR QRNLY+SGFSLFLW VLRR+V LI  +A +   + A   Q   A+EAAK+ M+ N+       S    + K  +      +       ++E++R+       + D   +KKQ     + +D LL EH+ LQN    +Q   +
Sbjct:    1 MTFQWTAVASFLYGEVAVLLILCIPFISPLRWKKIFRFQLWSKVSPYWNKAFLSIIVVLIVLFLDAAREVKKY-------SANHLTDKNAKLYPSSYDHIHMKLFRSQRNLYISGFSLFLWLVLRRVVSLIMQLASEIESNGAMQTQVENANEAAKKYMEDNEHLKKTINSAKMDEGKWALKAENEKLKTEVESLKEELKRMTEALSKSQKDSSAIKKQCDGLTREFDHLLKEHEKLQNATEGIQNKKE 242          
BLAST of B-cell receptor-associated protein 31 vs. Ensembl Xenopus
Match: bcap31 (B cell receptor associated protein 31 [Source:NCBI gene;Acc:394579])

HSP 1 Score: 130.568 bits (327), Expect = 1.261e-35
Identity = 104/254 (40.94%), Postives = 144/254 (56.69%), Query Frame = 2
Query:  104 MSLQWVAVAGFLYLEIFIAMLLTLPFISASRWSKVFKSRIVTKFSNYSTFYFNILLIILAVLFLDAIREIVKYNKME------HKLTSGHMHDTESIILMRLFRGQRNLYVSGFSLFLWFVLRRMVVLITTMAHQEAISSAAIKQAHGASEAAKEMMKKND------------VTDXXXXXXXXXXXXXXVATR----QLGVSEKEIERLELDLETLKKQYVNHNKAYDELLAEHDDLQNKLAELQQSTDSKKD 799
            MSLQW AVA FLY+E+F+ +LL +PFIS +RW K+FKSR+V     Y   +F +L+ IL +L LDA REI KY   E      + +   H+H       M+LFR QRNLY++GFSL L F+LRR+V+LI+  A   A + A  KQA  AS+AAK+ M++ND            V+D    +  E  +KL+   R    +LG + K + + E ++  +KKQ     K YD LL EH       + LQ  +D  KD
Sbjct:    1 MSLQWTAVATFLYVEVFLVLLLCIPFISPTRWQKIFKSRLVQLLVTYGNTFFLVLIAILVLLLLDAFREIQKYGVGEQVDLKNNPVAVEHIH-------MKLFRAQRNLYIAGFSLLLSFLLRRLVMLISKQATLLASNEAFRKQAESASDAAKKYMEENDKLKKELKSLGVEVSDLPDNNAEEDNKKLKEEVRKLKEELGSARKTLHKSESEVVAIKKQCEGLTKEYDRLLEEH-------SRLQAQSDGPKD 240          
BLAST of B-cell receptor-associated protein 31 vs. Ensembl Xenopus
Match: bcap31 (B cell receptor associated protein 31 [Source:NCBI gene;Acc:394579])

HSP 1 Score: 128.642 bits (322), Expect = 5.513e-35
Identity = 101/239 (42.26%), Postives = 139/239 (58.16%), Query Frame = 2
Query:  104 MSLQWVAVAGFLYLEIFIAMLLTLPFISASRWSKVFKSRIVTKFSNYSTFYFNILLIILAVLFLDAIREIVKYNKME------HKLTSGHMHDTESIILMRLFRGQRNLYVSGFSLFLWFVLRRMVVLITTMAHQEAISSAAIKQAHGASEAAKEMMKKND------------VTDXXXXXXXXXXXXXXVATR----QLGVSEKEIERLELDLETLKKQYVNHNKAYDELLAEHDDLQ 754
            MSLQW AVA FLY+E+F+ +LL +PFIS +RW K+FKSR+V     Y   +F +L+ IL +L LDA REI KY   E      + +   H+H       M+LFR QRNLY++GFSL L F+LRR+V+LI+  A   A + A  KQA  AS+AAK+ M++ND            V+D    +  E  +KL+   R    +LG + K + + E ++  +KKQ     K YD LL EH  LQ
Sbjct:    1 MSLQWTAVATFLYVEVFLVLLLCIPFISPTRWQKIFKSRLVQLLVTYGNTFFLVLIAILVLLLLDAFREIQKYGVGEQVDLKNNPVAVEHIH-------MKLFRAQRNLYIAGFSLLLSFLLRRLVMLISKQATLLASNEAFRKQAESASDAAKKYMEENDKLKKELKSLGVEVSDLPDNNAEEDNKKLKEEVRKLKEELGSARKTLHKSESEVVAIKKQCEGLTKEYDRLLEEHSRLQ 232          
BLAST of B-cell receptor-associated protein 31 vs. Ensembl Mouse
Match: Bcap31 (B cell receptor associated protein 31 [Source:MGI Symbol;Acc:MGI:1350933])

HSP 1 Score: 126.716 bits (317), Expect = 2.602e-34
Identity = 97/233 (41.63%), Postives = 134/233 (57.51%), Query Frame = 2
Query:  104 MSLQWVAVAGFLYLEIFIAMLLTLPFISASRWSKVFKSRIVTKFSNYSTFYFNILLIILAVLFLDAIREIVKYNKMEHKLTSGHMHDTESIILMRLFRGQRNLYVSGFSLFLWFVLRRMVVLITTMAHQEAISSAAIKQAHGASEAAKEMMKKNDV----------------TDXXXXXXXXXXXXXXVATRQLGVSEKEIERLELDLETLKKQYVNHNKAYDELLAEHDDLQ 754
            MSLQW  VA FLY E+F  +LL +PFIS  RW KVFKSR+V     Y   +F +L++IL +L +DA+REI+KY+ +  K+   +         M+LFR QRNLY++GFSL L F+LRR+V LI+  A   A + A  KQA  ASEAAK+ M++ND                 T+ K +    LK  L     +L  ++K++E+ E +   ++KQ     K YD LL EH  LQ
Sbjct:    1 MSLQWTTVATFLYAEVFAVLLLCIPFISPKRWQKVFKSRLVELVVTYGNTFFVVLIVILVLLVIDAVREILKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAEDGDKLDIGNTEMKLEENKSLKNDLRKLKDELASTKKKLEKAENEALAMQKQSEGLTKEYDRLLEEHAKLQ 233          
BLAST of B-cell receptor-associated protein 31 vs. Ensembl Mouse
Match: Bcap29 (B cell receptor associated protein 29 [Source:MGI Symbol;Acc:MGI:101917])

HSP 1 Score: 126.331 bits (316), Expect = 2.775e-34
Identity = 91/240 (37.92%), Postives = 134/240 (55.83%), Query Frame = 2
Query:  104 MSLQWVAVAGFLYLEIFIAMLLTLPFISASRWSKVFKSRIVTKFSNYSTFYFNILLIILAVLFLDAIREIVKYNKMEHKLTSGHMHDTESIIL--------MRLFRGQRNLYVSGFSLFLWFVLRRMVVLITTMAHQEAISSAAIKQAHGASEAAKEMMKKNDVTDXXXXXXXXXXXXXXVATRQLGVSEKEIERLEL------------DLETLKKQYVNHNKAYDELLAEHDDLQNKL 763
            M++QW AVA FLY EI + +L  LPFI   RW K+F   +  K +++    F  ++I+L +LFLDA+RE+ KY       +S ++ +  S I         M+LFR QRNLY+SGFSLF W VLRR+V LIT +A + A       QA   ++AAK+ M++N+      +++   +  LE   ++L +  KE  + EL            D+ T+K Q    +K YD LL EH +LQN+L
Sbjct:    1 MTIQWAAVASFLYAEIGLILLFCLPFIPPQRWQKIFSFSVWGKIASFWNKAFLTIIILLIILFLDAVREVRKY-------SSTNVVEKNSAIRPSAFEHTQMKLFRSQRNLYISGFSLFFWLVLRRLVTLITQLAKEIANKGVLKIQAENTNKAAKKFMEENEKLKLGLRNDNAEEHLLEAENKKL-IESKENLKTELKKASDALLKAQNDVMTMKIQSERLSKEYDRLLKEHSELQNRL 232          
BLAST of B-cell receptor-associated protein 31 vs. Ensembl Mouse
Match: Bcap29 (B cell receptor associated protein 29 [Source:MGI Symbol;Acc:MGI:101917])

HSP 1 Score: 126.331 bits (316), Expect = 2.775e-34
Identity = 91/240 (37.92%), Postives = 134/240 (55.83%), Query Frame = 2
Query:  104 MSLQWVAVAGFLYLEIFIAMLLTLPFISASRWSKVFKSRIVTKFSNYSTFYFNILLIILAVLFLDAIREIVKYNKMEHKLTSGHMHDTESIIL--------MRLFRGQRNLYVSGFSLFLWFVLRRMVVLITTMAHQEAISSAAIKQAHGASEAAKEMMKKNDVTDXXXXXXXXXXXXXXVATRQLGVSEKEIERLEL------------DLETLKKQYVNHNKAYDELLAEHDDLQNKL 763
            M++QW AVA FLY EI + +L  LPFI   RW K+F   +  K +++    F  ++I+L +LFLDA+RE+ KY       +S ++ +  S I         M+LFR QRNLY+SGFSLF W VLRR+V LIT +A + A       QA   ++AAK+ M++N+      +++   +  LE   ++L +  KE  + EL            D+ T+K Q    +K YD LL EH +LQN+L
Sbjct:    1 MTIQWAAVASFLYAEIGLILLFCLPFIPPQRWQKIFSFSVWGKIASFWNKAFLTIIILLIILFLDAVREVRKY-------SSTNVVEKNSAIRPSAFEHTQMKLFRSQRNLYISGFSLFFWLVLRRLVTLITQLAKEIANKGVLKIQAENTNKAAKKFMEENEKLKLGLRNDNAEEHLLEAENKKL-IESKENLKTELKKASDALLKAQNDVMTMKIQSERLSKEYDRLLKEHSELQNRL 232          
BLAST of B-cell receptor-associated protein 31 vs. UniProt/SwissProt
Match: sp|Q5R8H3|BAP31_PONAB (B-cell receptor-associated protein 31 OS=Pongo abelii OX=9601 GN=BCAP31 PE=2 SV=3)

HSP 1 Score: 129.028 bits (323), Expect = 2.713e-34
Identity = 100/249 (40.16%), Postives = 142/249 (57.03%), Query Frame = 2
Query:  104 MSLQWVAVAGFLYLEIFIAMLLTLPFISASRWSKVFKSRIVTKFSNYSTFYFNILLIILAVLFLDAIREIVKYNKMEHKLTSGHMHDTESIILMRLFRGQRNLYVSGFSLFLWFVLRRMVVLITTMAHQEAISSAAIKQAHGASEAAKEMMKKND------VTDXXXXXXXXXXXXXXVATR-----------QLGVSEKEIERLELDLETLKKQYVNHNKAYDELLAEHDDLQNKLAELQQSTDSKKD 799
            MSLQW AVA FLY E+F+ +LL +PFIS  RW K+FKSR+V    +Y   +F +L++IL +L +DA+REI KY+ +  K+   +         M+LFR QRNLY++GFSL L F+LRR+V LI+  A   A + A  KQA  ASEAAK+ M++ND        D         + KLE   R           +L  +++++E+ E  +  ++KQ     K YD LL EH  LQ   A +   TD K++
Sbjct:    1 MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELVVSYGNTFFVVLIVILVLLVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQ---AAVDGPTDKKEE 246          
BLAST of B-cell receptor-associated protein 31 vs. UniProt/SwissProt
Match: sp|P51572|BAP31_HUMAN (B-cell receptor-associated protein 31 OS=Homo sapiens OX=9606 GN=BCAP31 PE=1 SV=3)

HSP 1 Score: 127.872 bits (320), Expect = 6.788e-34
Identity = 96/234 (41.03%), Postives = 135/234 (57.69%), Query Frame = 2
Query:  104 MSLQWVAVAGFLYLEIFIAMLLTLPFISASRWSKVFKSRIVTKFSNYSTFYFNILLIILAVLFLDAIREIVKYNKMEHKLTSGHMHDTESIILMRLFRGQRNLYVSGFSLFLWFVLRRMVVLITTMAHQEAISSAAIKQAHGASEAAKEMMKKND------VTDXXXXXXXXXXXXXXVATR-----------QLGVSEKEIERLELDLETLKKQYVNHNKAYDELLAEHDDLQ 754
            MSLQW AVA FLY E+F+ +LL +PFIS  RW K+FKSR+V    +Y   +F +L++IL +L +DA+REI KY+ +  K+   +         M+LFR QRNLY++GFSL L F+LRR+V LI+  A   A + A  KQA  ASEAAK+ M++ND        D         + KLE   R           +L  +++++E+ E  +  ++KQ     K YD LL EH  LQ
Sbjct:    1 MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQ 234          
BLAST of B-cell receptor-associated protein 31 vs. UniProt/SwissProt
Match: sp|Q9UHQ4|BAP29_HUMAN (B-cell receptor-associated protein 29 OS=Homo sapiens OX=9606 GN=BCAP29 PE=1 SV=2)

HSP 1 Score: 127.487 bits (319), Expect = 8.213e-34
Identity = 90/234 (38.46%), Postives = 133/234 (56.84%), Query Frame = 2
Query:  104 MSLQWVAVAGFLYLEIFIAMLLTLPFISASRWSKVFKSRIVTKFSNYSTFYFNILLIILAVLFLDAIREIVKYNKMEHKL--TSGHMHDTESIILMRLFRGQRNLYVSGFSLFLWFVLRRMVVLITTMAHQEAISSAAIKQAHGASEAAKEMMKKNDVTDXXXXXXXXXXXXXXVATRQLGVSEKEIERLEL------------DLETLKKQYVNHNKAYDELLAEHDDLQNKL 763
            M+LQW AVA FLY EI + ++  LPFI   RW K+F   +  K + +    F  ++I+L VLFLDA+RE+ KY+ + H +  +S    D      M+LFR QRNLY+SGFSLF W VLRR+V LIT +A + +       QA   ++AAK+ M++N+      KS  + +E +  A  +  V ++E  + EL            D+  +K Q    +K YD+LL EH +LQ++L
Sbjct:    1 MTLQWAAVATFLYAEIGLILIFCLPFIPPQRWQKIFSFNVWGKIATFWNKAFLTIIILLIVLFLDAVREVRKYSSV-HTIEKSSTSRPDAYEHTQMKLFRSQRNLYISGFSLFFWLVLRRLVTLITQLAKELSNKGVLKTQAENTNKAAKKFMEENEKLKRILKSHGKDEECVLEAENKKLVEDQEKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKEHSELQDRL 233          
BLAST of B-cell receptor-associated protein 31 vs. UniProt/SwissProt
Match: sp|Q61335|BAP31_MOUSE (B-cell receptor-associated protein 31 OS=Mus musculus OX=10090 GN=Bcap31 PE=1 SV=4)

HSP 1 Score: 126.716 bits (317), Expect = 1.820e-33
Identity = 97/233 (41.63%), Postives = 134/233 (57.51%), Query Frame = 2
Query:  104 MSLQWVAVAGFLYLEIFIAMLLTLPFISASRWSKVFKSRIVTKFSNYSTFYFNILLIILAVLFLDAIREIVKYNKMEHKLTSGHMHDTESIILMRLFRGQRNLYVSGFSLFLWFVLRRMVVLITTMAHQEAISSAAIKQAHGASEAAKEMMKKNDV----------------TDXXXXXXXXXXXXXXVATRQLGVSEKEIERLELDLETLKKQYVNHNKAYDELLAEHDDLQ 754
            MSLQW  VA FLY E+F  +LL +PFIS  RW KVFKSR+V     Y   +F +L++IL +L +DA+REI+KY+ +  K+   +         M+LFR QRNLY++GFSL L F+LRR+V LI+  A   A + A  KQA  ASEAAK+ M++ND                 T+ K +    LK  L     +L  ++K++E+ E +   ++KQ     K YD LL EH  LQ
Sbjct:    1 MSLQWTTVATFLYAEVFAVLLLCIPFISPKRWQKVFKSRLVELVVTYGNTFFVVLIVILVLLVIDAVREILKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAEDGDKLDIGNTEMKLEENKSLKNDLRKLKDELASTKKKLEKAENEALAMQKQSEGLTKEYDRLLEEHAKLQ 233          
BLAST of B-cell receptor-associated protein 31 vs. UniProt/SwissProt
Match: sp|Q61334|BAP29_MOUSE (B-cell receptor-associated protein 29 OS=Mus musculus OX=10090 GN=Bcap29 PE=1 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 1.941e-33
Identity = 91/240 (37.92%), Postives = 134/240 (55.83%), Query Frame = 2
Query:  104 MSLQWVAVAGFLYLEIFIAMLLTLPFISASRWSKVFKSRIVTKFSNYSTFYFNILLIILAVLFLDAIREIVKYNKMEHKLTSGHMHDTESIIL--------MRLFRGQRNLYVSGFSLFLWFVLRRMVVLITTMAHQEAISSAAIKQAHGASEAAKEMMKKNDVTDXXXXXXXXXXXXXXVATRQLGVSEKEIERLEL------------DLETLKKQYVNHNKAYDELLAEHDDLQNKL 763
            M++QW AVA FLY EI + +L  LPFI   RW K+F   +  K +++    F  ++I+L +LFLDA+RE+ KY       +S ++ +  S I         M+LFR QRNLY+SGFSLF W VLRR+V LIT +A + A       QA   ++AAK+ M++N+      +++   +  LE   ++L +  KE  + EL            D+ T+K Q    +K YD LL EH +LQN+L
Sbjct:    1 MTIQWAAVASFLYAEIGLILLFCLPFIPPQRWQKIFSFSVWGKIASFWNKAFLTIIILLIILFLDAVREVRKY-------SSTNVVEKNSAIRPSAFEHTQMKLFRSQRNLYISGFSLFFWLVLRRLVTLITQLAKEIANKGVLKIQAENTNKAAKKFMEENEKLKLGLRNDNAEEHLLEAENKKL-IESKENLKTELKKASDALLKAQNDVMTMKIQSERLSKEYDRLLKEHSELQNRL 232          
BLAST of B-cell receptor-associated protein 31 vs. TrEMBL
Match: K1Q5J2 (B-cell receptor-associated protein 31 OS=Crassostrea gigas OX=29159 GN=CGI_10002335 PE=4 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 8.369e-54
Identity = 103/241 (42.74%), Postives = 150/241 (62.24%), Query Frame = 2
Query:  104 MSLQWVAVAGFLYLEIFIAMLLTLPFISASRWSKVFKSRIVTKFSNYSTFYFNILLIILAVLFLDAIREIVKYNKMEHKLTSGHMHDTESIILMRLFRGQRNLYVSGFSLFLWFVLRRMVVLITTMAHQEAISSAAIKQAHGASEAAKEMM--KKNDVTDXXXXXXXXXXXXXXVATR------QLGVSEKEIERLELDLETLKKQYVNHNKAYDELLAEHDDLQNKLAELQQSTDSKKDN 802
            M+LQW  VA F+Y+EI + ++L LPF+S  RW K+F+SR+V+  S YS  YFN+ + IL +LF+D+IRE+ KY     ++   H  D  ++ +M+LFR QRN Y+SGF+LFLWF++RR++ LI   A   A   A  KQA  A+EAAK +M  K N V   K   E    E+  +A +      QL  +++E+++ ++DLETLK Q  + N  YD LL EH+ LQ ++     +  SKKDN
Sbjct:    1 MALQWTFVASFMYIEIAVVIILLLPFVSPGRWQKIFRSRLVSGVSAYSNIYFNVFIAILLLLFVDSIREVHKYTAPTEEVDLKHNPDAANLAMMKLFRAQRNFYISGFALFLWFIIRRLLTLINEEAKLAAQCQAYKKQAESATEAAKRLMEEKDNSVNKGKEDHEDLDPEEKNIAVKLDQTKEQLVKTKEELKKTKVDLETLKSQATSTNNEYDRLLKEHEKLQKQV----DTESSKKDN 237          
BLAST of B-cell receptor-associated protein 31 vs. TrEMBL
Match: A0A0B7B8G7 (Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF170090 PE=4 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 2.475e-52
Identity = 99/245 (40.41%), Postives = 146/245 (59.59%), Query Frame = 2
Query:  104 MSLQWVAVAGFLYLEIFIAMLLTLPFISASRWSKVFKSRIVTKFSNYSTFYFNILLIILAVLFLDAIREIVKYNKMEHKLTSGHMHDTESIILMRLFRGQRNLYVSGFSLFLWFVLRRMVVLITTMAHQEAISSAAIKQAHGASEAAKEMMKKNDVTDXXXXXXXXXXXXXXVATRQLGVSEKEIERLELDLE--------------TLKKQYVNHNKAYDELLAEHDDLQNKLAELQQSTDSKK 796
            M+LQW  VAG LY+EIF+  +L LPF+S   W K+F+SR  + FS YS  YFNI + IL +LFL++IRE  KY++           + E++  M+LFR QRN+Y++GF+LFLWF+LRR+V+LI + A   A + A++KQAH ASEAA++ M++ ++     K++         + RQ    EKE+ + + +LE              T+KKQ  + N+ YD L  E+  LQN     Q  +D KK
Sbjct:    1 MTLQWTFVAGVLYIEIFLVSILLLPFVSPKTWQKLFRSRFTSVFSRYSNIYFNIFIAILVLLFLESIRETWKYSEPMESEDLRRYPEAETVYHMKLFRAQRNMYIAGFALFLWFILRRLVILIASEATLMAQTEASLKQAHSASEAARQYMEEKNLLSDNKKNKDAEDRDEVDSKRQTAHLEKELAQTQTELEKTKEELYRAKLEFTTMKKQAESTNQEYDRLSEEYAKLQNSQDFGQGESDKKK 245          
BLAST of B-cell receptor-associated protein 31 vs. TrEMBL
Match: A0A5K7QSX9 (B-cell receptor-associated protein 31 OS=Haliotis discus discus OX=91233 PE=2 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 3.094e-52
Identity = 100/243 (41.15%), Postives = 146/243 (60.08%), Query Frame = 2
Query:  104 MSLQWVAVAGFLYLEIFIAMLLTLPFISASRWSKVFKSRIVTKFSNYSTFYFNILLIILAVLFLDAIREIVKYNKMEHKLTSGHMHDTESIILMRLFRGQRNLYVSGFSLFLWFVLRRMVVLITTMAHQEAISSAAIKQAHGASEAAKEMM--KKNDVTDXXXXXXXXXXXXXXVATRQ--------LGVSEKEIERLELDLETLKKQYVNHNKAYDELLAEHDDLQNKLAELQQSTDSKKDN 802
            MSLQW  +A  LY+EI + +LL LPFIS  RW KVF+SR++   + Y   YFN+ + IL +LFLD++RE+ KY     ++   H  + + +  M+LFR QRN Y++GF+LFL+F++RR+VVLI+T A   A   A+ KQA GA++AA+ +M  K+N V  +K  +             Q        L  ++ ++ + +L+LE++KKQ    N  YD LL EH  LQ K  E  +ST  KKDN
Sbjct:    1 MSLQWTFIAACLYIEIAVIVLLLLPFISPPRWQKVFRSRLLKSMAAYGHIYFNVFIGILVLLFLDSVREVRKYAGPTEEVDLKHNPEAQMMAQMKLFRSQRNFYIAGFALFLFFIIRRLVVLISTDARLMAECEASRKQAEGATDAARRLMEDKENKVNKTKEDAGAGEDVGAAKGAAQKLDEVETELKKTKDDLHKAQLNLESMKKQAEATNTEYDRLLKEHSKLQEKF-EAIESTGGKKDN 242          
BLAST of B-cell receptor-associated protein 31 vs. TrEMBL
Match: K1S3U6 (B-cell receptor-associated protein 31 OS=Crassostrea gigas OX=29159 GN=CGI_10020710 PE=4 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 4.652e-51
Identity = 98/225 (43.56%), Postives = 142/225 (63.11%), Query Frame = 2
Query:  104 MSLQWVAVAGFLYLEIFIAMLLTLPFISASRWSKVFKSRIVTKFSNYSTFYFNILLIILAVLFLDAIREIVKYNKMEHKLTSGHMHDTESIILMRLFRGQRNLYVSGFSLFLWFVLRRMVVLITTMAHQEAISSAAIKQAHGASEAAKEMM--KKNDVTDXXXXXXXXXXXXXXVATR------QLGVSEKEIERLELDLETLKKQYVNHNKAYDELLAEHDDLQ 754
            M+LQW  VA F+Y+EI + ++L LPF+S  RW K+F+SR+V+  S YS  YFN+ + IL +LF+D+IRE+ KY     ++   H  D  ++ +M+LFR QRN Y+SGF+LFLWF++RR++ LI   A   A   A  KQA  A+EAAK +M  K N V   K   E    E+  +A +      QL  +++E+++ ++DLETLK Q  + N  YD LL EH+ LQ
Sbjct:   13 MALQWTFVASFMYIEIAVVIILLLPFVSPGRWQKIFRSRLVSGVSAYSNIYFNVFIAILLILFVDSIREVHKYTAPTEEVDLKHNPDAANLAMMKLFRAQRNFYISGFALFLWFIIRRLLTLINEEAKLAAQCQAYKKQAESATEAAKRLMEEKDNSVNKGKEDHEDLDPEEKNIAVKLDQTKEQLVKTKEELKKTKVDLETLKSQATSTNNEYDRLLKEHEKLQ 237          
BLAST of B-cell receptor-associated protein 31 vs. TrEMBL
Match: A0A1S3JN78 (B-cell receptor-associated protein 31 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106174712 PE=4 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 8.944e-50
Identity = 105/246 (42.68%), Postives = 149/246 (60.57%), Query Frame = 2
Query:  104 MSLQWVAVAGFLYLEIFIAMLLTLPFISASRWSKVFKSRIVTKFSNYSTFYFNILLIILAVLFLDAIREIVKYNKMEHKLTSGHM-HDTESIILMRLFRGQRNLYVSGFSLFLWFVLRRMVVLITTMAHQEAISSAAIKQAHGASEAAKEMMKKNDVTDXXXXXXXXXXXXXXVAT-------------RQLGVSEKEIERLELDLETLKKQYVNHNKAYDELLAEHDDLQNKLAELQQSTDSKKD 799
            MS QW  +A FLY+EIF+ +LL LPFIS + W K+FKSR +   ++Y+ +YF + ++IL V+F DAIRE+ KY+  E  L      HDT   I +RLFR QRNLY++GF+LFLW VL+R+VVLI+  A   A    A+KQA   S  AK++M++ D   +   +E + +E+   ++               L  SE E+E+ + DL+TLKKQ    N  YD LL EH +LQ   A+L+   + KKD
Sbjct:    1 MSFQWTFIATFLYVEIFLVVLLLLPFISPTTWQKLFKSRFLMIITSYANYYFTVFIVILMVVFGDAIREVYKYSGEEKMLDPKTTHHDTLEHIQLRLFRSQRNLYIAGFALFLWLVLKRLVVLISAAATLTAQRDVALKQAENTSAHAKKLMEEADTKKANKDNEEKDEERKRTSSASDKLEEELKRVKEDLEKSESELEQSKRDLQTLKKQASATNNEYDRLLKEHAELQ---AKLESGGEDKKD 243          
BLAST of B-cell receptor-associated protein 31 vs. Ensembl Cavefish
Match: bcap29 (B cell receptor associated protein 29 [Source:NCBI gene;Acc:103043886])

HSP 1 Score: 146.747 bits (369), Expect = 3.141e-42
Identity = 99/247 (40.08%), Postives = 137/247 (55.47%), Query Frame = 2
Query:  104 MSLQWVAVAGFLYLEIFIAMLLTLPFISASRWSKVFKSRIVTKFSNYSTFYFNILLIILAVLFLDAIREIVKYNKMEH----KLTSG---HMHDTESIILMRLFRGQRNLYVSGFSLFLWFVLRRMVVLITTMAHQEAISSAAIKQAHGASEAAK------EMMKKN--DVTDXXXXXXXXXXXXXXVA--TRQLGVSEKEIERLELDLETLKKQYVNHNKAYDELLAEHDDLQNKLAELQQSTDSK 793
            M+LQW AVA FLY EI I + L LPFISA RW  +FK  + +  + +    F  ++IIL VLFLDA+RE+ KY+  E     K+T     H+H       M+LFR QRNLY+SGFSLFLW VLRR+++LI  +A     S A   Q   A+ AAK      E++K+   D T+ +   +     + EV   T +L  S + +++   +++ LKKQ  +  K YD LL +H  L      L QS D K
Sbjct:    1 MTLQWTAVASFLYAEIGILVFLCLPFISAKRWQSIFKLNMWSSIARFWNKGFLAMIIILIVLFLDAVREVRKYSGAEPSKEAKMTPNMVDHLH-------MKLFRAQRNLYISGFSLFLWLVLRRVIMLINQLAEVTDTSKALHAQTEAANLAAKKYMEDIELLKQALVDGTEEEKSGQKNELLRKEVQKLTDELKTSTEALQKSRSEVDVLKKQTEDLAKEYDRLLQDHQQL------LNQSEDKK 234          
BLAST of B-cell receptor-associated protein 31 vs. Ensembl Cavefish
Match: bcap31 (B cell receptor associated protein 31 [Source:ZFIN;Acc:ZDB-GENE-030616-63])

HSP 1 Score: 128.257 bits (321), Expect = 8.485e-35
Identity = 92/242 (38.02%), Postives = 135/242 (55.79%), Query Frame = 2
Query:  104 MSLQWVAVAGFLYLEIFIAMLLTLPFISASRWSKVFKSRIVTKFSNYSTFYFNILLIILAVLFLDAIREIVKYNKMEH-KLTSG-----HMHDTESIILMRLFRGQRNLYVSGFSLFLWFVLRRMVVLITTMAHQEAISSAAIKQAHGASEAAKEMMKKN---------------DVTDXXXXXXXXXXXXXXVATRQ----LGVSEKEIERLELDLETLKKQYVNHNKAYDELLAEHDDLQ 754
            MSLQW AVA FLY E+F  +LL +PF+S  RWSK+FKSR+V   ++Y    F +++ IL  L +DA RE+ KY+  +   LT+      H+H       M+LFR QRN Y++GF+L L  +LRR+  L++  A   A + A  KQA GAS+AA++ M++N               +V      S  E  + L+   RQ    L  ++K +++ + D++ +KKQ  N    YD LL EH  LQ
Sbjct:    1 MSLQWTAVATFLYAEVFAVLLLCIPFVSPKRWSKIFKSRLVIAITSYGNTAFIVVICILVFLLVDAFREVRKYSVTDKVDLTNNPVAIEHIH-------MKLFRAQRNEYIAGFALLLCLLLRRLASLLSQQATLMASNEAFQKQAEGASDAARKYMEENEKLQERLREAGLEVPEVGGKAKASAEEENKTLKGEVRQLKDELDATKKALQKSDSDVKAMKKQAENLTVEYDRLLEEHAKLQ 235          
BLAST of B-cell receptor-associated protein 31 vs. Ensembl Yeast
Match: YET3 (Protein of unknown function; YET3 null mutant decreases the level of secreted invertase; homolog of human BAP31 protein; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000002230])

HSP 1 Score: 55.0694 bits (131), Expect = 1.395e-9
Identity = 50/174 (28.74%), Postives = 85/174 (48.85%), Query Frame = 2
Query:  104 MSLQWVAVAGFLYLEIFIAMLLTLPFISASRWSKVFKSRIVTKF-SNYSTFYFNILLIILAVLFLDAIREIVKYNKMEHKLTSGHMHDTESI------ILMRLFRGQRNLYVSGFSLFLWFVLRR---MVVLITTMAH----QEAISSAAIKQAHG--ASEAAKEMMKKNDVTD 577
            MSL +  V   L +EIF+  +L LP    SR+ +     ++  F S+        +L  + +LF+D I  +   +K E +L+S   ++   I      +L R F  QRN+Y++G +LFL FV+ R   +V+ + TM         ++S+ +K+     A  AA+    K+D  D
Sbjct:    1 MSLYYTLVFAILVVEIFMFSILALPI--PSRYRRPLTLLLLKPFKSSTVQVAIKCVLGFILLLFIDCINRVYSIDK-ELQLSSASQNNGAIIAQDRIEVLSRKFFAQRNMYLTGITLFLTFVVVRTFGLVIELLTMKDIYRASPPVASSDVKKNDSVTAEAAAQSGASKDDHGD 171          
BLAST of B-cell receptor-associated protein 31 vs. Ensembl Medaka
Match: bcap29 (B cell receptor associated protein 29 [Source:NCBI gene;Acc:101172597])

HSP 1 Score: 136.346 bits (342), Expect = 3.575e-38
Identity = 96/253 (37.94%), Postives = 145/253 (57.31%), Query Frame = 2
Query:  104 MSLQWVAVAGFLYLEIFIAMLLTLPFISASRWSKVFKSRIVTKFSNYSTFYFNILLIILAVLFLDAIREIVKYNKME----HKLTSG---HMHDTESIILMRLFRGQRNLYVSGFSLFLWFVLRRMVVLITTMAHQEAISSAAIKQAHGASEAAKEMMKKNDVTDXXXXXXXXXXXXXXVATRQLGVSEKEIERLELDLET--------------LKKQYVNHNKAYDELLAEHDDLQNKLAELQQSTDSKKD 799
            M+LQW AVA FLY EI + ++L LPFISA RW  +FK RI +  +N+    F  ++IIL +LFLDA+RE+ KY+  +     KL      HMH       M+LFR QRNLY+SGFS+FLW V++R++ LI  +A   A ++A  +QA  A++ A++ MK N++     K  +   +  +   + + +   E+E+L+ +L+T              +KKQ     + YD LL EH +LQN    LQ + + K+D
Sbjct:    1 MTLQWTAVALFLYAEIGVILILCLPFISARRWQSIFKFRIWSWMANFWNKVFLTMIIILIILFLDAVREVRKYSSKDLVVGAKLQPNMFDHMH-------MKLFRAQRNLYISGFSVFLWLVMKRLITLINQLASASATTAALQEQAANANQTAEKYMKDNEL----LKQTLMDGKADKATEKGMELLRTEMEKLKKELKTSGDALEKSHKEADAVKKQVDGLAREYDRLLKEHQELQN----LQDNGNKKED 238          
BLAST of B-cell receptor-associated protein 31 vs. Ensembl Medaka
Match: ENSORLT00000005544.2 (B-cell receptor-associated protein 29 [Source:NCBI gene;Acc:101167034])

HSP 1 Score: 136.732 bits (343), Expect = 6.070e-38
Identity = 88/242 (36.36%), Postives = 129/242 (53.31%), Query Frame = 2
Query:  104 MSLQWVAVAGFLYLEIFIAMLLTLPFISASRWSKVFKSRIVTKFSNYSTFYFNILLIILAVLFLDAIREIVKYNKMEHKLTSGHMHDTESIILMRLFRGQRNLYVSGFSLFLWFVLRRMVVLITTM-------AHQEAISSAAIKQAHGASEAAKEMMKKNDVTDXXXXXXXXXXXXXXVATR---QLGVSEKEIERLELDLETLKKQYVNHNKAYDELLAEHDDLQNKLAELQQSTDSKKD 799
            MSLQW AVA FLY EI + ++L +PFISA RW  VF+ RI    S+Y    F  ++ +L VLF+DA+RE+ KY+  +    +    +    + M+LFR QRNLY+SGFSLFLW  + R+V L+          A  +A   AA+K+A    E  KE M K  +++ +       ++      +   QL  +E++  +   ++E +K+Q       YD LL EH  LQN      Q  + KKD
Sbjct:   41 MSLQWTAVAFFLYAEIVVNLILCIPFISAHRWRVVFRWRIWGWLSSYWNKAFFAMITVLVVLFIDAVREVQKYSAPQSTQDATVNPNLYDNVHMKLFRAQRNLYISGFSLFLWLTMCRVVTLLNKTAITLENSAELQAQVDAALKEAKQHQE--KEQMFKKVISEGEKSMAATKEQLKLELEKLSSQLKAAEEDRRKSNAEVEAMKRQAKGLALEYDRLLREHHQLQN------QRPEDKKD 274          
BLAST of B-cell receptor-associated protein 31 vs. Ensembl Medaka
Match: bcap31 (B cell receptor associated protein 31 [Source:NCBI gene;Acc:101171812])

HSP 1 Score: 127.872 bits (320), Expect = 6.164e-35
Identity = 92/246 (37.40%), Postives = 134/246 (54.47%), Query Frame = 2
Query:  104 MSLQWVAVAGFLYLEIFIAMLLTLPFISASRWSKVFKSRIVTKFSNYSTFYFNILLIILAVLFLDAIREIVKYNKMEHKLTSGHMHDTESIILMRLFRGQRNLYVSGFSLFLWFVLRRMVVLITTMAHQEAISSAAIKQAHGASEAAKEMMKKNDVTDXXXXXXXXXXXXX------------------XVATRQLGVSEKEIERLELDLETLKKQYVNHNKAYDELLAEHDDLQNKLAELQQSTD 787
            MSLQW AVA FLY+E+F+ +LL +PFIS  RWSKVFKSRI+   + Y   +F + + IL  L +DA RE+ KY+  +    + +    E  I M+LFR QRN Y++GF+L L  +LRR+  L++  A   A + A  KQA GAS AAK+ M  N++   K ++      +                   +  T +L  ++K + + + D++ +KKQ  N    YD LL EH  L   LAE +   D
Sbjct:    1 MSLQWTAVATFLYVEVFLVLLLCIPFISPKRWSKVFKSRILQTIALYGNTWFMVAIAILVFLLIDAFREVRKYSVSDKVDVTNNPTAIEH-IHMKLFRAQRNEYIAGFALLLCLLLRRLATLLSQQASLMASNEAFKKQAEGASAAAKKYMDDNELLQEKLQAAGIEVPEGGKKGAGPQEENKVLKGELKTLTEELETTKKALHKSDSDVQAMKKQAENLTVEYDRLLEEHSKL---LAERRSEED 242          
BLAST of B-cell receptor-associated protein 31 vs. Ensembl Medaka
Match: bcap31 (B cell receptor associated protein 31 [Source:NCBI gene;Acc:101171812])

HSP 1 Score: 128.642 bits (322), Expect = 1.039e-34
Identity = 92/250 (36.80%), Postives = 136/250 (54.40%), Query Frame = 2
Query:  104 MSLQWVAVAGFLYLEIFIAMLLTLPFISASRWSKVFKSRIVTKFSNYSTFYFNILLIILAVLFLDAIREIVKYNKMEHKLTSGHMHDTESIILMRLFRGQRNLYVSGFSLFLWFVLRRMVVLITTMAHQEAISSAAIKQAHGASEAAKEMMKKNDVTDXXXXXXXXXXXXX------------------XVATRQLGVSEKEIERLELDLETLKKQYVNHNKAYDELLAEHDDLQNKLAELQQSTDSKKD 799
            MSLQW AVA FLY+E+F+ +LL +PFIS  RWSKVFKSRI+   + Y   +F + + IL  L +DA RE+ KY+  +    + +    E  I M+LFR QRN Y++GF+L L  +LRR+  L++  A   A + A  KQA GAS AAK+ M  N++   K ++      +                   +  T +L  ++K + + + D++ +KKQ  N    YD LL EH       ++L  S+D K D
Sbjct:   40 MSLQWTAVATFLYVEVFLVLLLCIPFISPKRWSKVFKSRILQTIALYGNTWFMVAIAILVFLLIDAFREVRKYSVSDKVDVTNNPTAIEH-IHMKLFRAQRNEYIAGFALLLCLLLRRLATLLSQQASLMASNEAFKKQAEGASAAAKKYMDDNELLQEKLQAAGIEVPEGGKKGAGPQEENKVLKGELKTLTEELETTKKALHKSDSDVQAMKKQAENLTVEYDRLLEEH-------SKLLASSDKKSD 281          
BLAST of B-cell receptor-associated protein 31 vs. Planmine SMEST
Match: SMESG000064614.1 (SMESG000064614.1)

HSP 1 Score: 440.654 bits (1132), Expect = 7.803e-158
Identity = 232/233 (99.57%), Postives = 232/233 (99.57%), Query Frame = 2
Query:  104 MSLQWVAVAGFLYLEIFIAMLLTLPFISASRWSKVFKSRIVTKFSNYSTFYFNILLIILAVLFLDAIREIVKYNKMEHKLTSGHMHDTESIILMRLFRGQRNLYVSGFSLFLWFVLRRMVVLITTMAHQEAISSAAIKQAHGASEAAKEMMKKNDVTDXXXXXXXXXXXXXXVATRQLGVSEKEIERLELDLETLKKQYVNHNKAYDELLAEHDDLQNKLAELQQSTDSKKDN 802
            MSLQWVAVAGFLYLEIFIAMLLTLPFISASRWSKVFKSRIVTKFSNYSTFYFNILLIILAVLFLDAIREIVKYNKMEHKL SGHMHDTESIILMRLFRGQRNLYVSGFSLFLWFVLRRMVVLITTMAHQEAISSAAIKQAHGASEAAKEMMKKNDVTDSKSKSEIELKEKLEVATRQLGVSEKEIERLELDLETLKKQYVNHNKAYDELLAEHDDLQNKLAELQQSTDSKKDN
Sbjct:    1 MSLQWVAVAGFLYLEIFIAMLLTLPFISASRWSKVFKSRIVTKFSNYSTFYFNILLIILAVLFLDAIREIVKYNKMEHKLASGHMHDTESIILMRLFRGQRNLYVSGFSLFLWFVLRRMVVLITTMAHQEAISSAAIKQAHGASEAAKEMMKKNDVTDSKSKSEIELKEKLEVATRQLGVSEKEIERLELDLETLKKQYVNHNKAYDELLAEHDDLQNKLAELQQSTDSKKDN 233          
The following BLAST results are available for this feature:
BLAST of B-cell receptor-associated protein 31 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BCAP313.028e-3641.94B cell receptor associated protein 31 [Source:HGNC... [more]
BCAP311.413e-3441.03B cell receptor associated protein 31 [Source:HGNC... [more]
BCAP311.413e-3441.03B cell receptor associated protein 31 [Source:HGNC... [more]
BCAP311.413e-3441.03B cell receptor associated protein 31 [Source:HGNC... [more]
BCAP291.710e-3438.46B cell receptor associated protein 29 [Source:NCBI... [more]
back to top
BLAST of B-cell receptor-associated protein 31 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Y54G2A.188.782e-4236.214D656 [Source:UniProtKB/TrEMBL;Acc:G5EBI0][more]
back to top
BLAST of B-cell receptor-associated protein 31 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG138875.079e-3336.20gene:FBgn0035165 transcript:FBtr0072583[more]
CG138875.079e-3336.20gene:FBgn0035165 transcript:FBtr0345588[more]
CG138875.079e-3336.20gene:FBgn0035165 transcript:FBtr0072584[more]
CG138874.399e-2940.76gene:FBgn0035165 transcript:FBtr0304797[more]
back to top
BLAST of B-cell receptor-associated protein 31 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
bcap294.639e-4438.10B cell receptor associated protein 29 [Source:ZFIN... [more]
bcap311.655e-3639.84B cell receptor associated protein 31 [Source:ZFIN... [more]
back to top
BLAST of B-cell receptor-associated protein 31 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
noc3l2.038e-3935.34NOC3-like DNA replication regulator [Source:Xenbas... [more]
bcap311.261e-3540.94B cell receptor associated protein 31 [Source:NCBI... [more]
bcap315.513e-3542.26B cell receptor associated protein 31 [Source:NCBI... [more]
back to top
BLAST of B-cell receptor-associated protein 31 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Bcap312.602e-3441.63B cell receptor associated protein 31 [Source:MGI ... [more]
Bcap292.775e-3437.92B cell receptor associated protein 29 [Source:MGI ... [more]
Bcap292.775e-3437.92B cell receptor associated protein 29 [Source:MGI ... [more]
back to top
BLAST of B-cell receptor-associated protein 31 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5R8H3|BAP31_PONAB2.713e-3440.16B-cell receptor-associated protein 31 OS=Pongo abe... [more]
sp|P51572|BAP31_HUMAN6.788e-3441.03B-cell receptor-associated protein 31 OS=Homo sapi... [more]
sp|Q9UHQ4|BAP29_HUMAN8.213e-3438.46B-cell receptor-associated protein 29 OS=Homo sapi... [more]
sp|Q61335|BAP31_MOUSE1.820e-3341.63B-cell receptor-associated protein 31 OS=Mus muscu... [more]
sp|Q61334|BAP29_MOUSE1.941e-3337.92B-cell receptor-associated protein 29 OS=Mus muscu... [more]
back to top
BLAST of B-cell receptor-associated protein 31 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1Q5J28.369e-5442.74B-cell receptor-associated protein 31 OS=Crassostr... [more]
A0A0B7B8G72.475e-5240.41Uncharacterized protein OS=Arion vulgaris OX=10286... [more]
A0A5K7QSX93.094e-5241.15B-cell receptor-associated protein 31 OS=Haliotis ... [more]
K1S3U64.652e-5143.56B-cell receptor-associated protein 31 OS=Crassostr... [more]
A0A1S3JN788.944e-5042.68B-cell receptor-associated protein 31 isoform X1 O... [more]
back to top
BLAST of B-cell receptor-associated protein 31 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
bcap293.141e-4240.08B cell receptor associated protein 29 [Source:NCBI... [more]
bcap318.485e-3538.02B cell receptor associated protein 31 [Source:ZFIN... [more]
back to top
BLAST of B-cell receptor-associated protein 31 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of B-cell receptor-associated protein 31 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
YET31.395e-928.74Protein of unknown function; YET3 null mutant decr... [more]
back to top
BLAST of B-cell receptor-associated protein 31 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of B-cell receptor-associated protein 31 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
bcap293.575e-3837.94B cell receptor associated protein 29 [Source:NCBI... [more]
ENSORLT00000005544.26.070e-3836.36B-cell receptor-associated protein 29 [Source:NCBI... [more]
bcap316.164e-3537.40B cell receptor associated protein 31 [Source:NCBI... [more]
bcap311.039e-3436.80B cell receptor associated protein 31 [Source:NCBI... [more]
back to top
BLAST of B-cell receptor-associated protein 31 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000064614.17.803e-15899.57SMESG000064614.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016492 ID=SMED30016492|Name=B-cell receptor-associated protein 31|organism=Schmidtea mediterranea sexual|type=transcript|length=968bp
TTTTTTTTGAAAATTTGAAATTGTTTGAATAAATTAACTTCTTTGCAAAT
AATTAAACGTTTAAATCTTCCAAGATTTCAATAATCAGCTTATTTGAATA
ATAATGAGTTTACAATGGGTAGCTGTTGCTGGATTTCTTTATTTAGAAAT
ATTTATTGCGATGCTCTTGACATTGCCATTTATTTCAGCTTCGCGGTGGA
GCAAGGTCTTTAAATCACGAATTGTTACTAAGTTTAGTAATTATTCAACG
TTCTATTTTAATATTTTGCTCATAATTTTGGCGGTGCTCTTTTTAGATGC
TATTCGAGAAATTGTTAAATATAACAAAATGGAACACAAATTGACATCTG
GCCATATGCACGATACTGAATCAATAATATTAATGAGACTTTTTCGTGGT
CAAAGGAATTTATATGTATCCGGATTTTCTCTCTTTTTGTGGTTTGTTTT
ACGAAGAATGGTCGTTCTAATCACTACGATGGCCCATCAAGAAGCAATTA
GTTCAGCTGCCATTAAGCAAGCACATGGGGCATCAGAGGCTGCTAAAGAA
ATGATGAAAAAAAACGATGTAACAGACAGCAAATCGAAATCTGAAATTGA
ATTGAAAGAAAAACTAGAAGTCGCTACAAGACAGTTGGGAGTGTCAGAAA
AAGAAATCGAACGCTTAGAATTGGACTTAGAAACACTGAAGAAACAATAC
GTTAACCATAACAAAGCATATGATGAATTGTTAGCGGAACACGACGATTT
ACAGAATAAATTGGCTGAACTGCAACAATCAACAGATAGTAAGAAAGACA
ATTAGTGGAAATTTATTTAATTTGAAAATAAATTTTTTGTTGGCTTTATG
ATTAATTACAAATTTTGACATTTCATGTTTTATTTGATTTGCTACAATTC
ATTAACTGACCAAATCCGGTATATATATTTGTATTTCGTATTTGTTTAAT
AAAATTTGTATTTCTGTT
back to top

protein sequence of SMED30016492-orf-1

>SMED30016492-orf-1 ID=SMED30016492-orf-1|Name=SMED30016492-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=234bp
MSLQWVAVAGFLYLEIFIAMLLTLPFISASRWSKVFKSRIVTKFSNYSTF
YFNILLIILAVLFLDAIREIVKYNKMEHKLTSGHMHDTESIILMRLFRGQ
RNLYVSGFSLFLWFVLRRMVVLITTMAHQEAISSAAIKQAHGASEAAKEM
MKKNDVTDSKSKSEIELKEKLEVATRQLGVSEKEIERLELDLETLKKQYV
NHNKAYDELLAEHDDLQNKLAELQQSTDSKKDN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000208testis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR040463BAP29/BAP31_N
IPR008417BAP29/BAP31
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0006886intracellular protein transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 171..233
NoneNo IPR availablePANTHERPTHR12701:SF15B-CELL RECEPTOR-ASSOCIATED PROTEIN 31coord: 1..221
NoneNo IPR availableTMHMMTMhelixcoord: 5..27
NoneNo IPR availableTMHMMTMhelixcoord: 102..121
NoneNo IPR availableTMHMMTMhelixcoord: 47..64
IPR040463BAP29/BAP31, transmembrane domainPFAMPF05529Bap31coord: 1..133
e-value: 6.1E-43
score: 145.9
IPR008417B-cell receptor-associated protein 29/31PANTHERPTHR12701BCR-ASSOCIATED PROTEIN, BAPcoord: 1..221