ANK_REP_REGION domain-containing protein

Overview
NameANK_REP_REGION domain-containing protein
Smed IDSMED30016480
Length (bp)1232
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ANK_REP_REGION domain-containing protein (SMED30016480) t-SNE clustered cells

Violin plots show distribution of expression levels for ANK_REP_REGION domain-containing protein (SMED30016480) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ANK_REP_REGION domain-containing protein (SMED30016480) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ANK_REP_REGION domain-containing protein (SMED30016480) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016480

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 36

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30016480h1SMcG0008237 dd_Smed_v4_91547_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30016480h1SMcG0008237 dd_Smed_v4_91547_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30016480h1SMcG0008237 dd_Smed_v4_91547_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30016480h1SMcG0008237 dd_Smed_v4_96152_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30016480h1SMcG0008237 dd_Smed_v4_96152_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30016480h1SMcG0008237 dd_Smed_v4_96152_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30016480h1SMcG0008237 dd_Smed_v4_98586_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30016480h1SMcG0008237 dd_Smed_v4_98586_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30016480h1SMcG0008237 dd_Smed_v4_98586_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30016480h1SMcG0008237 dd_Smed_v4_92330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30016480h1SMcG0008237 dd_Smed_v4_92330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30016480h1SMcG0008237 dd_Smed_v4_92330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016480h1SMcG0008237 Contig29127newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016480h1SMcG0008237 Contig29127uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30016480h1SMcG0008237 dd_Smed_v4_71921_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30016480h1SMcG0008237 dd_Smed_v4_71921_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30016480h1SMcG0008237 dd_Smed_v4_71921_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016480h1SMcG0008236 Contig29127newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016480h1SMcG0008236 Contig29127uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30016480h1SMcG0008237 dd_Smed_v4_89532_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30016480h1SMcG0008237 dd_Smed_v4_89532_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30016480h1SMcG0008237 dd_Smed_v4_55264_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30016480h1SMcG0008237 dd_Smed_v4_55264_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30016480h1SMcG0008237 dd_Smed_v4_55264_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30016480h1SMcG0008237 dd_Smed_v4_55117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30016480h1SMcG0008237 dd_Smed_v4_55117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30016480h1SMcG0008237 dd_Smed_v4_55117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30016480h1SMcG0008237 dd_Smed_v4_82108_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30016480h1SMcG0008237 dd_Smed_v4_82108_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30016480h1SMcG0008237 dd_Smed_v4_82108_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30016480h1SMcG0008237 dd_Smed_v6_55264_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30016480h1SMcG0008237 dd_Smed_v6_55117_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30016480h1SMcG0008237 Contig29127newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30016480h1SMcG0008237 Contig29127uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30016480h1SMcG0008236 Contig29127newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30016480h1SMcG0008236 Contig29127uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 103.219 bits (256), Expect = 5.942e-23
Identity = 81/261 (31.03%), Postives = 126/261 (48.28%), Query Frame = 2
Query:  416 MNCSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            ++C+ ++  + V +LL     E   P +  +  GET L +A +  ++ +V  LL  GA V+++ ++  T LH +++  K EIV+LLL   A P+       Y PLH++ R       + S LL+A     L    +G   L  A + G++  AK LL++ A      K   NG T  H A    +     LL +  A        G T LHI  ++N   I   L +Y A  NIV     TPLH+A+++G T +V  L+DK
Sbjct:  274 LHCAARSGHDQVVELLL----ERGAPLLARTKRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAA-TTNGYTPLHISAREG--QVDVASVLLEAGAAHSLAT-KKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGK---NGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDK 523          

HSP 2 Score: 85.1149 bits (209), Expect = 5.942e-17
Identity = 69/230 (30.00%), Postives = 112/230 (48.70%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDS--EGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            G   L LA KE  + +V  LL  G++V+S TK G TALH ++   + E+VK+L+ + A+ N   +   + PL++A +        I  +    +NG  Q  +  +G   L  A++ G       LLE D       K +L    A H A R+ D  +  LL   +   D+Q+  G T LHI     + N+   L +  A+ +       TPLH+A+++G T +V+ L+D+
Sbjct:   43 GLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANIN-AQSQNGFTPLYMAAQEN-----HIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDT----KGKVRL---PALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDR 259          

HSP 3 Score: 79.337 bits (194), Expect = 4.259e-15
Identity = 74/250 (29.60%), Postives = 113/250 (45.20%), Query Frame = 2
Query:  491 PNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITK--YYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            P+   +N G T L ++ +E ++ +   LLE GA  +  TK G T LH +AKY   ++ KLLL + A     D+  K    PLH+A            ALL   K       ++   + +H A +   +  A  LL   A+  +  K+   G T  H A +    D + LL D  A I +    G T LH+  +E+  N+   L  + A  +    +  TPL +A   G  K+V FL+ K   NV A+ K+
Sbjct:  362 PDAATTN-GYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRA---AADSAGKNGLTPLHVAAHYD----NQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQ---GVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLL-KQGANVNAKTKN 599          

HSP 4 Score: 75.8702 bits (185), Expect = 5.022e-14
Identity = 77/290 (26.55%), Postives = 121/290 (41.72%), Query Frame = 2
Query:  422 CSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKA------------------------------SANIVDNMDR---TPLHIAAEKGFTKIVEFLI 1192
             S+  +   V+ L+++ +  N+      S  G T L +A +EN + +V  LLE GAN ++ T+DG T L  + +    + V +LL  +    +     +   LH+A R+       +  LL+   N  +Q  S G   L  A   G V  A  LL + A +    +   NG T  H A +R + + +KLL D    ID +   G T LH       + +V+ L    A                              +  +VD   R   TPLHIA+  G T+IV+ L+
Sbjct:   83 ASLAGQAEVVKVLVKEGANINA-----QSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKV-----RLPALHIAARKDDTKSAAL--LLQNDHNADVQSKS-GFTPLHIAAHYGNVNVATLLLNRGAAVDFTAR---NGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLL 356          

HSP 5 Score: 73.1738 bits (178), Expect = 4.225e-13
Identity = 68/239 (28.45%), Postives = 108/239 (45.19%), Query Frame = 2
Query:  527 LMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNA--DPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDS---EGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDK 1228
            L +A +++       LL+   N + ++K G T LH +A Y    +  LLL++ A  D    + IT   PLH+A +R      ++  LL   + G  QID+   +G+  L  A   G     + LLE+ A +    KR   G+TA H A R   ++ ++ L    A +D +    QT LHI        IV+ L  + A  +       TPLHI+A +G   +   L++    +  A  K
Sbjct:  175 LHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGIT---PLHVASKRG--NTNMVKLLLD--RGG--QIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKR---GETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKK 401          

HSP 6 Score: 55.0694 bits (131), Expect = 2.062e-7
Identity = 29/68 (42.65%), Postives = 44/68 (64.71%), Query Frame = 2
Query:  500 KDSNT--GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPN 697
            +D++T  G T L++AC    + +V+ LL+ GANVN+KTK+G T LH +A+     I+ +LL   A PN
Sbjct:  560 QDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPN 627          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 101.293 bits (251), Expect = 2.605e-22
Identity = 83/266 (31.20%), Postives = 121/266 (45.49%), Query Frame = 2
Query:  491 PNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACR---------------------RTIPPPGLISALLKATKNGRLQID---------SEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            PN +  N G T L +ACK+N++ +++ L++ GA++ + T+ GLT +H +A      IV LLL   A P++  NI     LH+A R                     R    P  I++ L  T+  +L +          + G   L  +   G V  A  LLE  A   +  K+   G T  H A +   LD  KLL    A  D     G T LHI  ++N   I   L +Y A  NIV     TPLH+A+++G T +V  L+DK
Sbjct:  362 PNARALN-GFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVT-NIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKK---GFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDK 622          

HSP 2 Score: 85.1149 bits (209), Expect = 4.939e-17
Identity = 69/230 (30.00%), Postives = 112/230 (48.70%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDS--EGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            G   L LA KE  + +V  LL  G++V+S TK G TALH ++   + E+VK+L+ + A+ N   +   + PL++A +        I  +    +NG  Q  +  +G   L  A++ G       LLE D       K +L    A H A R+ D  +  LL   +   D+Q+  G T LHI     + N+   L +  A+ +       TPLH+A+++G T +V+ L+D+
Sbjct:   43 GLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANIN-AQSQNGFTPLYMAAQEN-----HIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDT----KGKVRL---PALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDR 259          

HSP 3 Score: 85.1149 bits (209), Expect = 4.984e-17
Identity = 76/273 (27.84%), Postives = 124/273 (45.42%), Query Frame = 2
Query:  416 MNCSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNG-RLQIDSEGMNSLIH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDK 1228
            ++C+ ++  + V +LL     E   P +  +  G + L +A + + +  V  LL+  A V+  T D LTALH +A      + KLLL K A+PN    +  + PLH+AC++       I  +    K G  +Q  +E   + IH A  +G +     LL+  A   +   R   G+TA H A R   ++ ++ L    A +D +    QT LHI        IV+ L  + A  +       TPLHI+A +G   +   L++    +  A  K
Sbjct:  274 LHCAARSGHDQVVELLL----ERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPN-ARALNGFTPLHIACKKN-----RIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIR---GETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKK 533          

HSP 4 Score: 83.9593 bits (206), Expect = 1.202e-16
Identity = 82/288 (28.47%), Postives = 124/288 (43.06%), Query Frame = 2
Query:  458 LLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADI------------------QMNKKRKL------------NGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            LL Q      + NI+    GET L +A +  ++ +V  LL  GA V+++ ++  T LH +++  K EIV+LLL   A P+       Y PLH++ R       + S LL+A     L    +G   L  A + G++  AK LL++ A                    QM     L             G T  H A +    D + LL D  A I +    G T LH+  +E+  N+   L  + A  +    +  TPL +A   G  K+V FL+ K   NV A+ K+
Sbjct:  420 LLLQNGASPDVTNIR----GETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAA-TTNGYTPLHISAREG--QVDVASVLLEAGAAHSLAT-KKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLL-KQGANVNAKTKN 698          

HSP 5 Score: 83.5741 bits (205), Expect = 1.816e-16
Identity = 69/229 (30.13%), Postives = 108/229 (47.16%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSL--IH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
            G T L +A K     +V  LL+ G  +++KT+DGLT LH +A+   +++V+LLL + A P +        PLH+A +      G     +K     +  +D   ++ L  +H A   G     K LL+K A+      R LNG T  H AC++  +  ++LL    A I      G T +H+       NIV  L    AS ++ +    T LH+AA  G  ++V  L+
Sbjct:  237 GITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGA-PLLARTKNGLSPLHMAAQ------GDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRAN---PNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLL 455          

HSP 6 Score: 74.7146 bits (182), Expect = 1.363e-13
Identity = 78/300 (26.00%), Postives = 124/300 (41.33%), Query Frame = 2
Query:  422 CSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIV---------------------------------KYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFAR 1222
             S+  +   V+ L+++ +  N+      S  G T L +A +EN + +V  LLE GAN ++ T+DG T L  + +    + V +LL  +    +     +   LH+A R+       +  LL+   N  +Q  S G   L  A   G V  A  LL + A +    +   NG T  H A +R + + +KLL D    ID +   G T LH       + +V                                 K+L  +KA  + V     T LH+AA  G  ++ + L+DK + N  AR
Sbjct:   83 ASLAGQAEVVKVLVKEGANINA-----QSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKV-----RLPALHIAARKDDTKSAAL--LLQNDHNADVQSKS-GFTPLHIAAHYGNVNVATLLLNRGAAVDFTAR---NGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDK-RANPNAR 365          

HSP 7 Score: 55.0694 bits (131), Expect = 1.863e-7
Identity = 29/68 (42.65%), Postives = 44/68 (64.71%), Query Frame = 2
Query:  500 KDSNT--GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPN 697
            +D++T  G T L++AC    + +V+ LL+ GANVN+KTK+G T LH +A+     I+ +LL   A PN
Sbjct:  659 QDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPN 726          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 101.293 bits (251), Expect = 2.605e-22
Identity = 83/266 (31.20%), Postives = 121/266 (45.49%), Query Frame = 2
Query:  491 PNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACR---------------------RTIPPPGLISALLKATKNGRLQID---------SEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            PN +  N G T L +ACK+N++ +++ L++ GA++ + T+ GLT +H +A      IV LLL   A P++  NI     LH+A R                     R    P  I++ L  T+  +L +          + G   L  +   G V  A  LLE  A   +  K+   G T  H A +   LD  KLL    A  D     G T LHI  ++N   I   L +Y A  NIV     TPLH+A+++G T +V  L+DK
Sbjct:  362 PNARALN-GFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVT-NIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKK---GFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDK 622          

HSP 2 Score: 85.1149 bits (209), Expect = 4.939e-17
Identity = 69/230 (30.00%), Postives = 112/230 (48.70%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDS--EGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            G   L LA KE  + +V  LL  G++V+S TK G TALH ++   + E+VK+L+ + A+ N   +   + PL++A +        I  +    +NG  Q  +  +G   L  A++ G       LLE D       K +L    A H A R+ D  +  LL   +   D+Q+  G T LHI     + N+   L +  A+ +       TPLH+A+++G T +V+ L+D+
Sbjct:   43 GLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANIN-AQSQNGFTPLYMAAQEN-----HIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDT----KGKVRL---PALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDR 259          

HSP 3 Score: 85.1149 bits (209), Expect = 4.984e-17
Identity = 76/273 (27.84%), Postives = 124/273 (45.42%), Query Frame = 2
Query:  416 MNCSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNG-RLQIDSEGMNSLIH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDK 1228
            ++C+ ++  + V +LL     E   P +  +  G + L +A + + +  V  LL+  A V+  T D LTALH +A      + KLLL K A+PN    +  + PLH+AC++       I  +    K G  +Q  +E   + IH A  +G +     LL+  A   +   R   G+TA H A R   ++ ++ L    A +D +    QT LHI        IV+ L  + A  +       TPLHI+A +G   +   L++    +  A  K
Sbjct:  274 LHCAARSGHDQVVELLL----ERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPN-ARALNGFTPLHIACKKN-----RIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIR---GETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKK 533          

HSP 4 Score: 83.9593 bits (206), Expect = 1.202e-16
Identity = 82/288 (28.47%), Postives = 124/288 (43.06%), Query Frame = 2
Query:  458 LLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADI------------------QMNKKRKL------------NGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            LL Q      + NI+    GET L +A +  ++ +V  LL  GA V+++ ++  T LH +++  K EIV+LLL   A P+       Y PLH++ R       + S LL+A     L    +G   L  A + G++  AK LL++ A                    QM     L             G T  H A +    D + LL D  A I +    G T LH+  +E+  N+   L  + A  +    +  TPL +A   G  K+V FL+ K   NV A+ K+
Sbjct:  420 LLLQNGASPDVTNIR----GETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAA-TTNGYTPLHISAREG--QVDVASVLLEAGAAHSLAT-KKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLL-KQGANVNAKTKN 698          

HSP 5 Score: 83.5741 bits (205), Expect = 1.816e-16
Identity = 69/229 (30.13%), Postives = 108/229 (47.16%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSL--IH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
            G T L +A K     +V  LL+ G  +++KT+DGLT LH +A+   +++V+LLL + A P +        PLH+A +      G     +K     +  +D   ++ L  +H A   G     K LL+K A+      R LNG T  H AC++  +  ++LL    A I      G T +H+       NIV  L    AS ++ +    T LH+AA  G  ++V  L+
Sbjct:  237 GITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGA-PLLARTKNGLSPLHMAAQ------GDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRAN---PNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLL 455          

HSP 6 Score: 74.7146 bits (182), Expect = 1.363e-13
Identity = 78/300 (26.00%), Postives = 124/300 (41.33%), Query Frame = 2
Query:  422 CSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIV---------------------------------KYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFAR 1222
             S+  +   V+ L+++ +  N+      S  G T L +A +EN + +V  LLE GAN ++ T+DG T L  + +    + V +LL  +    +     +   LH+A R+       +  LL+   N  +Q  S G   L  A   G V  A  LL + A +    +   NG T  H A +R + + +KLL D    ID +   G T LH       + +V                                 K+L  +KA  + V     T LH+AA  G  ++ + L+DK + N  AR
Sbjct:   83 ASLAGQAEVVKVLVKEGANINA-----QSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKV-----RLPALHIAARKDDTKSAAL--LLQNDHNADVQSKS-GFTPLHIAAHYGNVNVATLLLNRGAAVDFTAR---NGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDK-RANPNAR 365          

HSP 7 Score: 55.0694 bits (131), Expect = 1.863e-7
Identity = 29/68 (42.65%), Postives = 44/68 (64.71%), Query Frame = 2
Query:  500 KDSNT--GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPN 697
            +D++T  G T L++AC    + +V+ LL+ GANVN+KTK+G T LH +A+     I+ +LL   A PN
Sbjct:  659 QDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPN 726          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 101.293 bits (251), Expect = 2.655e-22
Identity = 83/266 (31.20%), Postives = 121/266 (45.49%), Query Frame = 2
Query:  491 PNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACR---------------------RTIPPPGLISALLKATKNGRLQID---------SEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            PN +  N G T L +ACK+N++ +++ L++ GA++ + T+ GLT +H +A      IV LLL   A P++  NI     LH+A R                     R    P  I++ L  T+  +L +          + G   L  +   G V  A  LLE  A   +  K+   G T  H A +   LD  KLL    A  D     G T LHI  ++N   I   L +Y A  NIV     TPLH+A+++G T +V  L+DK
Sbjct:  370 PNARALN-GFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVT-NIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKK---GFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDK 630          

HSP 2 Score: 85.1149 bits (209), Expect = 5.457e-17
Identity = 76/273 (27.84%), Postives = 124/273 (45.42%), Query Frame = 2
Query:  416 MNCSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNG-RLQIDSEGMNSLIH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDK 1228
            ++C+ ++  + V +LL     E   P +  +  G + L +A + + +  V  LL+  A V+  T D LTALH +A      + KLLL K A+PN    +  + PLH+AC++       I  +    K G  +Q  +E   + IH A  +G +     LL+  A   +   R   G+TA H A R   ++ ++ L    A +D +    QT LHI        IV+ L  + A  +       TPLHI+A +G   +   L++    +  A  K
Sbjct:  282 LHCAARSGHDQVVELLL----ERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPN-ARALNGFTPLHIACKKN-----RIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIR---GETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKK 541          

HSP 3 Score: 83.9593 bits (206), Expect = 1.192e-16
Identity = 82/288 (28.47%), Postives = 124/288 (43.06%), Query Frame = 2
Query:  458 LLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADI------------------QMNKKRKL------------NGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            LL Q      + NI+    GET L +A +  ++ +V  LL  GA V+++ ++  T LH +++  K EIV+LLL   A P+       Y PLH++ R       + S LL+A     L    +G   L  A + G++  AK LL++ A                    QM     L             G T  H A +    D + LL D  A I +    G T LH+  +E+  N+   L  + A  +    +  TPL +A   G  K+V FL+ K   NV A+ K+
Sbjct:  428 LLLQNGASPDVTNIR----GETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAA-TTNGYTPLHISAREG--QVDVASVLLEAGAAHSLAT-KKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLL-KQGANVNAKTKN 706          

HSP 4 Score: 83.5741 bits (205), Expect = 1.936e-16
Identity = 69/229 (30.13%), Postives = 108/229 (47.16%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSL--IH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
            G T L +A K     +V  LL+ G  +++KT+DGLT LH +A+   +++V+LLL + A P +        PLH+A +      G     +K     +  +D   ++ L  +H A   G     K LL+K A+      R LNG T  H AC++  +  ++LL    A I      G T +H+       NIV  L    AS ++ +    T LH+AA  G  ++V  L+
Sbjct:  245 GITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGA-PLLARTKNGLSPLHMAAQ------GDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRAN---PNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLL 463          

HSP 5 Score: 78.9518 bits (193), Expect = 5.900e-15
Identity = 69/238 (28.99%), Postives = 112/238 (47.06%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDS--EGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSF--------GQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            G   L LA KE  + +V  LL  G++V+S TK G TALH ++   + E+VK+L+ + A+ N   +   + PL++A +        I  +    +NG  Q  +  +G   L  A++ G       LLE D       K +L    A H A R+ D  +  LL   +   D+Q+          G T LHI     + N+   L +  A+ +       TPLH+A+++G T +V+ L+D+
Sbjct:   43 GLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANIN-AQSQNGFTPLYMAAQEN-----HIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDT----KGKVRL---PALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDR 267          

HSP 6 Score: 70.8626 bits (172), Expect = 1.892e-12
Identity = 77/307 (25.08%), Postives = 123/307 (40.07%), Query Frame = 2
Query:  422 CSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQ-------IDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIV---------------------------------KYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFAR 1222
             S+  +   V+ L+++ +  N+      S  G T L +A +EN + +V  LLE GAN ++ T+DG T L  + +    + V +LL  +    +     +   LH+A R+       +  LL+   N  +Q           G   L  A   G V  A  LL + A +    +   NG T  H A +R + + +KLL D    ID +   G T LH       + +V                                 K+L  +KA  + V     T LH+AA  G  ++ + L+DK + N  AR
Sbjct:   83 ASLAGQAEVVKVLVKEGANINA-----QSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKV-----RLPALHIAARKDDTKSAAL--LLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTAR---NGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDK-RANPNAR 373          

HSP 7 Score: 55.0694 bits (131), Expect = 1.947e-7
Identity = 29/68 (42.65%), Postives = 44/68 (64.71%), Query Frame = 2
Query:  500 KDSNT--GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPN 697
            +D++T  G T L++AC    + +V+ LL+ GANVN+KTK+G T LH +A+     I+ +LL   A PN
Sbjct:  667 QDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPN 734          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 101.293 bits (251), Expect = 2.955e-22
Identity = 83/266 (31.20%), Postives = 121/266 (45.49%), Query Frame = 2
Query:  491 PNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACR---------------------RTIPPPGLISALLKATKNGRLQID---------SEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            PN +  N G T L +ACK+N++ +++ L++ GA++ + T+ GLT +H +A      IV LLL   A P++  NI     LH+A R                     R    P  I++ L  T+  +L +          + G   L  +   G V  A  LLE  A   +  K+   G T  H A +   LD  KLL    A  D     G T LHI  ++N   I   L +Y A  NIV     TPLH+A+++G T +V  L+DK
Sbjct:  370 PNARALN-GFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVT-NIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKK---GFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDK 630          

HSP 2 Score: 85.1149 bits (209), Expect = 5.900e-17
Identity = 76/273 (27.84%), Postives = 124/273 (45.42%), Query Frame = 2
Query:  416 MNCSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNG-RLQIDSEGMNSLIH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDK 1228
            ++C+ ++  + V +LL     E   P +  +  G + L +A + + +  V  LL+  A V+  T D LTALH +A      + KLLL K A+PN    +  + PLH+AC++       I  +    K G  +Q  +E   + IH A  +G +     LL+  A   +   R   G+TA H A R   ++ ++ L    A +D +    QT LHI        IV+ L  + A  +       TPLHI+A +G   +   L++    +  A  K
Sbjct:  282 LHCAARSGHDQVVELLL----ERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPN-ARALNGFTPLHIACKKN-----RIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIR---GETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKK 541          

HSP 3 Score: 83.9593 bits (206), Expect = 1.348e-16
Identity = 82/288 (28.47%), Postives = 124/288 (43.06%), Query Frame = 2
Query:  458 LLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADI------------------QMNKKRKL------------NGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            LL Q      + NI+    GET L +A +  ++ +V  LL  GA V+++ ++  T LH +++  K EIV+LLL   A P+       Y PLH++ R       + S LL+A     L    +G   L  A + G++  AK LL++ A                    QM     L             G T  H A +    D + LL D  A I +    G T LH+  +E+  N+   L  + A  +    +  TPL +A   G  K+V FL+ K   NV A+ K+
Sbjct:  428 LLLQNGASPDVTNIR----GETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAA-TTNGYTPLHISAREG--QVDVASVLLEAGAAHSLAT-KKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLL-KQGANVNAKTKN 706          

HSP 4 Score: 83.1889 bits (204), Expect = 2.073e-16
Identity = 69/229 (30.13%), Postives = 108/229 (47.16%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSL--IH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
            G T L +A K     +V  LL+ G  +++KT+DGLT LH +A+   +++V+LLL + A P +        PLH+A +      G     +K     +  +D   ++ L  +H A   G     K LL+K A+      R LNG T  H AC++  +  ++LL    A I      G T +H+       NIV  L    AS ++ +    T LH+AA  G  ++V  L+
Sbjct:  245 GITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGA-PLLARTKNGLSPLHMAAQ------GDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRAN---PNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLL 463          

HSP 5 Score: 78.9518 bits (193), Expect = 6.261e-15
Identity = 69/238 (28.99%), Postives = 112/238 (47.06%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDS--EGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSF--------GQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            G   L LA KE  + +V  LL  G++V+S TK G TALH ++   + E+VK+L+ + A+ N   +   + PL++A +        I  +    +NG  Q  +  +G   L  A++ G       LLE D       K +L    A H A R+ D  +  LL   +   D+Q+          G T LHI     + N+   L +  A+ +       TPLH+A+++G T +V+ L+D+
Sbjct:   43 GLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANIN-AQSQNGFTPLYMAAQEN-----HIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDT----KGKVRL---PALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDR 267          

HSP 6 Score: 70.8626 bits (172), Expect = 2.153e-12
Identity = 77/307 (25.08%), Postives = 123/307 (40.07%), Query Frame = 2
Query:  422 CSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQ-------IDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIV---------------------------------KYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFAR 1222
             S+  +   V+ L+++ +  N+      S  G T L +A +EN + +V  LLE GAN ++ T+DG T L  + +    + V +LL  +    +     +   LH+A R+       +  LL+   N  +Q           G   L  A   G V  A  LL + A +    +   NG T  H A +R + + +KLL D    ID +   G T LH       + +V                                 K+L  +KA  + V     T LH+AA  G  ++ + L+DK + N  AR
Sbjct:   83 ASLAGQAEVVKVLVKEGANINA-----QSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKV-----RLPALHIAARKDDTKSAAL--LLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTAR---NGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDK-RANPNAR 373          

HSP 7 Score: 55.0694 bits (131), Expect = 2.024e-7
Identity = 29/68 (42.65%), Postives = 44/68 (64.71%), Query Frame = 2
Query:  500 KDSNT--GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPN 697
            +D++T  G T L++AC    + +V+ LL+ GANVN+KTK+G T LH +A+     I+ +LL   A PN
Sbjct:  667 QDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPN 734          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: trp-4 (TRP (Transient receptor potential) channel family [Source:UniProtKB/TrEMBL;Acc:Q9GRV5])

HSP 1 Score: 137.502 bits (345), Expect = 8.595e-35
Identity = 96/283 (33.92%), Postives = 146/283 (51.59%), Query Frame = 2
Query:  407 SKIMNCSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKL-------LLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAP-IDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            +KI+  + ++EW  VE  +    + +   ++ D N G T  +LA K  K  IVD+++  GA V+  TKDG  A H +A YS  E ++L       LL K A P       K   +H+AC R       I   +    + R+  D +G   +  A + G V   + LL   +D Q  +K   NGDT  H A R  +++A++    A     ++QN  G+T LH   E  D+N++K +   +A ANI D  D+TP+H+AAE+G T +VE LIDKF  ++ AR +D
Sbjct:  320 TKILYFAKRDEWANVESEIETIKRSDF--SMAD-NHGFTAFLLAVKAGKDQIVDKMIRKGARVDYSTKDGRNATHIAAMYSGVETLELILKRYSELLRKGAGPK------KQLAIHVACERKSKKAFPIVKRILEDTDQRMAEDGDGSLPIHLAFKFGNVNIVELLLSGPSDEQ-TRKADGNGDTLLHLAARSGNIEAVRTAIAAGCDNANVQNRVGRTPLHEVAEVGDQNMLKIMFKLRADANIHDKEDKTPVHVAAERGDTSMVESLIDKFGGSIRARTRD 592          

HSP 2 Score: 65.855 bits (159), Expect = 2.819e-11
Identity = 70/258 (27.13%), Postives = 111/258 (43.02%), Query Frame = 2
Query:  458 LLRQFSKENSLPNIKDSNTGETLLMLACK----ENKLVIVDRLLE------LGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGL---ISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
            ++R    EN+   I  S  GET L +A K    E   +I+  L E      L  +VN +T DG TALHY+A+  + +    L     D  + + +  Y  +       +  P L    +A+  A ++G   +    + ++++ I  GAV            I  NK+ K NG +    AC R       +L    A ID+ +  G+T LH+       ++V  L  +KA  N        PLH+AA+ G  K+V  L+
Sbjct:  744 IMRLLLDENADSKI-SSKIGETPLQVAAKSCNFEAASMILKHLSEVLTQEQLKEHVNHRTNDGFTALHYAAEIEQRQ----LHFPGEDAKLVNLLIDYGGM-------VEMPSLNANETAMHMAARSGNQAV----LLAMVNKIGAGAV-----------QIVQNKQSK-NGWSPLLEACARGHSGVANILLKHHARIDVFDEMGRTALHLAAFNGHLSLVHLLLQHKAFVNSKSKTGEAPLHLAAQHGHVKVVNVLV 973          

HSP 3 Score: 55.8398 bits (133), Expect = 4.679e-8
Identity = 64/252 (25.40%), Postives = 99/252 (39.29%), Query Frame = 2
Query:  443 NTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGA-NVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFH-TACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
            N VE LL   S E +    K    G+TLL LA +   +  V   +  G  N N + + G T LH  A+   + ++K++    AD NI D   K  P+H+A  R                      D+  + SLI     G++                + R  +G T  H  AC      A+  L     P+ + N  G  GLH        ++VK L +   + ++    + T LH+A + G   +VE L+
Sbjct:  471 NIVELLLSGPSDEQTR---KADGNGDTLLHLAARSGNIEAVRTAIAAGCDNANVQNRVGRTPLHEVAEVGDQNMLKIMFKLRADANIHDKEDKT-PVHVAAERG---------------------DTSMVESLIDKFG-GSI----------------RARTRDGSTLLHIAACSGHTSTALAFLKRG-VPLFMPNKKGALGLHSAAAAGFNDVVKMLIARGTNVDVRTRDNYTALHVAVQSGKASVVETLL 679          

HSP 4 Score: 55.0694 bits (131), Expect = 7.678e-8
Identity = 64/283 (22.61%), Postives = 113/283 (39.93%), Query Frame = 2
Query:  518 ETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLS-KNADPNICDNI--TKYYPLHLACRR----------TIPPPGLISALLKATKNGRLQIDSEGMNSLI-------------------HAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLD-------AIKLLCDAEAPI-------DIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVD-NMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARD 1225
            +T L  A K  +L +   LL LGAN N++   G T LH +A+    ++VKL L  +N + ++   I    +   H+A  +           I  P +I A  K  +   L + + G ++ I                    A+ +GA      +LE    I   +  +  G  A H A    + D        ++    +E PI       +    +G T LH+  +   +++V+ L +     +     M+  PLH+AA++G   +V  L+ +      A+D
Sbjct:  988 QTALHFAAKFGQLAVSQTLLALGANPNARDDKGQTPLHLAAENDFPDVVKLFLKMRNNNRSVLTAIDHNGFTCAHIAAMKGSLAVVRELMMIDKPMVIQAKTKTLEATTLHMAAAGGHANIVKILLENGANAEDENSHGMTALHLGAKNGFISILEAFDKILWKRCSRKTGLNALHIAAFYGNSDFVNEMLKHVQATVRSEPPIYNHHVNKEFSTEYGFTPLHLAAQSGHDSLVRMLLNQGVQVDATSTTMNVIPLHLAAQQGHIAVVGMLLSRSTQQQHAKD 1270          

HSP 5 Score: 50.447 bits (119), Expect = 2.296e-6
Identity = 63/253 (24.90%), Postives = 106/253 (41.90%), Query Frame = 2
Query:  494 NIKDSNT-GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLL-----SKNADPNICDN------ITKY--YPLHLACRRTIPPPGLISALLKATKNGRLQID--SEGMNSL-IH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            N +D N+ G T L L  K   + I++   ++     S+ K GL ALH +A Y   + V  +L     +  ++P I ++       T+Y   PLHLA +          +L++   N  +Q+D  S  MN + +H A + G +     LL +    Q    +   G T  H A +    + + LL    + I++ +  G TGLH        ++VK      A         + PL  AA     + + FL+ +
Sbjct: 1118 NAEDENSHGMTALHLGAKNGFISILEAFDKILWKRCSR-KTGLNALHIAAFYGNSDFVNEMLKHVQATVRSEPPIYNHHVNKEFSTEYGFTPLHLAAQSGH------DSLVRMLLNQGVQVDATSTTMNVIPLHLAAQQGHIAVVGMLLSRST--QQQHAKDWRGRTPLHLAAQNGHYEMVSLLIAQGSNINVMDQNGWTGLHFATRAGHLSVVKLFIDSSADPLAETKEGKVPLCFAAAHNHIECLRFLLKQ 1361          

HSP 6 Score: 50.447 bits (119), Expect = 2.316e-6
Identity = 54/210 (25.71%), Postives = 85/210 (40.48%), Query Frame = 2
Query:  560 IVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHI----CVEENDENIVKYL------HSYKASANIVDNMDRTPLHIAAE 1159
            +V  L+  G NV+ +T+D  TALH + +  K  +V+ LL   AD ++         LH+A                A+ NG     +E  +  +  ++ G             D+      +++G+T  H A R  + D ++LL D  A   I +  G+T L +    C  E    I+K+L         K   N   N   T LH AAE
Sbjct:  641 VVKMLIARGTNVDVRTRDNYTALHVAVQSGKASVVETLLGSGADIHVKGGELGQTALHIA----------------ASLNG-----AESRDCAMMLLKSGG----------QPDVA-----QMDGETCLHIAARSGNKDIMRLLLDENADSKISSKIGETPLQVAAKSCNFEAASMILKHLSEVLTQEQLKEHVNHRTNDGFTALHYAAE 814          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 88.5817 bits (218), Expect = 1.441e-18
Identity = 80/277 (28.88%), Postives = 128/277 (46.21%), Query Frame = 2
Query:  491 PNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACR---------------------RTIPPPGLISA----------LLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDK 1228
            PN +  N G T L +ACK+N++ +V+ LL+  A + + T+ GLT LH +A      IV  LL + A+P++ + +    PLHLA R                     R +  P  I++          LL+A  N       +  + L  A + G    A  LL+ +AD  +  K+   G T  H A +  +L+ ++LL +   P+DI+     T LH+    N++ +   L    ASA        TPLHIAA+K   +I   L+ +FK +  A+ +
Sbjct:  385 PNSRALN-GFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDV-ETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSN-ATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKK---GFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLL-QFKADPNAKSR 654          

HSP 2 Score: 84.7297 bits (208), Expect = 3.160e-17
Identity = 71/225 (31.56%), Postives = 106/225 (47.11%), Query Frame = 2
Query:  527 LMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSL--IH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
            L +A K  +  + + LL  GA ++S+TKD LT LH +A+   +++V LL+ + A P          PLH+A +      G      +     R  +D   ++ L  +H A   G V  AK LL++ AD      R LNG T  H AC++  +  ++LL    A I+     G T LH+       NIV YL    A+ ++      TPLH+AA    T +V  LI
Sbjct:  264 LHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGA-PISAKTKNGLAPLHMAAQ------GDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSAD---PNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLI 478          

HSP 3 Score: 77.0258 bits (188), Expect = 9.568e-15
Identity = 68/236 (28.81%), Postives = 110/236 (46.61%), Query Frame = 2
Query:  494 NIKDSNT-GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            +I  SN  G   L LA KE    +V  L++  A V++ T+ G TALH ++   +  IV +L+   A+ N+  ++  + PL++A +       ++  LLK   N  L  + +G   L  A++ G       LLE D+      K +L    A H A ++ D  A  LL   E   D+ +  G T LHI      EN+ + L    A+ N     + +PLH+A + G T +   L+ +
Sbjct:   58 DINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNV-QSVNGFTPLYMAAQEN--HEEVVKYLLKHGANQALSTE-DGFTPLAVALQQGHDRVVAVLLENDS----KGKVRL---PALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSR 282          

HSP 4 Score: 76.6406 bits (187), Expect = 1.261e-14
Identity = 68/223 (30.49%), Postives = 99/223 (44.39%), Query Frame = 2
Query:  521 TLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFL 1189
            T L +A   N   +   LLE GA+  +  K+G T LH +AK ++ EI   LL   ADPN   +   + PLHL+ +        IS LL    +      + G+ ++    +   V  A+ L    A+I  N K    G T  H AC    L+ +K L +  A +  +     T LH   ++   N V+YL    AS N      +TPL IA   G+  +VE L
Sbjct:  592 TPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPN-AKSRAGFTPLHLSAQEGHKE---ISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEI--NSKTNA-GYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 5 Score: 75.485 bits (184), Expect = 2.434e-14
Identity = 63/230 (27.39%), Postives = 100/230 (43.48%), Query Frame = 2
Query:  506 SNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLID 1195
            +  G T L LA K   L +V  LLE G  V+ + K+ +T LH +A Y+ +++  LLL   A          Y PLH+A ++            KA  N +      G   L  + + G    +  L+E  +D+        NG TA H   +   +   ++L +  A I+ + + G T LH+       N+VK+L    A          TPLH AA++G    V +L++
Sbjct:  554 TKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAK-NGYTPLHIAAKKNQMEIASTLLQFKADPNAK---SRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKAN---NGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLE 776          

HSP 6 Score: 73.1738 bits (178), Expect = 1.448e-13
Identity = 73/286 (25.52%), Postives = 125/286 (43.71%), Query Frame = 2
Query:  434 NEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITK--YYPLHLACR------------RTIP---------PPGLISALLKATKNGRLQIDS---------EGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLID 1195
            N+ + V  L+R  +K ++      +   +T L +A +     IV  LL+ GAN N+ T+D  + LH +AK  +EE+  +LL  NAD  +   +TK  + PLHLA +            R  P          P  ++A     K   L +++          G   L  A +   +  A  LL+  AD     +    G T  H + +    +   LL +  + +  + + G T +H+C +E+   + + L++  A  N   N   TPLH+A   G   +V+FL++
Sbjct:  469 NQTDVVRVLIRNGAKVDA-----QARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTL---LTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRA---GFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVE 743          

HSP 7 Score: 67.0106 bits (162), Expect = 1.281e-11
Identity = 73/241 (30.29%), Postives = 104/241 (43.15%), Query Frame = 2
Query:  506 SNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITK--YYPLHLACRR--------TIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            S +G T L +A       +   LLE GANVN + +  ++ LH + K+ +  +  LLLS+ A   I D+ TK    PLH A R          +     ISA    TKNG        +  L  A +   V  A+ LL   A +       L   T  H A     +   KLL D  A  + +   G T LHI  ++N   +V+ L  Y+A+         TPLH+AA  G   IV +L+ +
Sbjct:  224 SKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGA---IIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISA---KTKNG--------LAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYL---TPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQ 447          

HSP 8 Score: 49.6766 bits (117), Expect = 3.491e-6
Identity = 34/125 (27.20%), Postives = 56/125 (44.80%), Query Frame = 2
Query:  818 SEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
            +EG  S + A   G +    ELL    DI  +     NG  + H A +    + ++ L   +A +D     G T LHI        IV  L    A+ N+      TPL++AA++   ++V++L+
Sbjct:   31 AEGSASFLRAARAGDLEKVLELLRAGTDINTSNA---NGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLL 152          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 88.5817 bits (218), Expect = 1.441e-18
Identity = 80/277 (28.88%), Postives = 128/277 (46.21%), Query Frame = 2
Query:  491 PNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACR---------------------RTIPPPGLISA----------LLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDK 1228
            PN +  N G T L +ACK+N++ +V+ LL+  A + + T+ GLT LH +A      IV  LL + A+P++ + +    PLHLA R                     R +  P  I++          LL+A  N       +  + L  A + G    A  LL+ +AD  +  K+   G T  H A +  +L+ ++LL +   P+DI+     T LH+    N++ +   L    ASA        TPLHIAA+K   +I   L+ +FK +  A+ +
Sbjct:  385 PNSRALN-GFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDV-ETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSN-ATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKK---GFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLL-QFKADPNAKSR 654          

HSP 2 Score: 84.7297 bits (208), Expect = 3.160e-17
Identity = 71/225 (31.56%), Postives = 106/225 (47.11%), Query Frame = 2
Query:  527 LMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSL--IH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
            L +A K  +  + + LL  GA ++S+TKD LT LH +A+   +++V LL+ + A P          PLH+A +      G      +     R  +D   ++ L  +H A   G V  AK LL++ AD      R LNG T  H AC++  +  ++LL    A I+     G T LH+       NIV YL    A+ ++      TPLH+AA    T +V  LI
Sbjct:  264 LHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGA-PISAKTKNGLAPLHMAAQ------GDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSAD---PNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLI 478          

HSP 3 Score: 77.0258 bits (188), Expect = 9.568e-15
Identity = 68/236 (28.81%), Postives = 110/236 (46.61%), Query Frame = 2
Query:  494 NIKDSNT-GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            +I  SN  G   L LA KE    +V  L++  A V++ T+ G TALH ++   +  IV +L+   A+ N+  ++  + PL++A +       ++  LLK   N  L  + +G   L  A++ G       LLE D+      K +L    A H A ++ D  A  LL   E   D+ +  G T LHI      EN+ + L    A+ N     + +PLH+A + G T +   L+ +
Sbjct:   58 DINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNV-QSVNGFTPLYMAAQEN--HEEVVKYLLKHGANQALSTE-DGFTPLAVALQQGHDRVVAVLLENDS----KGKVRL---PALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSR 282          

HSP 4 Score: 76.6406 bits (187), Expect = 1.261e-14
Identity = 68/223 (30.49%), Postives = 99/223 (44.39%), Query Frame = 2
Query:  521 TLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFL 1189
            T L +A   N   +   LLE GA+  +  K+G T LH +AK ++ EI   LL   ADPN   +   + PLHL+ +        IS LL    +      + G+ ++    +   V  A+ L    A+I  N K    G T  H AC    L+ +K L +  A +  +     T LH   ++   N V+YL    AS N      +TPL IA   G+  +VE L
Sbjct:  592 TPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPN-AKSRAGFTPLHLSAQEGHKE---ISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEI--NSKTNA-GYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 5 Score: 75.485 bits (184), Expect = 2.434e-14
Identity = 63/230 (27.39%), Postives = 100/230 (43.48%), Query Frame = 2
Query:  506 SNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLID 1195
            +  G T L LA K   L +V  LLE G  V+ + K+ +T LH +A Y+ +++  LLL   A          Y PLH+A ++            KA  N +      G   L  + + G    +  L+E  +D+        NG TA H   +   +   ++L +  A I+ + + G T LH+       N+VK+L    A          TPLH AA++G    V +L++
Sbjct:  554 TKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAK-NGYTPLHIAAKKNQMEIASTLLQFKADPNAK---SRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKAN---NGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLE 776          

HSP 6 Score: 73.1738 bits (178), Expect = 1.448e-13
Identity = 73/286 (25.52%), Postives = 125/286 (43.71%), Query Frame = 2
Query:  434 NEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITK--YYPLHLACR------------RTIP---------PPGLISALLKATKNGRLQIDS---------EGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLID 1195
            N+ + V  L+R  +K ++      +   +T L +A +     IV  LL+ GAN N+ T+D  + LH +AK  +EE+  +LL  NAD  +   +TK  + PLHLA +            R  P          P  ++A     K   L +++          G   L  A +   +  A  LL+  AD     +    G T  H + +    +   LL +  + +  + + G T +H+C +E+   + + L++  A  N   N   TPLH+A   G   +V+FL++
Sbjct:  469 NQTDVVRVLIRNGAKVDA-----QARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTL---LTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRA---GFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVE 743          

HSP 7 Score: 67.0106 bits (162), Expect = 1.281e-11
Identity = 73/241 (30.29%), Postives = 104/241 (43.15%), Query Frame = 2
Query:  506 SNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITK--YYPLHLACRR--------TIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            S +G T L +A       +   LLE GANVN + +  ++ LH + K+ +  +  LLLS+ A   I D+ TK    PLH A R          +     ISA    TKNG        +  L  A +   V  A+ LL   A +       L   T  H A     +   KLL D  A  + +   G T LHI  ++N   +V+ L  Y+A+         TPLH+AA  G   IV +L+ +
Sbjct:  224 SKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGA---IIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISA---KTKNG--------LAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYL---TPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQ 447          

HSP 8 Score: 49.6766 bits (117), Expect = 3.491e-6
Identity = 34/125 (27.20%), Postives = 56/125 (44.80%), Query Frame = 2
Query:  818 SEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
            +EG  S + A   G +    ELL    DI  +     NG  + H A +    + ++ L   +A +D     G T LHI        IV  L    A+ N+      TPL++AA++   ++V++L+
Sbjct:   31 AEGSASFLRAARAGDLEKVLELLRAGTDINTSNA---NGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLL 152          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 88.5817 bits (218), Expect = 1.490e-18
Identity = 80/277 (28.88%), Postives = 128/277 (46.21%), Query Frame = 2
Query:  491 PNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACR---------------------RTIPPPGLISA----------LLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDK 1228
            PN +  N G T L +ACK+N++ +V+ LL+  A + + T+ GLT LH +A      IV  LL + A+P++ + +    PLHLA R                     R +  P  I++          LL+A  N       +  + L  A + G    A  LL+ +AD  +  K+   G T  H A +  +L+ ++LL +   P+DI+     T LH+    N++ +   L    ASA        TPLHIAA+K   +I   L+ +FK +  A+ +
Sbjct:  385 PNSRALN-GFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDV-ETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSN-ATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKK---GFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLL-QFKADPNAKSR 654          

HSP 2 Score: 84.7297 bits (208), Expect = 3.152e-17
Identity = 71/225 (31.56%), Postives = 106/225 (47.11%), Query Frame = 2
Query:  527 LMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSL--IH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
            L +A K  +  + + LL  GA ++S+TKD LT LH +A+   +++V LL+ + A P          PLH+A +      G      +     R  +D   ++ L  +H A   G V  AK LL++ AD      R LNG T  H AC++  +  ++LL    A I+     G T LH+       NIV YL    A+ ++      TPLH+AA    T +V  LI
Sbjct:  264 LHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGA-PISAKTKNGLAPLHMAAQ------GDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSAD---PNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLI 478          

HSP 3 Score: 77.0258 bits (188), Expect = 9.545e-15
Identity = 68/236 (28.81%), Postives = 110/236 (46.61%), Query Frame = 2
Query:  494 NIKDSNT-GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            +I  SN  G   L LA KE    +V  L++  A V++ T+ G TALH ++   +  IV +L+   A+ N+  ++  + PL++A +       ++  LLK   N  L  + +G   L  A++ G       LLE D+      K +L    A H A ++ D  A  LL   E   D+ +  G T LHI      EN+ + L    A+ N     + +PLH+A + G T +   L+ +
Sbjct:   58 DINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNV-QSVNGFTPLYMAAQEN--HEEVVKYLLKHGANQALSTE-DGFTPLAVALQQGHDRVVAVLLENDS----KGKVRL---PALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSR 282          

HSP 4 Score: 76.6406 bits (187), Expect = 1.280e-14
Identity = 68/223 (30.49%), Postives = 99/223 (44.39%), Query Frame = 2
Query:  521 TLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFL 1189
            T L +A   N   +   LLE GA+  +  K+G T LH +AK ++ EI   LL   ADPN   +   + PLHL+ +        IS LL    +      + G+ ++    +   V  A+ L    A+I  N K    G T  H AC    L+ +K L +  A +  +     T LH   ++   N V+YL    AS N      +TPL IA   G+  +VE L
Sbjct:  592 TPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPN-AKSRAGFTPLHLSAQEGHKE---ISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEI--NSKTNA-GYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 5 Score: 75.485 bits (184), Expect = 2.364e-14
Identity = 63/230 (27.39%), Postives = 100/230 (43.48%), Query Frame = 2
Query:  506 SNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLID 1195
            +  G T L LA K   L +V  LLE G  V+ + K+ +T LH +A Y+ +++  LLL   A          Y PLH+A ++            KA  N +      G   L  + + G    +  L+E  +D+        NG TA H   +   +   ++L +  A I+ + + G T LH+       N+VK+L    A          TPLH AA++G    V +L++
Sbjct:  554 TKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAK-NGYTPLHIAAKKNQMEIASTLLQFKADPNAK---SRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKAN---NGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLE 776          

HSP 6 Score: 73.1738 bits (178), Expect = 1.406e-13
Identity = 73/286 (25.52%), Postives = 125/286 (43.71%), Query Frame = 2
Query:  434 NEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITK--YYPLHLACR------------RTIP---------PPGLISALLKATKNGRLQIDS---------EGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLID 1195
            N+ + V  L+R  +K ++      +   +T L +A +     IV  LL+ GAN N+ T+D  + LH +AK  +EE+  +LL  NAD  +   +TK  + PLHLA +            R  P          P  ++A     K   L +++          G   L  A +   +  A  LL+  AD     +    G T  H + +    +   LL +  + +  + + G T +H+C +E+   + + L++  A  N   N   TPLH+A   G   +V+FL++
Sbjct:  469 NQTDVVRVLIRNGAKVDA-----QARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTL---LTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRA---GFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVE 743          

HSP 7 Score: 67.0106 bits (162), Expect = 1.301e-11
Identity = 73/241 (30.29%), Postives = 104/241 (43.15%), Query Frame = 2
Query:  506 SNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITK--YYPLHLACRR--------TIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            S +G T L +A       +   LLE GANVN + +  ++ LH + K+ +  +  LLLS+ A   I D+ TK    PLH A R          +     ISA    TKNG        +  L  A +   V  A+ LL   A +       L   T  H A     +   KLL D  A  + +   G T LHI  ++N   +V+ L  Y+A+         TPLH+AA  G   IV +L+ +
Sbjct:  224 SKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGA---IIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISA---KTKNG--------LAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYL---TPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQ 447          

HSP 8 Score: 49.6766 bits (117), Expect = 3.547e-6
Identity = 34/125 (27.20%), Postives = 56/125 (44.80%), Query Frame = 2
Query:  818 SEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
            +EG  S + A   G +    ELL    DI  +     NG  + H A +    + ++ L   +A +D     G T LHI        IV  L    A+ N+      TPL++AA++   ++V++L+
Sbjct:   31 AEGSASFLRAARAGDLEKVLELLRAGTDINTSNA---NGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLL 152          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 88.5817 bits (218), Expect = 1.490e-18
Identity = 80/277 (28.88%), Postives = 128/277 (46.21%), Query Frame = 2
Query:  491 PNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACR---------------------RTIPPPGLISA----------LLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDK 1228
            PN +  N G T L +ACK+N++ +V+ LL+  A + + T+ GLT LH +A      IV  LL + A+P++ + +    PLHLA R                     R +  P  I++          LL+A  N       +  + L  A + G    A  LL+ +AD  +  K+   G T  H A +  +L+ ++LL +   P+DI+     T LH+    N++ +   L    ASA        TPLHIAA+K   +I   L+ +FK +  A+ +
Sbjct:  385 PNSRALN-GFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDV-ETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSN-ATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKK---GFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLL-QFKADPNAKSR 654          

HSP 2 Score: 84.7297 bits (208), Expect = 3.152e-17
Identity = 71/225 (31.56%), Postives = 106/225 (47.11%), Query Frame = 2
Query:  527 LMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSL--IH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
            L +A K  +  + + LL  GA ++S+TKD LT LH +A+   +++V LL+ + A P          PLH+A +      G      +     R  +D   ++ L  +H A   G V  AK LL++ AD      R LNG T  H AC++  +  ++LL    A I+     G T LH+       NIV YL    A+ ++      TPLH+AA    T +V  LI
Sbjct:  264 LHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGA-PISAKTKNGLAPLHMAAQ------GDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSAD---PNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLI 478          

HSP 3 Score: 77.0258 bits (188), Expect = 9.545e-15
Identity = 68/236 (28.81%), Postives = 110/236 (46.61%), Query Frame = 2
Query:  494 NIKDSNT-GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            +I  SN  G   L LA KE    +V  L++  A V++ T+ G TALH ++   +  IV +L+   A+ N+  ++  + PL++A +       ++  LLK   N  L  + +G   L  A++ G       LLE D+      K +L    A H A ++ D  A  LL   E   D+ +  G T LHI      EN+ + L    A+ N     + +PLH+A + G T +   L+ +
Sbjct:   58 DINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNV-QSVNGFTPLYMAAQEN--HEEVVKYLLKHGANQALSTE-DGFTPLAVALQQGHDRVVAVLLENDS----KGKVRL---PALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSR 282          

HSP 4 Score: 76.6406 bits (187), Expect = 1.280e-14
Identity = 68/223 (30.49%), Postives = 99/223 (44.39%), Query Frame = 2
Query:  521 TLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFL 1189
            T L +A   N   +   LLE GA+  +  K+G T LH +AK ++ EI   LL   ADPN   +   + PLHL+ +        IS LL    +      + G+ ++    +   V  A+ L    A+I  N K    G T  H AC    L+ +K L +  A +  +     T LH   ++   N V+YL    AS N      +TPL IA   G+  +VE L
Sbjct:  592 TPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPN-AKSRAGFTPLHLSAQEGHKE---ISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEI--NSKTNA-GYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 5 Score: 75.485 bits (184), Expect = 2.364e-14
Identity = 63/230 (27.39%), Postives = 100/230 (43.48%), Query Frame = 2
Query:  506 SNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLID 1195
            +  G T L LA K   L +V  LLE G  V+ + K+ +T LH +A Y+ +++  LLL   A          Y PLH+A ++            KA  N +      G   L  + + G    +  L+E  +D+        NG TA H   +   +   ++L +  A I+ + + G T LH+       N+VK+L    A          TPLH AA++G    V +L++
Sbjct:  554 TKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAK-NGYTPLHIAAKKNQMEIASTLLQFKADPNAK---SRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKAN---NGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLE 776          

HSP 6 Score: 73.1738 bits (178), Expect = 1.406e-13
Identity = 73/286 (25.52%), Postives = 125/286 (43.71%), Query Frame = 2
Query:  434 NEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITK--YYPLHLACR------------RTIP---------PPGLISALLKATKNGRLQIDS---------EGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLID 1195
            N+ + V  L+R  +K ++      +   +T L +A +     IV  LL+ GAN N+ T+D  + LH +AK  +EE+  +LL  NAD  +   +TK  + PLHLA +            R  P          P  ++A     K   L +++          G   L  A +   +  A  LL+  AD     +    G T  H + +    +   LL +  + +  + + G T +H+C +E+   + + L++  A  N   N   TPLH+A   G   +V+FL++
Sbjct:  469 NQTDVVRVLIRNGAKVDA-----QARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTL---LTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRA---GFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVE 743          

HSP 7 Score: 67.0106 bits (162), Expect = 1.301e-11
Identity = 73/241 (30.29%), Postives = 104/241 (43.15%), Query Frame = 2
Query:  506 SNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITK--YYPLHLACRR--------TIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            S +G T L +A       +   LLE GANVN + +  ++ LH + K+ +  +  LLLS+ A   I D+ TK    PLH A R          +     ISA    TKNG        +  L  A +   V  A+ LL   A +       L   T  H A     +   KLL D  A  + +   G T LHI  ++N   +V+ L  Y+A+         TPLH+AA  G   IV +L+ +
Sbjct:  224 SKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGA---IIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISA---KTKNG--------LAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYL---TPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQ 447          

HSP 8 Score: 49.6766 bits (117), Expect = 3.547e-6
Identity = 34/125 (27.20%), Postives = 56/125 (44.80%), Query Frame = 2
Query:  818 SEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
            +EG  S + A   G +    ELL    DI  +     NG  + H A +    + ++ L   +A +D     G T LHI        IV  L    A+ N+      TPL++AA++   ++V++L+
Sbjct:   31 AEGSASFLRAARAGDLEKVLELLRAGTDINTSNA---NGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLL 152          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: nompC (gene:FBgn0016920 transcript:FBtr0300012)

HSP 1 Score: 213.386 bits (542), Expect = 1.322e-60
Identity = 119/287 (41.46%), Postives = 168/287 (58.54%), Query Frame = 2
Query:  410 KIMNCSMKNEWNTVEQLLRQFSK--------ENSLP--NIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSK-NADPNICDNITKYYPLHL-ACRRTIPPPGLISALLKAT-KNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            K++  +MK+EW  +E  L++  K         N +P   + D NTG T LM A K+NK  I+DR++ELGA+V ++  D    LH +A YS+E++VKLLL+K   DP           +HL + R+T     ++ ALL A  K+ RL+ D  G   L+ A+E G  +  +ELL      Q+ K    NGDTA H A RRRD+D +++L D    +D QN  GQT LHI   E DE ++KY +  +ASA+I DN DRTP+H+AAE G   ++E L DKFK ++F R KD
Sbjct:   82 KVLGLAMKSEWTPIEAELKKLEKYVANVGEDGNHIPLAGVHDMNTGMTPLMYATKDNKTAIMDRMIELGADVGARNNDNYNVLHIAAMYSREDVVKLLLTKRGVDPFSTGGSRSQTAVHLVSSRQTGTATNILRALLAAAGKDIRLKADGRGKIPLLLAVESGNQSMCRELLAAQTAEQL-KATTANGDTALHLAARRRDVDMVRILVDYGTNVDTQNGEGQTPLHIAAAEGDEALLKYFYGVRASASIADNQDRTPMHLAAENGHAHVIEILADKFKASIFERTKD 367          

HSP 2 Score: 73.559 bits (179), Expect = 1.563e-13
Identity = 81/302 (26.82%), Postives = 125/302 (41.39%), Query Frame = 2
Query:  506 SNTGETLLMLACKENKLVIVDRLLEL----------GANVNSKTKDGLTALHYSAKYSKEE---------IVKLLLSKNADPNI------------C---------------------------DNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQI-DSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLC-DAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            SNTGET L +AC+     IV  L+E              +NS  +DG TALHY+ + +KEE         IV++LL   AD  +            C                            +   + PL +AC R      L++ LL    + R+ + D+EG ++L  A E G +     LL   A I  N K ++ G TA H A        +K L  D  A IDI     QT LH+        + + L    A+ +  D++ + P+H+AA+  ++++ +  + +    V A  KD
Sbjct:  532 SNTGETPLHMACRACHPDIVRHLIETVKEKHGPDKATTYINSVNEDGATALHYTCQITKEEVKIPESDKQIVRMLLENGADVTLQTKTALETAFHYCAVAGNNDVLMEMISHMNPTDIQKAMNRQSSVGWTPLLIACHRGHME--LVNNLL--ANHARVDVFDTEGRSALHLAAERGYLHVCDALLTNKAFI--NSKSRV-GRTALHLAAMNGFTHLVKFLIKDHNAVIDILTLRKQTPLHLAAASGQMEVCQLLLELGANIDATDDLGQKPIHVAAQNNYSEVAKLFLQQHPSLVNATSKD 826          

HSP 3 Score: 68.5514 bits (166), Expect = 5.903e-12
Identity = 68/269 (25.28%), Postives = 117/269 (43.49%), Query Frame = 2
Query:  422 CSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLAC--------RRTIPPPGLISALLKA-TKNGRLQIDSEGMNSLIHAIEVGAVTTAK---ELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPI-DIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFL 1189
             +M+     +E+L++ F +   + + ++  T  T L LA +     +V  L+  GA+   + K G TA+H +A+    +++ +L S N+   I        PLH+A         R  +     + A +K+ T  G+      G  S +  + + A +  +    LL   A +Q++     NG    H AC    +  + LL    A +   Q+  G+TGLHI        +V+ L    A  N  D    TPLH AA+ G  ++V+ L
Sbjct:  834 AAMQGSVKVIEELMK-FDRSGVI-SARNKLTDATPLQLAAEGGHADVVKALVRAGASCTEENKAGFTAVHLAAQNGHGQVLDVLKSTNS-LRINSKKLGLTPLHVAAYYGQADTVRELLTS---VPATVKSETPTGQSLFGDLGTESGMTPLHLAAFSGNENVVRLLLNSAGVQVDAATIENGYNPLHLACFGGHMSVVGLLLSRSAELLQSQDRNGRTGLHIAAMHGHIQMVEILLGQGAEINATDRNGWTPLHCAAKAGHLEVVKLL 1096          

HSP 4 Score: 68.1662 bits (165), Expect = 6.390e-12
Identity = 61/222 (27.48%), Postives = 98/222 (44.14%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRT------IPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEV-GAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDR-TPLHIAA 1156
            G+T L LA +   + +V  L++ G NV+++  +G T LH +A    E ++K      A  +I DN  +  P+HLA          I      +++ + TK+G         ++L+H   + G    A  L +K   + M  K   +G  + HTA        I  L      +D+  +   T LHI VE     +V+ L  + A  ++     R TPLHIAA
Sbjct:  268 GDTALHLAARRRDVDMVRILVDYGTNVDTQNGEGQTPLHIAAAEGDEALLKYFYGVRASASIADNQDRT-PMHLAAENGHAHVIEILADKFKASIFERTKDG---------STLMHIASLNGHAECATMLFKKGVYLHMPNK---DGARSIHTAAAYGHTGIINTLLQKGEKVDVTTNDNYTALHIAVESAKPAVVETLLGFGADVHVRGGKLRETPLHIAA 476          

HSP 5 Score: 63.5438 bits (153), Expect = 2.183e-10
Identity = 50/171 (29.24%), Postives = 81/171 (47.37%), Query Frame = 2
Query:  605 TKDGLTALHYSAKYSKEEIVKLLLSK---NADPNICDNITKYYPLHLACRRT-IPPPGLI----SALLKAT-KNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYL 1090
            T+ G+T LH +A    E +V+LLL+      D    +N   Y PLHLAC    +   GL+    + LL++  +NGR  +    M+  I  +E+        LL + A+I    +   NG T  H A +   L+ +KLLC+A A    + ++G   +     E    +++YL
Sbjct:  972 TESGMTPLHLAAFSGNENVVRLLLNSAGVQVDAATIEN--GYNPLHLACFGGHMSVVGLLLSRSAELLQSQDRNGRTGLHIAAMHGHIQMVEI--------LLGQGAEINATDR---NGWTPLHCAAKAGHLEVVKLLCEAGASPKSETNYGCAAIWFAASEGHNEVLRYL 1129          

HSP 6 Score: 56.6102 bits (135), Expect = 3.417e-8
Identity = 56/233 (24.03%), Postives = 93/233 (39.91%), Query Frame = 2
Query:  518 ETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNV 1213
            +T L LA    ++ +   LLELGAN+++    G   +H +A+ +  E+ KL L ++                         P L++A    +K+G         N+  H A   G+V   +EL++ D    ++ + KL   T    A      D +K L  A A    +N  G T +H+  +     ++  L S  +       +  TPLH+AA  G    V  L+      V
Sbjct:  761 QTPLHLAAASGQMEVCQLLLELGANIDATDDLGQKPIHVAAQNNYSEVAKLFLQQH-------------------------PSLVNA---TSKDG---------NTCAHIAAMQGSVKVIEELMKFDRSGVISARNKLTDATPLQLAAEGGHADVVKALVRAGASCTEENKAGFTAVHLAAQNGHGQVLDVLKSTNSLRINSKKLGLTPLHVAAYYGQADTVRELLTSVPATV 956          

HSP 7 Score: 53.9138 bits (128), Expect = 2.414e-7
Identity = 53/197 (26.90%), Postives = 85/197 (43.15%), Query Frame = 2
Query:  560 IVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCD----------AEAPIDIQNSFGQTGLH---------ICVEENDENIVKYL 1090
            I++ LL+ G  V+  T D  TALH + + +K  +V+ LL   AD ++     +  PLH+A R      G   AL+         + ++   + +H A   G + T  +LLE + D          G+T  H ACR    D ++ L +          A   I+  N  G T LH         + + E+D+ IV+ L
Sbjct:  416 IINTLLQKGEKVDVTTNDNYTALHIAVESAKPAVVETLLGFGADVHVRGGKLRETPLHIAARVK---DGDRCALMLLKSGASPNLTTDDCLTPVHVAARHGNLATLMQLLEDEGDPLYKSN---TGETPLHMACRACHPDIVRHLIETVKEKHGPDKATTYINSVNEDGATALHYTCQITKEEVKIPESDKQIVRML 606          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: nompC (gene:FBgn0016920 transcript:FBtr0304843)

HSP 1 Score: 213.386 bits (542), Expect = 1.349e-60
Identity = 119/287 (41.46%), Postives = 168/287 (58.54%), Query Frame = 2
Query:  410 KIMNCSMKNEWNTVEQLLRQFSK--------ENSLP--NIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSK-NADPNICDNITKYYPLHL-ACRRTIPPPGLISALLKAT-KNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            K++  +MK+EW  +E  L++  K         N +P   + D NTG T LM A K+NK  I+DR++ELGA+V ++  D    LH +A YS+E++VKLLL+K   DP           +HL + R+T     ++ ALL A  K+ RL+ D  G   L+ A+E G  +  +ELL      Q+ K    NGDTA H A RRRD+D +++L D    +D QN  GQT LHI   E DE ++KY +  +ASA+I DN DRTP+H+AAE G   ++E L DKFK ++F R KD
Sbjct:   82 KVLGLAMKSEWTPIEAELKKLEKYVANVGEDGNHIPLAGVHDMNTGMTPLMYATKDNKTAIMDRMIELGADVGARNNDNYNVLHIAAMYSREDVVKLLLTKRGVDPFSTGGSRSQTAVHLVSSRQTGTATNILRALLAAAGKDIRLKADGRGKIPLLLAVESGNQSMCRELLAAQTAEQL-KATTANGDTALHLAARRRDVDMVRILVDYGTNVDTQNGEGQTPLHIAAAEGDEALLKYFYGVRASASIADNQDRTPMHLAAENGHAHVIEILADKFKASIFERTKD 367          

HSP 2 Score: 73.559 bits (179), Expect = 1.551e-13
Identity = 81/302 (26.82%), Postives = 125/302 (41.39%), Query Frame = 2
Query:  506 SNTGETLLMLACKENKLVIVDRLLEL----------GANVNSKTKDGLTALHYSAKYSKEE---------IVKLLLSKNADPNI------------C---------------------------DNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQI-DSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLC-DAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            SNTGET L +AC+     IV  L+E              +NS  +DG TALHY+ + +KEE         IV++LL   AD  +            C                            +   + PL +AC R      L++ LL    + R+ + D+EG ++L  A E G +     LL   A I  N K ++ G TA H A        +K L  D  A IDI     QT LH+        + + L    A+ +  D++ + P+H+AA+  ++++ +  + +    V A  KD
Sbjct:  532 SNTGETPLHMACRACHPDIVRHLIETVKEKHGPDKATTYINSVNEDGATALHYTCQITKEEVKIPESDKQIVRMLLENGADVTLQTKTALETAFHYCAVAGNNDVLMEMISHMNPTDIQKAMNRQSSVGWTPLLIACHRGHME--LVNNLL--ANHARVDVFDTEGRSALHLAAERGYLHVCDALLTNKAFI--NSKSRV-GRTALHLAAMNGFTHLVKFLIKDHNAVIDILTLRKQTPLHLAAASGQMEVCQLLLELGANIDATDDLGQKPIHVAAQNNYSEVAKLFLQQHPSLVNATSKD 826          

HSP 3 Score: 68.5514 bits (166), Expect = 6.338e-12
Identity = 68/269 (25.28%), Postives = 117/269 (43.49%), Query Frame = 2
Query:  422 CSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLAC--------RRTIPPPGLISALLKA-TKNGRLQIDSEGMNSLIHAIEVGAVTTAK---ELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPI-DIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFL 1189
             +M+     +E+L++ F +   + + ++  T  T L LA +     +V  L+  GA+   + K G TA+H +A+    +++ +L S N+   I        PLH+A         R  +     + A +K+ T  G+      G  S +  + + A +  +    LL   A +Q++     NG    H AC    +  + LL    A +   Q+  G+TGLHI        +V+ L    A  N  D    TPLH AA+ G  ++V+ L
Sbjct:  834 AAMQGSVKVIEELMK-FDRSGVI-SARNKLTDATPLQLAAEGGHADVVKALVRAGASCTEENKAGFTAVHLAAQNGHGQVLDVLKSTNS-LRINSKKLGLTPLHVAAYYGQADTVRELLTS---VPATVKSETPTGQSLFGDLGTESGMTPLHLAAFSGNENVVRLLLNSAGVQVDAATIENGYNPLHLACFGGHMSVVGLLLSRSAELLQSQDRNGRTGLHIAAMHGHIQMVEILLGQGAEINATDRNGWTPLHCAAKAGHLEVVKLL 1096          

HSP 4 Score: 68.1662 bits (165), Expect = 6.394e-12
Identity = 60/222 (27.03%), Postives = 98/222 (44.14%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRT------IPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEV-GAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDN-MDRTPLHIAA 1156
            G+T L LA +   + +V  L++ G NV+++  +G T LH +A    E ++K      A  +I DN  +  P+HLA          I      +++ + TK+G         ++L+H   + G    A  L +K   + M  K   +G  + HTA        I  L      +D+  +   T LHI VE     +V+ L  + A  ++    +  TPLHIAA
Sbjct:  268 GDTALHLAARRRDVDMVRILVDYGTNVDTQNGEGQTPLHIAAAEGDEALLKYFYGVRASASIADNQDRT-PMHLAAENGHAHVIEILADKFKASIFERTKDG---------STLMHIASLNGHAECATMLFKKGVYLHMPNK---DGARSIHTAAAYGHTGIINTLLQKGEKVDVTTNDNYTALHIAVESAKPAVVETLLGFGADVHVRGGKLRETPLHIAA 476          

HSP 5 Score: 63.5438 bits (153), Expect = 2.302e-10
Identity = 50/171 (29.24%), Postives = 81/171 (47.37%), Query Frame = 2
Query:  605 TKDGLTALHYSAKYSKEEIVKLLLSK---NADPNICDNITKYYPLHLACRRT-IPPPGLI----SALLKAT-KNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYL 1090
            T+ G+T LH +A    E +V+LLL+      D    +N   Y PLHLAC    +   GL+    + LL++  +NGR  +    M+  I  +E+        LL + A+I    +   NG T  H A +   L+ +KLLC+A A    + ++G   +     E    +++YL
Sbjct:  972 TESGMTPLHLAAFSGNENVVRLLLNSAGVQVDAATIEN--GYNPLHLACFGGHMSVVGLLLSRSAELLQSQDRNGRTGLHIAAMHGHIQMVEI--------LLGQGAEINATDR---NGWTPLHCAAKAGHLEVVKLLCEAGASPKSETNYGCAAIWFAASEGHNEVLRYL 1129          

HSP 6 Score: 56.6102 bits (135), Expect = 3.634e-8
Identity = 56/233 (24.03%), Postives = 93/233 (39.91%), Query Frame = 2
Query:  518 ETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNV 1213
            +T L LA    ++ +   LLELGAN+++    G   +H +A+ +  E+ KL L ++                         P L++A    +K+G         N+  H A   G+V   +EL++ D    ++ + KL   T    A      D +K L  A A    +N  G T +H+  +     ++  L S  +       +  TPLH+AA  G    V  L+      V
Sbjct:  761 QTPLHLAAASGQMEVCQLLLELGANIDATDDLGQKPIHVAAQNNYSEVAKLFLQQH-------------------------PSLVNA---TSKDG---------NTCAHIAAMQGSVKVIEELMKFDRSGVISARNKLTDATPLQLAAEGGHADVVKALVRAGASCTEENKAGFTAVHLAAQNGHGQVLDVLKSTNSLRINSKKLGLTPLHVAAYYGQADTVRELLTSVPATV 956          

HSP 7 Score: 53.9138 bits (128), Expect = 2.566e-7
Identity = 53/197 (26.90%), Postives = 85/197 (43.15%), Query Frame = 2
Query:  560 IVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCD----------AEAPIDIQNSFGQTGLH---------ICVEENDENIVKYL 1090
            I++ LL+ G  V+  T D  TALH + + +K  +V+ LL   AD ++     +  PLH+A R      G   AL+         + ++   + +H A   G + T  +LLE + D          G+T  H ACR    D ++ L +          A   I+  N  G T LH         + + E+D+ IV+ L
Sbjct:  416 IINTLLQKGEKVDVTTNDNYTALHIAVESAKPAVVETLLGFGADVHVRGGKLRETPLHIAARVK---DGDRCALMLLKSGASPNLTTDDCLTPVHVAARHGNLATLMQLLEDEGDPLYKSN---TGETPLHMACRACHPDIVRHLIETVKEKHGPDKATTYINSVNEDGATALHYTCQITKEEVKIPESDKQIVRML 606          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: nompC (gene:FBgn0016920 transcript:FBtr0343224)

HSP 1 Score: 213.386 bits (542), Expect = 1.375e-60
Identity = 119/287 (41.46%), Postives = 168/287 (58.54%), Query Frame = 2
Query:  410 KIMNCSMKNEWNTVEQLLRQFSK--------ENSLP--NIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSK-NADPNICDNITKYYPLHL-ACRRTIPPPGLISALLKAT-KNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            K++  +MK+EW  +E  L++  K         N +P   + D NTG T LM A K+NK  I+DR++ELGA+V ++  D    LH +A YS+E++VKLLL+K   DP           +HL + R+T     ++ ALL A  K+ RL+ D  G   L+ A+E G  +  +ELL      Q+ K    NGDTA H A RRRD+D +++L D    +D QN  GQT LHI   E DE ++KY +  +ASA+I DN DRTP+H+AAE G   ++E L DKFK ++F R KD
Sbjct:   82 KVLGLAMKSEWTPIEAELKKLEKYVANVGEDGNHIPLAGVHDMNTGMTPLMYATKDNKTAIMDRMIELGADVGARNNDNYNVLHIAAMYSREDVVKLLLTKRGVDPFSTGGSRSQTAVHLVSSRQTGTATNILRALLAAAGKDIRLKADGRGKIPLLLAVESGNQSMCRELLAAQTAEQL-KATTANGDTALHLAARRRDVDMVRILVDYGTNVDTQNGEGQTPLHIAAAEGDEALLKYFYGVRASASIADNQDRTPMHLAAENGHAHVIEILADKFKASIFERTKD 367          

HSP 2 Score: 73.1738 bits (178), Expect = 1.665e-13
Identity = 81/302 (26.82%), Postives = 125/302 (41.39%), Query Frame = 2
Query:  506 SNTGETLLMLACKENKLVIVDRLLEL----------GANVNSKTKDGLTALHYSAKYSKEE---------IVKLLLSKNADPNI------------C---------------------------DNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQI-DSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLC-DAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            SNTGET L +AC+     IV  L+E              +NS  +DG TALHY+ + +KEE         IV++LL   AD  +            C                            +   + PL +AC R      L++ LL    + R+ + D+EG ++L  A E G +     LL   A I  N K ++ G TA H A        +K L  D  A IDI     QT LH+        + + L    A+ +  D++ + P+H+AA+  ++++ +  + +    V A  KD
Sbjct:  532 SNTGETPLHMACRACHPDIVRHLIETVKEKHGPDKATTYINSVNEDGATALHYTCQITKEEVKIPESDKQIVRMLLENGADVTLQTKTALETAFHYCAVAGNNDVLMEMISHMNPTDIQKAMNRQSSVGWTPLLIACHRGHME--LVNNLL--ANHARVDVFDTEGRSALHLAAERGYLHVCDALLTNKAFI--NSKSRV-GRTALHLAAMNGFTHLVKFLIKDHNAVIDILTLRKQTPLHLAAASGQMEVCQLLLELGANIDATDDLGQKPIHVAAQNNYSEVAKLFLQQHPSLVNATSKD 826          

HSP 3 Score: 68.5514 bits (166), Expect = 6.174e-12
Identity = 68/269 (25.28%), Postives = 117/269 (43.49%), Query Frame = 2
Query:  422 CSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLAC--------RRTIPPPGLISALLKA-TKNGRLQIDSEGMNSLIHAIEVGAVTTAK---ELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPI-DIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFL 1189
             +M+     +E+L++ F +   + + ++  T  T L LA +     +V  L+  GA+   + K G TA+H +A+    +++ +L S N+   I        PLH+A         R  +     + A +K+ T  G+      G  S +  + + A +  +    LL   A +Q++     NG    H AC    +  + LL    A +   Q+  G+TGLHI        +V+ L    A  N  D    TPLH AA+ G  ++V+ L
Sbjct:  834 AAMQGSVKVIEELMK-FDRSGVI-SARNKLTDATPLQLAAEGGHADVVKALVRAGASCTEENKAGFTAVHLAAQNGHGQVLDVLKSTNS-LRINSKKLGLTPLHVAAYYGQADTVRELLTS---VPATVKSETPTGQSLFGDLGTESGMTPLHLAAFSGNENVVRLLLNSAGVQVDAATIENGYNPLHLACFGGHMSVVGLLLSRSAELLQSQDRNGRTGLHIAAMHGHIQMVEILLGQGAEINATDRNGWTPLHCAAKAGHLEVVKLL 1096          

HSP 4 Score: 68.1662 bits (165), Expect = 6.625e-12
Identity = 61/222 (27.48%), Postives = 98/222 (44.14%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRT------IPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEV-GAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDR-TPLHIAA 1156
            G+T L LA +   + +V  L++ G NV+++  +G T LH +A    E ++K      A  +I DN  +  P+HLA          I      +++ + TK+G         ++L+H   + G    A  L +K   + M  K   +G  + HTA        I  L      +D+  +   T LHI VE     +V+ L  + A  ++     R TPLHIAA
Sbjct:  268 GDTALHLAARRRDVDMVRILVDYGTNVDTQNGEGQTPLHIAAAEGDEALLKYFYGVRASASIADNQDRT-PMHLAAENGHAHVIEILADKFKASIFERTKDG---------STLMHIASLNGHAECATMLFKKGVYLHMPNK---DGARSIHTAAAYGHTGIINTLLQKGEKVDVTTNDNYTALHIAVESAKPAVVETLLGFGADVHVRGGKLRETPLHIAA 476          

HSP 5 Score: 63.5438 bits (153), Expect = 2.242e-10
Identity = 50/171 (29.24%), Postives = 81/171 (47.37%), Query Frame = 2
Query:  605 TKDGLTALHYSAKYSKEEIVKLLLSK---NADPNICDNITKYYPLHLACRRT-IPPPGLI----SALLKAT-KNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYL 1090
            T+ G+T LH +A    E +V+LLL+      D    +N   Y PLHLAC    +   GL+    + LL++  +NGR  +    M+  I  +E+        LL + A+I    +   NG T  H A +   L+ +KLLC+A A    + ++G   +     E    +++YL
Sbjct:  972 TESGMTPLHLAAFSGNENVVRLLLNSAGVQVDAATIEN--GYNPLHLACFGGHMSVVGLLLSRSAELLQSQDRNGRTGLHIAAMHGHIQMVEI--------LLGQGAEINATDR---NGWTPLHCAAKAGHLEVVKLLCEAGASPKSETNYGCAAIWFAASEGHNEVLRYL 1129          

HSP 6 Score: 56.225 bits (134), Expect = 3.763e-8
Identity = 56/233 (24.03%), Postives = 93/233 (39.91%), Query Frame = 2
Query:  518 ETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNV 1213
            +T L LA    ++ +   LLELGAN+++    G   +H +A+ +  E+ KL L ++                         P L++A    +K+G         N+  H A   G+V   +EL++ D    ++ + KL   T    A      D +K L  A A    +N  G T +H+  +     ++  L S  +       +  TPLH+AA  G    V  L+      V
Sbjct:  761 QTPLHLAAASGQMEVCQLLLELGANIDATDDLGQKPIHVAAQNNYSEVAKLFLQQH-------------------------PSLVNA---TSKDG---------NTCAHIAAMQGSVKVIEELMKFDRSGVISARNKLTDATPLQLAAEGGHADVVKALVRAGASCTEENKAGFTAVHLAAQNGHGQVLDVLKSTNSLRINSKKLGLTPLHVAAYYGQADTVRELLTSVPATV 956          

HSP 7 Score: 53.5286 bits (127), Expect = 2.751e-7
Identity = 53/197 (26.90%), Postives = 85/197 (43.15%), Query Frame = 2
Query:  560 IVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCD----------AEAPIDIQNSFGQTGLH---------ICVEENDENIVKYL 1090
            I++ LL+ G  V+  T D  TALH + + +K  +V+ LL   AD ++     +  PLH+A R      G   AL+         + ++   + +H A   G + T  +LLE + D          G+T  H ACR    D ++ L +          A   I+  N  G T LH         + + E+D+ IV+ L
Sbjct:  416 IINTLLQKGEKVDVTTNDNYTALHIAVESAKPAVVETLLGFGADVHVRGGKLRETPLHIAARVK---DGDRCALMLLKSGASPNLTTDDCLTPVHVAARHGNLATLMQLLEDEGDPLYKSN---TGETPLHMACRACHPDIVRHLIETVKEKHGPDKATTYINSVNEDGATALHYTCQITKEEVKIPESDKQIVRML 606          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: nompC (gene:FBgn0016920 transcript:FBtr0347409)

HSP 1 Score: 213.001 bits (541), Expect = 1.670e-60
Identity = 119/287 (41.46%), Postives = 168/287 (58.54%), Query Frame = 2
Query:  410 KIMNCSMKNEWNTVEQLLRQFSK--------ENSLP--NIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNA-DPNICDNITKYYPLHL-ACRRTIPPPGLISALLKAT-KNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            K++  +MK+EW  +E  L++  K         N +P   + D NTG T LM A K+NK  I+DR++ELGA+V ++  D    LH +A YS+E++VKLLL+K   DP           +HL + R+T     ++ ALL A  K+ RL+ D  G   L+ A+E G  +  +ELL      Q+ K    NGDTA H A RRRD+D +++L D    +D QN  GQT LHI   E DE ++KY +  +ASA+I DN DRTP+H+AAE G   ++E L DKFK ++F R KD
Sbjct:   82 KVLGLAMKSEWTPIEAELKKLEKYVANVGEDGNHIPLAGVHDMNTGMTPLMYATKDNKTAIMDRMIELGADVGARNNDNYNVLHIAAMYSREDVVKLLLTKRGVDPFSTGGSRSQTAVHLVSSRQTGTATNILRALLAAAGKDIRLKADGRGKIPLLLAVESGNQSMCRELLAAQTAEQL-KATTANGDTALHLAARRRDVDMVRILVDYGTNVDTQNGEGQTPLHIAAAEGDEALLKYFYGVRASASIADNQDRTPMHLAAENGHAHVIEILADKFKASIFERTKD 367          

HSP 2 Score: 73.1738 bits (178), Expect = 1.856e-13
Identity = 81/302 (26.82%), Postives = 125/302 (41.39%), Query Frame = 2
Query:  506 SNTGETLLMLACKENKLVIVDRLLEL----------GANVNSKTKDGLTALHYSAKYSKEE---------IVKLLLSKNADPNI------------C---------------------------DNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQI-DSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLC-DAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            SNTGET L +AC+     IV  L+E              +NS  +DG TALHY+ + +KEE         IV++LL   AD  +            C                            +   + PL +AC R      L++ LL    + R+ + D+EG ++L  A E G +     LL   A I  N K ++ G TA H A        +K L  D  A IDI     QT LH+        + + L    A+ +  D++ + P+H+AA+  ++++ +  + +    V A  KD
Sbjct:  532 SNTGETPLHMACRACHPDIVRHLIETVKEKHGPDKATTYINSVNEDGATALHYTCQITKEEVKIPESDKQIVRMLLENGADVTLQTKTALETAFHYCAVAGNNDVLMEMISHMNPTDIQKAMNRQSSVGWTPLLIACHRGHME--LVNNLL--ANHARVDVFDTEGRSALHLAAERGYLHVCDALLTNKAFI--NSKSRV-GRTALHLAAMNGFTHLVKFLIKDHNAVIDILTLRKQTPLHLAAASGQMEVCQLLLELGANIDATDDLGQKPIHVAAQNNYSEVAKLFLQQHPSLVNATSKD 826          

HSP 3 Score: 68.1662 bits (165), Expect = 6.879e-12
Identity = 68/269 (25.28%), Postives = 117/269 (43.49%), Query Frame = 2
Query:  422 CSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLAC--------RRTIPPPGLISALLKA-TKNGRLQIDSEGMNSLIHAIEVGAVTTAK---ELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPI-DIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFL 1189
             +M+     +E+L++ F +   + + ++  T  T L LA +     +V  L+  GA+   + K G TA+H +A+    +++ +L S N+   I        PLH+A         R  +     + A +K+ T  G+      G  S +  + + A +  +    LL   A +Q++     NG    H AC    +  + LL    A +   Q+  G+TGLHI        +V+ L    A  N  D    TPLH AA+ G  ++V+ L
Sbjct:  834 AAMQGSVKVIEELMK-FDRSGVI-SARNKLTDATPLQLAAEGGHADVVKALVRAGASCTEENKAGFTAVHLAAQNGHGQVLDVLKSTNS-LRINSKKLGLTPLHVAAYYGQADTVRELLTS---VPATVKSETPTGQSLFGDLGTESGMTPLHLAAFSGNENVVRLLLNSAGVQVDAATIENGYNPLHLACFGGHMSVVGLLLSRSAELLQSQDRNGRTGLHIAAMHGHIQMVEILLGQGAEINATDRNGWTPLHCAAKAGHLEVVKLL 1096          

HSP 4 Score: 68.1662 bits (165), Expect = 6.940e-12
Identity = 61/222 (27.48%), Postives = 98/222 (44.14%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRT------IPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEV-GAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDR-TPLHIAA 1156
            G+T L LA +   + +V  L++ G NV+++  +G T LH +A    E ++K      A  +I DN  +  P+HLA          I      +++ + TK+G         ++L+H   + G    A  L +K   + M  K   +G  + HTA        I  L      +D+  +   T LHI VE     +V+ L  + A  ++     R TPLHIAA
Sbjct:  268 GDTALHLAARRRDVDMVRILVDYGTNVDTQNGEGQTPLHIAAAEGDEALLKYFYGVRASASIADNQDRT-PMHLAAENGHAHVIEILADKFKASIFERTKDG---------STLMHIASLNGHAECATMLFKKGVYLHMPNK---DGARSIHTAAAYGHTGIINTLLQKGEKVDVTTNDNYTALHIAVESAKPAVVETLLGFGADVHVRGGKLRETPLHIAA 476          

HSP 5 Score: 63.1586 bits (152), Expect = 2.725e-10
Identity = 50/171 (29.24%), Postives = 81/171 (47.37%), Query Frame = 2
Query:  605 TKDGLTALHYSAKYSKEEIVKLLLSK---NADPNICDNITKYYPLHLACRRT-IPPPGLI----SALLKAT-KNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYL 1090
            T+ G+T LH +A    E +V+LLL+      D    +N   Y PLHLAC    +   GL+    + LL++  +NGR  +    M+  I  +E+        LL + A+I    +   NG T  H A +   L+ +KLLC+A A    + ++G   +     E    +++YL
Sbjct:  972 TESGMTPLHLAAFSGNENVVRLLLNSAGVQVDAATIEN--GYNPLHLACFGGHMSVVGLLLSRSAELLQSQDRNGRTGLHIAAMHGHIQMVEI--------LLGQGAEINATDR---NGWTPLHCAAKAGHLEVVKLLCEAGASPKSETNYGCAAIWFAASEGHNEVLRYL 1129          

HSP 6 Score: 56.6102 bits (135), Expect = 3.426e-8
Identity = 56/233 (24.03%), Postives = 93/233 (39.91%), Query Frame = 2
Query:  518 ETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNV 1213
            +T L LA    ++ +   LLELGAN+++    G   +H +A+ +  E+ KL L ++                         P L++A    +K+G         N+  H A   G+V   +EL++ D    ++ + KL   T    A      D +K L  A A    +N  G T +H+  +     ++  L S  +       +  TPLH+AA  G    V  L+      V
Sbjct:  761 QTPLHLAAASGQMEVCQLLLELGANIDATDDLGQKPIHVAAQNNYSEVAKLFLQQH-------------------------PSLVNA---TSKDG---------NTCAHIAAMQGSVKVIEELMKFDRSGVISARNKLTDATPLQLAAEGGHADVVKALVRAGASCTEENKAGFTAVHLAAQNGHGQVLDVLKSTNSLRINSKKLGLTPLHVAAYYGQADTVRELLTSVPATV 956          

HSP 7 Score: 53.9138 bits (128), Expect = 2.462e-7
Identity = 53/197 (26.90%), Postives = 85/197 (43.15%), Query Frame = 2
Query:  560 IVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCD----------AEAPIDIQNSFGQTGLH---------ICVEENDENIVKYL 1090
            I++ LL+ G  V+  T D  TALH + + +K  +V+ LL   AD ++     +  PLH+A R      G   AL+         + ++   + +H A   G + T  +LLE + D          G+T  H ACR    D ++ L +          A   I+  N  G T LH         + + E+D+ IV+ L
Sbjct:  416 IINTLLQKGEKVDVTTNDNYTALHIAVESAKPAVVETLLGFGADVHVRGGKLRETPLHIAARVK---DGDRCALMLLKSGASPNLTTDDCLTPVHVAARHGNLATLMQLLEDEGDPLYKSN---TGETPLHMACRACHPDIVRHLIETVKEKHGPDKATTYINSVNEDGATALHYTCQITKEEVKIPESDKQIVRML 606          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: nompC (gene:FBgn0016920 transcript:FBtr0347408)

HSP 1 Score: 213.001 bits (541), Expect = 1.751e-60
Identity = 119/287 (41.46%), Postives = 168/287 (58.54%), Query Frame = 2
Query:  410 KIMNCSMKNEWNTVEQLLRQFSK--------ENSLP--NIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNA-DPNICDNITKYYPLHL-ACRRTIPPPGLISALLKAT-KNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            K++  +MK+EW  +E  L++  K         N +P   + D NTG T LM A K+NK  I+DR++ELGA+V ++  D    LH +A YS+E++VKLLL+K   DP           +HL + R+T     ++ ALL A  K+ RL+ D  G   L+ A+E G  +  +ELL      Q+ K    NGDTA H A RRRD+D +++L D    +D QN  GQT LHI   E DE ++KY +  +ASA+I DN DRTP+H+AAE G   ++E L DKFK ++F R KD
Sbjct:   82 KVLGLAMKSEWTPIEAELKKLEKYVANVGEDGNHIPLAGVHDMNTGMTPLMYATKDNKTAIMDRMIELGADVGARNNDNYNVLHIAAMYSREDVVKLLLTKRGVDPFSTGGSRSQTAVHLVSSRQTGTATNILRALLAAAGKDIRLKADGRGKIPLLLAVESGNQSMCRELLAAQTAEQL-KATTANGDTALHLAARRRDVDMVRILVDYGTNVDTQNGEGQTPLHIAAAEGDEALLKYFYGVRASASIADNQDRTPMHLAAENGHAHVIEILADKFKASIFERTKD 367          

HSP 2 Score: 73.1738 bits (178), Expect = 1.888e-13
Identity = 81/302 (26.82%), Postives = 125/302 (41.39%), Query Frame = 2
Query:  506 SNTGETLLMLACKENKLVIVDRLLEL----------GANVNSKTKDGLTALHYSAKYSKEE---------IVKLLLSKNADPNI------------C---------------------------DNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQI-DSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLC-DAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            SNTGET L +AC+     IV  L+E              +NS  +DG TALHY+ + +KEE         IV++LL   AD  +            C                            +   + PL +AC R      L++ LL    + R+ + D+EG ++L  A E G +     LL   A I  N K ++ G TA H A        +K L  D  A IDI     QT LH+        + + L    A+ +  D++ + P+H+AA+  ++++ +  + +    V A  KD
Sbjct:  532 SNTGETPLHMACRACHPDIVRHLIETVKEKHGPDKATTYINSVNEDGATALHYTCQITKEEVKIPESDKQIVRMLLENGADVTLQTKTALETAFHYCAVAGNNDVLMEMISHMNPTDIQKAMNRQSSVGWTPLLIACHRGHME--LVNNLL--ANHARVDVFDTEGRSALHLAAERGYLHVCDALLTNKAFI--NSKSRV-GRTALHLAAMNGFTHLVKFLIKDHNAVIDILTLRKQTPLHLAAASGQMEVCQLLLELGANIDATDDLGQKPIHVAAQNNYSEVAKLFLQQHPSLVNATSKD 826          

HSP 3 Score: 68.5514 bits (166), Expect = 6.024e-12
Identity = 68/269 (25.28%), Postives = 117/269 (43.49%), Query Frame = 2
Query:  422 CSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLAC--------RRTIPPPGLISALLKA-TKNGRLQIDSEGMNSLIHAIEVGAVTTAK---ELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPI-DIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFL 1189
             +M+     +E+L++ F +   + + ++  T  T L LA +     +V  L+  GA+   + K G TA+H +A+    +++ +L S N+   I        PLH+A         R  +     + A +K+ T  G+      G  S +  + + A +  +    LL   A +Q++     NG    H AC    +  + LL    A +   Q+  G+TGLHI        +V+ L    A  N  D    TPLH AA+ G  ++V+ L
Sbjct:  834 AAMQGSVKVIEELMK-FDRSGVI-SARNKLTDATPLQLAAEGGHADVVKALVRAGASCTEENKAGFTAVHLAAQNGHGQVLDVLKSTNS-LRINSKKLGLTPLHVAAYYGQADTVRELLTS---VPATVKSETPTGQSLFGDLGTESGMTPLHLAAFSGNENVVRLLLNSAGVQVDAATIENGYNPLHLACFGGHMSVVGLLLSRSAELLQSQDRNGRTGLHIAAMHGHIQMVEILLGQGAEINATDRNGWTPLHCAAKAGHLEVVKLL 1096          

HSP 4 Score: 68.1662 bits (165), Expect = 6.579e-12
Identity = 61/222 (27.48%), Postives = 98/222 (44.14%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRT------IPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEV-GAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDR-TPLHIAA 1156
            G+T L LA +   + +V  L++ G NV+++  +G T LH +A    E ++K      A  +I DN  +  P+HLA          I      +++ + TK+G         ++L+H   + G    A  L +K   + M  K   +G  + HTA        I  L      +D+  +   T LHI VE     +V+ L  + A  ++     R TPLHIAA
Sbjct:  268 GDTALHLAARRRDVDMVRILVDYGTNVDTQNGEGQTPLHIAAAEGDEALLKYFYGVRASASIADNQDRT-PMHLAAENGHAHVIEILADKFKASIFERTKDG---------STLMHIASLNGHAECATMLFKKGVYLHMPNK---DGARSIHTAAAYGHTGIINTLLQKGEKVDVTTNDNYTALHIAVESAKPAVVETLLGFGADVHVRGGKLRETPLHIAA 476          

HSP 5 Score: 63.1586 bits (152), Expect = 2.700e-10
Identity = 50/171 (29.24%), Postives = 81/171 (47.37%), Query Frame = 2
Query:  605 TKDGLTALHYSAKYSKEEIVKLLLSK---NADPNICDNITKYYPLHLACRRT-IPPPGLI----SALLKAT-KNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYL 1090
            T+ G+T LH +A    E +V+LLL+      D    +N   Y PLHLAC    +   GL+    + LL++  +NGR  +    M+  I  +E+        LL + A+I    +   NG T  H A +   L+ +KLLC+A A    + ++G   +     E    +++YL
Sbjct:  972 TESGMTPLHLAAFSGNENVVRLLLNSAGVQVDAATIEN--GYNPLHLACFGGHMSVVGLLLSRSAELLQSQDRNGRTGLHIAAMHGHIQMVEI--------LLGQGAEINATDR---NGWTPLHCAAKAGHLEVVKLLCEAGASPKSETNYGCAAIWFAASEGHNEVLRYL 1129          

HSP 6 Score: 56.6102 bits (135), Expect = 3.223e-8
Identity = 56/233 (24.03%), Postives = 93/233 (39.91%), Query Frame = 2
Query:  518 ETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNV 1213
            +T L LA    ++ +   LLELGAN+++    G   +H +A+ +  E+ KL L ++                         P L++A    +K+G         N+  H A   G+V   +EL++ D    ++ + KL   T    A      D +K L  A A    +N  G T +H+  +     ++  L S  +       +  TPLH+AA  G    V  L+      V
Sbjct:  761 QTPLHLAAASGQMEVCQLLLELGANIDATDDLGQKPIHVAAQNNYSEVAKLFLQQH-------------------------PSLVNA---TSKDG---------NTCAHIAAMQGSVKVIEELMKFDRSGVISARNKLTDATPLQLAAEGGHADVVKALVRAGASCTEENKAGFTAVHLAAQNGHGQVLDVLKSTNSLRINSKKLGLTPLHVAAYYGQADTVRELLTSVPATV 956          

HSP 7 Score: 53.9138 bits (128), Expect = 2.357e-7
Identity = 53/197 (26.90%), Postives = 85/197 (43.15%), Query Frame = 2
Query:  560 IVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCD----------AEAPIDIQNSFGQTGLH---------ICVEENDENIVKYL 1090
            I++ LL+ G  V+  T D  TALH + + +K  +V+ LL   AD ++     +  PLH+A R      G   AL+         + ++   + +H A   G + T  +LLE + D          G+T  H ACR    D ++ L +          A   I+  N  G T LH         + + E+D+ IV+ L
Sbjct:  416 IINTLLQKGEKVDVTTNDNYTALHIAVESAKPAVVETLLGFGADVHVRGGKLRETPLHIAARVK---DGDRCALMLLKSGASPNLTTDDCLTPVHVAARHGNLATLMQLLEDEGDPLYKSN---TGETPLHMACRACHPDIVRHLIETVKEKHGPDKATTYINSVNEDGATALHYTCQITKEEVKIPESDKQIVRML 606          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 102.064 bits (253), Expect = 9.053e-23
Identity = 81/249 (32.53%), Postives = 116/249 (46.59%), Query Frame = 2
Query:  452 EQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            E +++Q +   + PN  +   GET L +A +  ++ +V  LL+ GA V+ K KD  TALH +++  K EIV+ LL K A PN     + Y PLHL+ R        I+ALL    +       +G   L  A + G +  A  LL+K A      K   +G T  H A    +     LL D  A        G T LHI  ++N   I   L  Y A  N V     +PLH+AA++G   +V  L+ K
Sbjct:  447 ENIVKQLTHHGASPNTTNVR-GETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAA-TTSGYTPLHLSAREGHQE---IAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGK---SGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTK 687          

HSP 2 Score: 98.5969 bits (244), Expect = 1.594e-21
Identity = 79/276 (28.62%), Postives = 126/276 (45.65%), Query Frame = 2
Query:  455 QLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLAC----RRTI------------PPPGLISALLKATKNGRLQIDS--------------EGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
            ++++Q  ++ +LPN   + +G T L L+ +E    I   LLE G+++++ TK G T LH +AKY + E+  LLL K A P+     +   PLH+A     +R              P     + L  A K  +L+I +              +G++ L  A + G+V     LL K A++ M  K   NG T  H A +       ++L +  A ID Q   G T LH+     +  +  +L   +A  N       TPLH AA++G T I+  L+
Sbjct:  514 EIVQQLLQKGALPNAA-TTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGK-SGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNK---NGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAKTKNGYTPLHQAAQQGHTHIINMLL 784          

HSP 3 Score: 90.1225 bits (222), Expect = 7.381e-19
Identity = 71/237 (29.96%), Postives = 115/237 (48.52%), Query Frame = 2
Query:  521 TLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQ-IDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI-DKFKCNVFARD 1225
            T L +A K     +V  LL+ G+ + +KTKDGLT LH  A+   E++V++LL + A P +        PLH+A +       L    L    N  +  + ++ + +L  A   G    AK +++K A+      + LNG T  H AC++  +  ++LL    A +      G T +H+      ENIVK L  + AS N  +    T LH+AA  G   +V +L+ +  K ++ A+D
Sbjct:  271 TPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGA-PILSKTKNGLSPLHMATQGD----HLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKAN---PNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKD 499          

HSP 4 Score: 88.9669 bits (219), Expect = 1.822e-18
Identity = 74/262 (28.24%), Postives = 121/262 (46.18%), Query Frame = 2
Query:  416 MNCSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            ++C  ++    V ++L     +   P +  +  G + L +A + + L  V  LL+  A V+  T D LTALH +A     ++ K+++ K A+PN    +  + PLH+AC++      ++  LLK      LQ  +E   + IH A  +G     K+L    A       R   G+TA H A R   +D ++ L    A +DI+    QT LHI        IV+ L    A  N       TPLH++A +G  +I   L+++
Sbjct:  306 LHCGARSGHEQVVEMLL----DRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPN-AKALNGFTPLHIACKKNRVK--VMELLLK--HGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVR---GETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQ 555          

HSP 5 Score: 86.6557 bits (213), Expect = 1.038e-17
Identity = 73/240 (30.42%), Postives = 120/240 (50.00%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSE-GMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            G   L LA KE  + +V  LL+LGANV++ TK G TALH ++   + E+V+ L++  A+ N   +   + PL++A +       ++  LL+   N    I +E G   L  A++ G       LLE D       K +L    A H A R+ D  +  LL   +   D+++  G T LHI     + N+   L +  A+ + +   D TPLH+A+++G   +V+ L+D+    + A+ KD
Sbjct:   75 GLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVN-AQSQNGFTPLYMAAQENHL--DVVRFLLE--NNSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDT----KGKVRL---PALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDR-GSKIEAKTKD 301          

HSP 6 Score: 75.0998 bits (183), Expect = 6.699e-14
Identity = 64/225 (28.44%), Postives = 96/225 (42.67%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFL 1189
            G T L +A K+N+L I   LLE GA  N+ T+ G++ LH +A+    ++V LLL+K A+ N+  N     PLHLA                       Q D  G+  +              LL   A+I    K   +G T  H AC   ++     L + +A  + +   G T LH   ++   +I+  L  Y AS N +     T L IA   G+  +V+ L
Sbjct:  632 GYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNM-GNKNGLTPLHLAA----------------------QDDKAGVTEV--------------LLNHGAEIDAQTK---SGYTPLHVACHYGNMKMANFLLENQAKPNAKTKNGYTPLHQAAQQGHTHIINMLLQYGASPNELTLNGNTALSIARRLGYISVVDTL 816          

HSP 7 Score: 64.3142 bits (155), Expect = 1.561e-10
Identity = 65/257 (25.29%), Postives = 110/257 (42.80%), Query Frame = 2
Query:  422 CSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
             S+  +   V +L+   +  N+      S  G T L +A +EN L +V  LLE  ++ +  T+DG T L  + +   +++V LLL  +    +     +   LH+A R+       +  LL+   N  ++  S G   L  A   G +  A  LL + A +    +   N  T  H A +R + + +KLL D  + I+ +   G T LH       E +V+ L    A          +PLH+A +      V+ L+
Sbjct:  115 ASLAGQTEVVRELVTNGANVNA-----QSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKV-----RLPALHIAARKDDTKSAAL--LLQNDHNADVESKS-GFTPLHIAAHYGNINVATLLLNRGAAVDFMAR---NDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLL 355          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 102.064 bits (253), Expect = 9.053e-23
Identity = 81/249 (32.53%), Postives = 116/249 (46.59%), Query Frame = 2
Query:  452 EQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            E +++Q +   + PN  +   GET L +A +  ++ +V  LL+ GA V+ K KD  TALH +++  K EIV+ LL K A PN     + Y PLHL+ R        I+ALL    +       +G   L  A + G +  A  LL+K A      K   +G T  H A    +     LL D  A        G T LHI  ++N   I   L  Y A  N V     +PLH+AA++G   +V  L+ K
Sbjct:  447 ENIVKQLTHHGASPNTTNVR-GETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAA-TTSGYTPLHLSAREGHQE---IAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGK---SGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTK 687          

HSP 2 Score: 98.5969 bits (244), Expect = 1.594e-21
Identity = 79/276 (28.62%), Postives = 126/276 (45.65%), Query Frame = 2
Query:  455 QLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLAC----RRTI------------PPPGLISALLKATKNGRLQIDS--------------EGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
            ++++Q  ++ +LPN   + +G T L L+ +E    I   LLE G+++++ TK G T LH +AKY + E+  LLL K A P+     +   PLH+A     +R              P     + L  A K  +L+I +              +G++ L  A + G+V     LL K A++ M  K   NG T  H A +       ++L +  A ID Q   G T LH+     +  +  +L   +A  N       TPLH AA++G T I+  L+
Sbjct:  514 EIVQQLLQKGALPNAA-TTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGK-SGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNK---NGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAKTKNGYTPLHQAAQQGHTHIINMLL 784          

HSP 3 Score: 90.1225 bits (222), Expect = 7.381e-19
Identity = 71/237 (29.96%), Postives = 115/237 (48.52%), Query Frame = 2
Query:  521 TLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQ-IDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI-DKFKCNVFARD 1225
            T L +A K     +V  LL+ G+ + +KTKDGLT LH  A+   E++V++LL + A P +        PLH+A +       L    L    N  +  + ++ + +L  A   G    AK +++K A+      + LNG T  H AC++  +  ++LL    A +      G T +H+      ENIVK L  + AS N  +    T LH+AA  G   +V +L+ +  K ++ A+D
Sbjct:  271 TPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGA-PILSKTKNGLSPLHMATQGD----HLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKAN---PNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKD 499          

HSP 4 Score: 88.9669 bits (219), Expect = 1.822e-18
Identity = 74/262 (28.24%), Postives = 121/262 (46.18%), Query Frame = 2
Query:  416 MNCSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            ++C  ++    V ++L     +   P +  +  G + L +A + + L  V  LL+  A V+  T D LTALH +A     ++ K+++ K A+PN    +  + PLH+AC++      ++  LLK      LQ  +E   + IH A  +G     K+L    A       R   G+TA H A R   +D ++ L    A +DI+    QT LHI        IV+ L    A  N       TPLH++A +G  +I   L+++
Sbjct:  306 LHCGARSGHEQVVEMLL----DRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPN-AKALNGFTPLHIACKKNRVK--VMELLLK--HGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVR---GETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQ 555          

HSP 5 Score: 86.6557 bits (213), Expect = 1.038e-17
Identity = 73/240 (30.42%), Postives = 120/240 (50.00%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSE-GMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            G   L LA KE  + +V  LL+LGANV++ TK G TALH ++   + E+V+ L++  A+ N   +   + PL++A +       ++  LL+   N    I +E G   L  A++ G       LLE D       K +L    A H A R+ D  +  LL   +   D+++  G T LHI     + N+   L +  A+ + +   D TPLH+A+++G   +V+ L+D+    + A+ KD
Sbjct:   75 GLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVN-AQSQNGFTPLYMAAQENHL--DVVRFLLE--NNSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDT----KGKVRL---PALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDR-GSKIEAKTKD 301          

HSP 6 Score: 75.0998 bits (183), Expect = 6.699e-14
Identity = 64/225 (28.44%), Postives = 96/225 (42.67%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFL 1189
            G T L +A K+N+L I   LLE GA  N+ T+ G++ LH +A+    ++V LLL+K A+ N+  N     PLHLA                       Q D  G+  +              LL   A+I    K   +G T  H AC   ++     L + +A  + +   G T LH   ++   +I+  L  Y AS N +     T L IA   G+  +V+ L
Sbjct:  632 GYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNM-GNKNGLTPLHLAA----------------------QDDKAGVTEV--------------LLNHGAEIDAQTK---SGYTPLHVACHYGNMKMANFLLENQAKPNAKTKNGYTPLHQAAQQGHTHIINMLLQYGASPNELTLNGNTALSIARRLGYISVVDTL 816          

HSP 7 Score: 64.3142 bits (155), Expect = 1.561e-10
Identity = 65/257 (25.29%), Postives = 110/257 (42.80%), Query Frame = 2
Query:  422 CSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
             S+  +   V +L+   +  N+      S  G T L +A +EN L +V  LLE  ++ +  T+DG T L  + +   +++V LLL  +    +     +   LH+A R+       +  LL+   N  ++  S G   L  A   G +  A  LL + A +    +   N  T  H A +R + + +KLL D  + I+ +   G T LH       E +V+ L    A          +PLH+A +      V+ L+
Sbjct:  115 ASLAGQTEVVRELVTNGANVNA-----QSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKV-----RLPALHIAARKDDTKSAAL--LLQNDHNADVESKS-GFTPLHIAAHYGNINVATLLLNRGAAVDFMAR---NDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLL 355          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: BX469921.1 (ankyrin 3a [Source:NCBI gene;Acc:103909035])

HSP 1 Score: 102.064 bits (253), Expect = 1.118e-22
Identity = 81/249 (32.53%), Postives = 116/249 (46.59%), Query Frame = 2
Query:  452 EQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            E +++Q +   + PN  +   GET L +A +  ++ +V  LL+ GA V+ K KD  TALH +++  K EIV+ LL K A PN     + Y PLHL+ R        I+ALL    +       +G   L  A + G +  A  LL+K A      K   +G T  H A    +     LL D  A        G T LHI  ++N   I   L  Y A  N V     +PLH+AA++G   +V  L+ K
Sbjct:  447 ENIVKQLTHHGASPNTTNVR-GETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAA-TTSGYTPLHLSAREGHQE---IAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGK---SGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTK 687          

HSP 2 Score: 89.7373 bits (221), Expect = 1.023e-18
Identity = 71/237 (29.96%), Postives = 115/237 (48.52%), Query Frame = 2
Query:  521 TLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQ-IDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI-DKFKCNVFARD 1225
            T L +A K     +V  LL+ G+ + +KTKDGLT LH  A+   E++V++LL + A P +        PLH+A +       L    L    N  +  + ++ + +L  A   G    AK +++K A+      + LNG T  H AC++  +  ++LL    A +      G T +H+      ENIVK L  + AS N  +    T LH+AA  G   +V +L+ +  K ++ A+D
Sbjct:  271 TPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGA-PILSKTKNGLSPLHMATQGD----HLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKAN---PNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKD 499          

HSP 3 Score: 88.5817 bits (218), Expect = 2.412e-18
Identity = 74/262 (28.24%), Postives = 121/262 (46.18%), Query Frame = 2
Query:  416 MNCSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            ++C  ++    V ++L     +   P +  +  G + L +A + + L  V  LL+  A V+  T D LTALH +A     ++ K+++ K A+PN    +  + PLH+AC++      ++  LLK      LQ  +E   + IH A  +G     K+L    A       R   G+TA H A R   +D ++ L    A +DI+    QT LHI        IV+ L    A  N       TPLH++A +G  +I   L+++
Sbjct:  306 LHCGARSGHEQVVEMLL----DRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPN-AKALNGFTPLHIACKKNRVK--VMELLLK--HGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVR---GETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQ 555          

HSP 4 Score: 87.8113 bits (216), Expect = 4.535e-18
Identity = 67/252 (26.59%), Postives = 122/252 (48.41%), Query Frame = 2
Query:  455 QLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLI-----SALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLID 1195
            ++++Q  ++ +LPN   + +G T L L+ +E    I   LLE G+++++ TK G T LH +AKY + E+  LLL K A P+     +   PLH+A         L+     ++     KNG   +    + +  + +E+G       LLE  A+     ++   G +  H A +   +D + LL   +A +++ N  G T LH+  +++   + + L ++ A  +       TPLH+A   G  K+  FL++
Sbjct:  514 EIVQQLLQKGALPNAA-TTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGK-SGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLH---IAAKKNQLEIGTT-----LLEYGAECNTVTRQ---GISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLE 752          

HSP 5 Score: 86.2705 bits (212), Expect = 1.325e-17
Identity = 73/240 (30.42%), Postives = 120/240 (50.00%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSE-GMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            G   L LA KE  + +V  LL+LGANV++ TK G TALH ++   + E+V+ L++  A+ N   +   + PL++A +       ++  LL+   N    I +E G   L  A++ G       LLE D       K +L    A H A R+ D  +  LL   +   D+++  G T LHI     + N+   L +  A+ + +   D TPLH+A+++G   +V+ L+D+    + A+ KD
Sbjct:   75 GLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVN-AQSQNGFTPLYMAAQENHL--DVVRFLLE--NNSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDT----KGKVRL---PALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDR-GSKIEAKTKD 301          

HSP 6 Score: 64.3142 bits (155), Expect = 1.845e-10
Identity = 65/257 (25.29%), Postives = 110/257 (42.80%), Query Frame = 2
Query:  422 CSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
             S+  +   V +L+   +  N+      S  G T L +A +EN L +V  LLE  ++ +  T+DG T L  + +   +++V LLL  +    +     +   LH+A R+       +  LL+   N  ++  S G   L  A   G +  A  LL + A +    +   N  T  H A +R + + +KLL D  + I+ +   G T LH       E +V+ L    A          +PLH+A +      V+ L+
Sbjct:  115 ASLAGQTEVVRELVTNGANVNA-----QSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKV-----RLPALHIAARKDDTKSAAL--LLQNDHNADVESKS-GFTPLHIAAHYGNINVATLLLNRGAAVDFMAR---NDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLL 355          

HSP 7 Score: 63.929 bits (154), Expect = 1.997e-10
Identity = 62/230 (26.96%), Postives = 95/230 (41.30%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPID-----IQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFL 1189
            G T L +A K+N+L I   LLE GA  N+ T+ G++ LH +A+    ++V LLL+K A+ N+  N     PLHLA                       Q D  G+  +              LL   A+I    K   +G T  H AC   ++     L + +A  +     I N +    +    ++   +I+  L  Y AS N +     T L IA   G+  +V+ L
Sbjct:  632 GYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNM-GNKNGLTPLHLAA----------------------QDDKAGVTEV--------------LLNHGAEIDAQTK---SGYTPLHVACHYGNMKMANFLLENQAKPNAKTKVIVNGYFDMLIPFSAQQGHTHIINMLLQYGASPNELTLNGNTALSIARRLGYISVVDTL 821          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: BX469921.1 (ankyrin 3a [Source:NCBI gene;Acc:103909035])

HSP 1 Score: 100.523 bits (249), Expect = 3.979e-22
Identity = 83/254 (32.68%), Postives = 119/254 (46.85%), Query Frame = 2
Query:  452 EQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNV 1213
            E +++Q +   + PN  +   GET L +A +  ++ +V  LL+ GA V+ K KD  TALH +++  K EIV+ LL K A PN     + Y PLHL+ R        I+ALL    +       +G   L  A + G +  A  LL+K A      K   +G T  H A    +     LL D  A        G T LHI  ++N   I   L  Y A  N V     +PLH+AA++G   +V  L+ K + NV
Sbjct:  433 ENIVKQLTHHGASPNTTNVR-GETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAA-TTSGYTPLHLSAREGH---QEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGK---SGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTK-QANV 677          

HSP 2 Score: 88.9669 bits (219), Expect = 1.949e-18
Identity = 71/237 (29.96%), Postives = 115/237 (48.52%), Query Frame = 2
Query:  521 TLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQ-IDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI-DKFKCNVFARD 1225
            T L +A K     +V  LL+ G+ + +KTKDGLT LH  A+   E++V++LL + A P +        PLH+A +       L    L    N  +  + ++ + +L  A   G    AK +++K A+      + LNG T  H AC++  +  ++LL    A +      G T +H+      ENIVK L  + AS N  +    T LH+AA  G   +V +L+ +  K ++ A+D
Sbjct:  257 TPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGA-PILSKTKNGLSPLHMATQGD----HLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNA---KALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKD 485          

HSP 3 Score: 86.2705 bits (212), Expect = 1.662e-17
Identity = 75/251 (29.88%), Postives = 116/251 (46.22%), Query Frame = 2
Query:  449 VEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            VE LL     +   P +  +  G + L +A + + L  V  LL+  A V+  T D LTALH +A     ++ K+++ K A+PN    +  + PLH+AC++      ++  LLK      LQ  +E   + IH A  +G     K+L    A       R   G+TA H A R   +D ++ L    A +DI+    QT LHI        IV+ L    A  N       TPLH++A +G  +I   L+++
Sbjct:  304 VEMLL-----DRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPN-AKALNGFTPLHIACKKNRV--KVMELLLK--HGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVR---GETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQ 541          

HSP 4 Score: 86.2705 bits (212), Expect = 1.786e-17
Identity = 67/252 (26.59%), Postives = 122/252 (48.41%), Query Frame = 2
Query:  455 QLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLI-----SALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLID 1195
            ++++Q  ++ +LPN   + +G T L L+ +E    I   LLE G+++++ TK G T LH +AKY + E+  LLL K A P+     +   PLH+A         L+     ++     KNG   +    + +  + +E+G       LLE  A+     ++   G +  H A +   +D + LL   +A +++ N  G T LH+  +++   + + L ++ A  +       TPLH+A   G  K+  FL++
Sbjct:  500 EIVQQLLQKGALPNAA-TTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGK-SGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLH---IAAKKNQLEIGTT-----LLEYGAECNTVTRQ---GISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLE 738          

HSP 5 Score: 78.9518 bits (193), Expect = 4.391e-15
Identity = 70/247 (28.34%), Postives = 120/247 (48.58%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSF--------GQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            G   L LA KE  + +V  LL+LGANV++ TK G TALH ++   + E+V+ L++  A+ N   +   + PL++A +       ++  LL+   +  +  + +G   L  A++ G       LLE D       K +L    A H A R+ D  +  LL   +   D+++          G T LHI     + N+   L +  A+ + +   D TPLH+A+++G   +V+ L+D+    + A+ KD
Sbjct:   53 GLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVN-AQSQNGFTPLYMAAQENH--LDVVRFLLENNSSQSIATE-DGFTPLAVALQQGHDQVVSLLLENDT----KGKVRL---PALHIAARKDDTKSAALLLQNDHNADVESKMMVNRTTESGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDR-GSKIEAKTKD 287          

HSP 6 Score: 62.7734 bits (151), Expect = 4.712e-10
Identity = 61/232 (26.29%), Postives = 95/232 (40.95%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLI--HAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPID-----IQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFL 1189
            G T L +A K+N+L I   LLE GA  N+ T+ G++ LH +A+    ++V LLL+K A+ N+  N     PLHLA                       Q D  G+  ++  H  E+ A T +                   G T  H AC   ++     L + +A  +     I N +    +    ++   +I+  L  Y AS N +     T L IA   G+  +V+ L
Sbjct:  618 GYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMG-NKNGLTPLHLAA----------------------QDDKAGVTEVLLNHGAEIDAQTKS-------------------GYTPLHVACHYGNMKMANFLLENQAKPNAKTKVIVNGYFDMLIPFSAQQGHTHIINMLLQYGASPNELTLNGNTALSIARRLGYISVVDTL 807          

HSP 7 Score: 58.5362 bits (140), Expect = 1.050e-8
Identity = 62/238 (26.05%), Postives = 99/238 (41.60%), Query Frame = 2
Query:  506 SNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSE---------GMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
            S  G T L +A +EN L +V  LLE  ++ +  T+DG T L  + +   +++V LLL      N      +   LH+A R+        SA L    +    ++S+         G   L  A   G +  A  LL + A +    +   N  T  H A +R + + +KLL D  + I+ +   G T LH       E +V+ L    A          +PLH+A +      V+ L+
Sbjct:  116 SQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLE-----NDTKGKVRLPALHIAARKD----DTKSAALLLQNDHNADVESKMMVNRTTESGFTPLHIAAHYGNINVATLLLNRGAAVDFMAR---NDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLL 341          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 100.138 bits (248), Expect = 4.441e-22
Identity = 83/254 (32.68%), Postives = 119/254 (46.85%), Query Frame = 2
Query:  452 EQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNV 1213
            E +++Q +   + PN  +   GET L +A +  ++ +V  LL+ GA V+ K KD  TALH +++  K EIV+ LL K A PN     + Y PLHL+ R        I+ALL    +       +G   L  A + G +  A  LL+K A      K   +G T  H A    +     LL D  A        G T LHI  ++N   I   L  Y A  N V     +PLH+AA++G   +V  L+ K + NV
Sbjct:  438 ENIVKQLTHHGASPNTTNVR-GETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAA-TTSGYTPLHLSAREGH---QEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGK---SGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTK-QANV 682          

HSP 2 Score: 96.2857 bits (238), Expect = 7.834e-21
Identity = 79/276 (28.62%), Postives = 126/276 (45.65%), Query Frame = 2
Query:  455 QLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLAC----RRTI------------PPPGLISALLKATKNGRLQIDS--------------EGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
            ++++Q  ++ +LPN   + +G T L L+ +E    I   LLE G+++++ TK G T LH +AKY + E+  LLL K A P+     +   PLH+A     +R              P     + L  A K  +L+I +              +G++ L  A + G+V     LL K A++ M  K   NG T  H A +       ++L +  A ID Q   G T LH+     +  +  +L   +A  N       TPLH AA++G T I+  L+
Sbjct:  505 EIVQQLLQKGALPNAA-TTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGK-SGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNK---NGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAKTKNGYTPLHQAAQQGHTHIINMLL 775          

HSP 3 Score: 88.9669 bits (219), Expect = 2.133e-18
Identity = 71/237 (29.96%), Postives = 115/237 (48.52%), Query Frame = 2
Query:  521 TLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQ-IDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI-DKFKCNVFARD 1225
            T L +A K     +V  LL+ G+ + +KTKDGLT LH  A+   E++V++LL + A P +        PLH+A +       L    L    N  +  + ++ + +L  A   G    AK +++K A+      + LNG T  H AC++  +  ++LL    A +      G T +H+      ENIVK L  + AS N  +    T LH+AA  G   +V +L+ +  K ++ A+D
Sbjct:  262 TPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGA-PILSKTKNGLSPLHMATQGD----HLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNA---KALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKD 490          

HSP 4 Score: 85.8853 bits (211), Expect = 1.973e-17
Identity = 75/251 (29.88%), Postives = 116/251 (46.22%), Query Frame = 2
Query:  449 VEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            VE LL     +   P +  +  G + L +A + + L  V  LL+  A V+  T D LTALH +A     ++ K+++ K A+PN    +  + PLH+AC++      ++  LLK      LQ  +E   + IH A  +G     K+L    A       R   G+TA H A R   +D ++ L    A +DI+    QT LHI        IV+ L    A  N       TPLH++A +G  +I   L+++
Sbjct:  309 VEMLL-----DRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPN-AKALNGFTPLHIACKKNRV--KVMELLLK--HGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVR---GETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQ 546          

HSP 5 Score: 78.5666 bits (192), Expect = 5.021e-15
Identity = 73/248 (29.44%), Postives = 120/248 (48.39%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSE-GMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSF--------GQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            G   L LA KE  + +V  LL+LGANV++ TK G TALH ++   + E+V+ L++  A+ N   +   + PL++A +       ++  LL+   N    I +E G   L  A++ G       LLE D       K +L    A H A R+ D  +  LL   +   D+++          G T LHI     + N+   L +  A+ + +   D TPLH+A+++G   +V+ L+D+    + A+ KD
Sbjct:   58 GLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVN-AQSQNGFTPLYMAAQENH--LDVVRFLLE--NNSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDT----KGKVRL---PALHIAARKDDTKSAALLLQNDHNADVESKMMVNRTTESGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDR-GSKIEAKTKD 292          

HSP 6 Score: 73.9442 bits (180), Expect = 1.379e-13
Identity = 63/227 (27.75%), Postives = 96/227 (42.29%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLI--HAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFL 1189
            G T L +A K+N+L I   LLE GA  N+ T+ G++ LH +A+    ++V LLL+K A+ N+  N     PLHLA                       Q D  G+  ++  H  E+ A T +                   G T  H AC   ++     L + +A  + +   G T LH   ++   +I+  L  Y AS N +     T L IA   G+  +V+ L
Sbjct:  623 GYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMG-NKNGLTPLHLAA----------------------QDDKAGVTEVLLNHGAEIDAQTKS-------------------GYTPLHVACHYGNMKMANFLLENQAKPNAKTKNGYTPLHQAAQQGHTHIINMLLQYGASPNELTLNGNTALSIARRLGYISVVDTL 807          

HSP 7 Score: 58.5362 bits (140), Expect = 1.250e-8
Identity = 62/238 (26.05%), Postives = 99/238 (41.60%), Query Frame = 2
Query:  506 SNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSE---------GMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
            S  G T L +A +EN L +V  LLE  ++ +  T+DG T L  + +   +++V LLL      N      +   LH+A R+        SA L    +    ++S+         G   L  A   G +  A  LL + A +    +   N  T  H A +R + + +KLL D  + I+ +   G T LH       E +V+ L    A          +PLH+A +      V+ L+
Sbjct:  121 SQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLE-----NDTKGKVRLPALHIAARKD----DTKSAALLLQNDHNADVESKMMVNRTTESGFTPLHIAAHYGNINVATLLLNRGAAVDFMAR---NDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLL 346          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: snx14 (sorting nexin 14 [Source:Xenbase;Acc:XB-GENE-984188])

HSP 1 Score: 214.157 bits (544), Expect = 1.376e-60
Identity = 116/240 (48.33%), Postives = 153/240 (63.75%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKAT-KNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            G T LM+A +EN+L IV+R LELG ++N +TKD  TALH +A +SK+EIV+LLL+K A+PNI        PLH    R      +   LL+A+ K+ RL  D +G   L+ AIE G +   KELL    + Q+  K   +GDTA H +CR+RD DA KLL +  A +D QN  GQT LHI     DE ++K LH  +A+AN+ D MDRTPLH+AAE+G T IVE L +KF+ NV AR K+
Sbjct:    9 GLTPLMIAVRENRLAIVERFLELGVDLNERTKDSRTALHVAAAHSKDEIVRLLLAKKAEPNIPGGPKDQLPLHYTALRPNGAINVTQTLLRASHKDARLTPDKDGCIPLVLAIEAGNLGICKELLSATPEAQLRAK---SGDTALHVSCRKRDADAAKLLVEYGASVDCQNVEGQTPLHIAAWAGDEMMLKLLHQCRANANLTDKMDRTPLHVAAERGNTNIVEILTEKFRSNVLARTKE 245          

HSP 2 Score: 71.2478 bits (173), Expect = 1.266e-12
Identity = 70/300 (23.33%), Postives = 120/300 (40.00%), Query Frame = 2
Query:  437 EWNTVEQLLRQFS-KENSLPNIKDSN-------TGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKA-TKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQ--------------------------------------MNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLID 1195
            E NT+  +  Q+   E +L  +K           G   L  A     + +V  LL+ GA+V+++TKD  TALH +A+  K  +V+ LL   A   +     +Y P  +    +     L++ + KA      L + +     + H  +   V   + L+E D DI                                       MNK+ K NG +    A  +     +++L   +A +D+ +  G+  LH+  E   + I   L  +KA  N    +  TPLH+ A+ GF  +V+ L++
Sbjct:  245 EGNTLMHIASQYGHPETALAFLKRGGLLHMPNKAGAVCLHAAATRGHVAVVRALLQKGAHVDARTKDNYTALHIAAESCKPLVVQTLLGFGAQVQLKGGKVRYIPSPIHIPVSHSNHCLVAKVKKALAGETPLHLAAAVKKEMTHT-QGEDVKIIRILMEHDGDISRPTNTTSETPLHYCARVGNEDVLLEMIRHISSSRIQQTMNKQAK-NGRSPLLVAAEQGHTGIVQILLQNQARVDVFDEHGKAALHLAAENGHDQIADILLKHKAFVNAKTKLGLTPLHLCAQNGFNHLVKLLVE 542          

HSP 3 Score: 68.9366 bits (167), Expect = 7.211e-12
Identity = 59/219 (26.94%), Postives = 101/219 (46.12%), Query Frame = 2
Query:  506 SNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDR---TPLHI 1150
            + +G+T L ++C++        L+E GA+V+ +  +G T LH +A    E ++KLL    A+ N+ D + +  PLH+A  R      ++  L +  ++  L    EG N+L+H A + G   TA   L++   + M  K    G    H A  R  +  ++ L    A +D +     T LHI  E     +V+ L  + A   +     R   +P+HI
Sbjct:  143 AKSGDTALHVSCRKRDADAAKLLVEYGASVDCQNVEGQTPLHIAAWAGDEMMLKLLHQCRANANLTDKMDR-TPLHVAAERG--NTNIVEILTEKFRSNVLARTKEG-NTLMHIASQYGHPETALAFLKRGGLLHMPNKA---GAVCLHAAATRGHVAVVRALLQKGAHVDARTKDNYTALHIAAESCKPLVVQTLLGFGAQVQLKGGKVRYIPSPIHI 354          

HSP 4 Score: 60.077 bits (144), Expect = 5.477e-9
Identity = 54/232 (23.28%), Postives = 95/232 (40.95%), Query Frame = 2
Query:  503 DSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCD-AEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLID 1195
            ++  G T + LA K   + +++ L    +   + TK GLTALH +A + + + V+ +L+K                 +    T  PP  +  LL   +  R      G   L  A + G  +  + LL     +Q +      G T  H A +      + LL   + + + +++  G+T LH+        +++ L    A  N+ D     PLH AA  GF   + FL++
Sbjct:  687 ENGEGMTAIHLAAKNGHIHVLEALKGSVSFRITSTKTGLTALHVAAHFGQLDFVREILTK-----------------VPATMTSEPPKSVPDLLHMKEQSR----ESGYTPLHLASQSGHESLVRLLLNYPG-VQADTATTRQGSTPIHLAAQNGHTAVVGLLLSKSTSQLHMKDKRGRTCLHLAAANGHIEMMRALIGQGAEINVTDKNGWCPLHFAARSGFLDTIRFLVE 896          

HSP 5 Score: 58.5362 bits (140), Expect = 1.561e-8
Identity = 64/231 (27.71%), Postives = 91/231 (39.39%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAP-IDIQNSFGQTGLHICVEENDENIVKYLHSY-KASANIVDNM--DRTPLHIAAEKGFTKIVEFLID 1195
            G+  L LA +     I D LL+  A VN+KTK GLT LH  A+     +VKLL+  +       ++TK  PLH+A                   NG+L +                      LL   AD+       + G T  H A      + +KL    +   +   N  G T  HI   +    ++K L  + K  A    N   D TPLH+AA  G T  V+ L++
Sbjct:  488 GKAALHLAAENGHDQIADILLKHKAFVNAKTKLGLTPLHLCAQNGFNHLVKLLVETHLACIDAMSLTKRTPLHMAAL-----------------NGQLDV-------------------CNSLLNMKADVNAT---DIEGQTPLHLAAENDHSEVVKLFLKHKPELVTSANMEGSTCAHIAASKGSAAVIKELLKFNKTGATTARNKTNDSTPLHLAAAGGHTDAVKVLLE 679          

HSP 6 Score: 57.7658 bits (138), Expect = 2.543e-8
Identity = 70/291 (24.05%), Postives = 116/291 (39.86%), Query Frame = 2
Query:  506 SNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGR------------LQIDSEG--MNSLIHAIEVGAVT--------TAKELLEKDADIQMNKKRKLN----------GDTAFHTACRRRDLDAIKLLC-------DAEAPIDIQNSF---------GQTGLHICVEENDENIVKYLHSYKA--SANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDK 1228
            S T  T L +A    +L + + LL + A+VN+   +G T LH +A+    E+VKL L    +     N+      H+A  +      +I  LLK  K G             L + + G   +++   +E GA          TA  L  K+  I + +  K +          G TA H A     LD ++ +         +E P  + +           G T LH+  +   E++V+ L +Y    +         TP+H+AA+ G T +V  L+ K    +  +DK
Sbjct:  552 SLTKRTPLHMAALNGQLDVCNSLLNMKADVNATDIEGQTPLHLAAENDHSEVVKLFLKHKPELVTSANMEGSTCAHIAASKG--SAAVIKELLKFNKTGATTARNKTNDSTPLHLAAAGGHTDAVKVLLETGASASDENGEGMTAIHLAAKNGHIHVLEALKGSVSFRITSTKTGLTALHVAAHFGQLDFVREILTKVPATMTSEPPKSVPDLLHMKEQSRESGYTPLHLASQSGHESLVRLLLNYPGVQADTATTRQGSTPIHLAAQNGHTAVVGLLLSKSTSQLHMKDK 840          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: snx14 (sorting nexin 14 [Source:Xenbase;Acc:XB-GENE-984188])

HSP 1 Score: 135.191 bits (339), Expect = 1.096e-33
Identity = 68/137 (49.64%), Postives = 88/137 (64.23%), Query Frame = 2
Query:  821 EGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            +G   L+ AIE G +   KELL    + Q+    K +GDTA H +CR+RD DA KLL +  A +D QN  GQT LHI     DE ++K LH  +A+AN+ D MDRTPLH+AAE+G T IVE L +KF+ NV AR K+
Sbjct:   36 DGCIPLVLAIEAGNLGICKELLSATPEAQLRAVSKKSGDTALHVSCRKRDADAAKLLVEYGASVDCQNVEGQTPLHIAAWAGDEMMLKLLHQCRANANLTDKMDRTPLHVAAERGNTNIVEILTEKFRSNVLARTKE 172          

HSP 2 Score: 80.1073 bits (196), Expect = 2.174e-15
Identity = 73/284 (25.70%), Postives = 123/284 (43.31%), Query Frame = 2
Query:  437 EWNTVEQLLRQFS-KENSLPNIKDSN-------TGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKA---------TKNGRLQIDSEG----------MNSLIHAIEVGAVTTAKELLE--KDADIQ--MNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLID 1195
            E NT+  +  Q+   E +L  +K           G   L  A     + +V  LL+ GA+V+++TKD  TALH +A+  K  +V+ LL   A   +     +Y PL L        P  ++A +K           K  R+ ++ +G             L +   VG      E++     + IQ  MNK+ K NG +    A  +     +++L   +A +D+ +  G+  LH+  E   + I   L  +KA  N    +  TPLH+ A+ GF  +V+ L++
Sbjct:  172 EGNTLMHIASQYGHPETALAFLKRGGLLHMPNKAGAVCLHAAATRGHVAVVRALLQKGAHVDARTKDNYTALHIAAESCKPLVVQTLLGFGAQVQLKGGKVRYIPLSLLYPNAGETPLHLAAAVKKEMTHTQGEDVKIIRILMEHDGDISRPTNTTSETPLHYCARVGNEDVLLEMIRHISSSRIQQTMNKQAK-NGRSPLLVAAEQGHTGIVQILLQNQARVDVFDEHGKAALHLAAENGHDQIADILLKHKAFVNAKTKLGLTPLHLCAQNGFNHLVKLLVE 454          

HSP 3 Score: 71.2478 bits (173), Expect = 1.524e-12
Identity = 68/251 (27.09%), Postives = 109/251 (43.43%), Query Frame = 2
Query:  446 TVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASAN-------------IVDNMDRTPLHIAA 1156
            T E  LR  SK+          +G+T L ++C++        L+E GA+V+ +  +G T LH +A    E ++KLL    A+ N+ D + +  PLH+A  R      ++  L +  ++  L    EG N+L+H A + G   TA   L++   + M  K    G    H A  R  +  ++ L    A +D +     T LHI  E     +V+ L  + A                +  N   TPLH+AA
Sbjct:   60 TPEAQLRAVSKK----------SGDTALHVSCRKRDADAAKLLVEYGASVDCQNVEGQTPLHIAAWAGDEMMLKLLHQCRANANLTDKMDR-TPLHVAAERG--NTNIVEILTEKFRSNVLARTKEG-NTLMHIASQYGHPETALAFLKRGGLLHMPNKA---GAVCLHAAATRGHVAVVRALLQKGAHVDARTKDNYTALHIAAESCKPLVVQTLLGFGAQVQLKGGKVRYIPLSLLYPNAGETPLHLAA 293          

HSP 4 Score: 59.6918 bits (143), Expect = 6.770e-9
Identity = 54/232 (23.28%), Postives = 95/232 (40.95%), Query Frame = 2
Query:  503 DSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCD-AEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLID 1195
            ++  G T + LA K   + +++ L    +   + TK GLTALH +A + + + V+ +L+K                 +    T  PP  +  LL   +  R      G   L  A + G  +  + LL     +Q +      G T  H A +      + LL   + + + +++  G+T LH+        +++ L    A  N+ D     PLH AA  GF   + FL++
Sbjct:  599 ENGEGMTAIHLAAKNGHIHVLEALKGSVSFRITSTKTGLTALHVAAHFGQLDFVREILTK-----------------VPATMTSEPPKSVPDLLHMKEQSR----ESGYTPLHLASQSGHESLVRLLLNYPG-VQADTATTRQGSTPIHLAAQNGHTAVVGLLLSKSTSQLHMKDKRGRTCLHLAAANGHIEMMRALIGQGAEINVTDKNGWCPLHFAARSGFLDTIRFLVE 808          

HSP 5 Score: 58.5362 bits (140), Expect = 1.649e-8
Identity = 64/231 (27.71%), Postives = 91/231 (39.39%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAP-IDIQNSFGQTGLHICVEENDENIVKYLHSY-KASANIVDNM--DRTPLHIAAEKGFTKIVEFLID 1195
            G+  L LA +     I D LL+  A VN+KTK GLT LH  A+     +VKLL+  +       ++TK  PLH+A                   NG+L +                      LL   AD+       + G T  H A      + +KL    +   +   N  G T  HI   +    ++K L  + K  A    N   D TPLH+AA  G T  V+ L++
Sbjct:  400 GKAALHLAAENGHDQIADILLKHKAFVNAKTKLGLTPLHLCAQNGFNHLVKLLVETHLACIDAMSLTKRTPLHMAAL-----------------NGQLDV-------------------CNSLLNMKADVNAT---DIEGQTPLHLAAENDHSEVVKLFLKHKPELVTSANMEGSTCAHIAASKGSAAVIKELLKFNKTGATTARNKTNDSTPLHLAAAGGHTDAVKVLLE 591          

HSP 6 Score: 57.7658 bits (138), Expect = 2.831e-8
Identity = 70/291 (24.05%), Postives = 116/291 (39.86%), Query Frame = 2
Query:  506 SNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGR------------LQIDSEG--MNSLIHAIEVGAVT--------TAKELLEKDADIQMNKKRKLN----------GDTAFHTACRRRDLDAIKLLC-------DAEAPIDIQNSF---------GQTGLHICVEENDENIVKYLHSYKA--SANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDK 1228
            S T  T L +A    +L + + LL + A+VN+   +G T LH +A+    E+VKL L    +     N+      H+A  +      +I  LLK  K G             L + + G   +++   +E GA          TA  L  K+  I + +  K +          G TA H A     LD ++ +         +E P  + +           G T LH+  +   E++V+ L +Y    +         TP+H+AA+ G T +V  L+ K    +  +DK
Sbjct:  464 SLTKRTPLHMAALNGQLDVCNSLLNMKADVNATDIEGQTPLHLAAENDHSEVVKLFLKHKPELVTSANMEGSTCAHIAASKG--SAAVIKELLKFNKTGATTARNKTNDSTPLHLAAAGGHTDAVKVLLETGASASDENGEGMTAIHLAAKNGHIHVLEALKGSVSFRITSTKTGLTALHVAAHFGQLDFVREILTKVPATMTSEPPKSVPDLLHMKEQSRESGYTPLHLASQSGHESLVRLLLNYPGVQADTATTRQGSTPIHLAAQNGHTAVVGLLLSKSTSQLHMKDK 752          

HSP 7 Score: 52.7582 bits (125), Expect = 1.083e-6
Identity = 75/283 (26.50%), Postives = 109/283 (38.52%), Query Frame = 2
Query:  521 TLLMLACKENKLVIVDRLLELGANVNSK-------------TKDGLTALHYSAKYSKE---------EIVKLLLSKNADPNICDNITKYYPLHLACR-----------RTIPPPGLISALLKATKNGR--------------LQI-----------DSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAE-APIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
            T L +A +  K ++V  LL  GA V  K                G T LH +A   KE         +I+++L+  + D +   N T   PLH   R           R I    +   + K  KNGR              +QI           D  G  +L  A E G    A  LL+  A +  N K KL G T  H   +      +KLL +   A ID  +   +T LH+       ++   L + KA  N  D   +TPLH+AAE   +++V+  +
Sbjct:  241 TALHIAAESCKPLVVQTLLGFGAQVQLKGGKVRYIPLSLLYPNAGETPLHLAAAVKKEMTHTQGEDVKIIRILMEHDGDISRPTNTTSETPLHYCARVGNEDVLLEMIRHISSSRIQQTMNKQAKNGRSPLLVAAEQGHTGIVQILLQNQARVDVFDEHGKAALHLAAENGHDQIADILLKHKAFV--NAKTKL-GLTPLHLCAQNGFNHLVKLLVETHLACIDAMSLTKRTPLHMAALNGQLDVCNSLLNMKADVNATDIEGQTPLHLAAENDHSEVVKLFL 520          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 102.834 bits (255), Expect = 8.199e-23
Identity = 77/234 (32.91%), Postives = 117/234 (50.00%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACR-RTIPPPGLISALLK--ATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKC 1207
            G T L +A K  K+ I + LLE  A+ NS  K GLT LH +  ++   IV+LLL+K A P+ C     Y PLH+A + R++       ALL+  AT N +     +G+  L  A + G       LL K A++ +  K  L   T  H A +   L+  ++L   +A +  +   G   LH+     +  +VK+L  ++A+ N V  +  TPLH AA++G T IV  L+    C
Sbjct:  527 GFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPH-CTARNGYTPLHMAVKQRSV---DTARALLQFGATCNAQ---SLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSL---TPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGAC 750          

HSP 2 Score: 93.2041 bits (230), Expect = 1.294e-19
Identity = 89/279 (31.90%), Postives = 123/279 (44.09%), Query Frame = 2
Query:  506 SNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNIC--DNITKYYPLHLACRRTIPPPGLI---------SALLKA-TKNG--RLQIDSEG-----------------------MNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            S TG T L +A     L +   LL  GANVN   ++G++ALH +++     +V+LLL + A  + C  D +T   PLH A R      G +          A ++A TKNG   + + S+G                       +  L  A   G    AK LL+K A    +  R LNG T  H AC++  +  ++LL  + A ID     G T LH+        IVK L    AS N+      TPLH+AA    T + +FLI   K  V AR KD
Sbjct:  194 SKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELT---PLHCAVRN-----GHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAK---SNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQN-KAKVNARAKD 460          

HSP 3 Score: 83.5741 bits (205), Expect = 1.488e-16
Identity = 70/276 (25.36%), Postives = 119/276 (43.12%), Query Frame = 2
Query:  458 LLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKL------------------------------NGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLID 1195
            +++   ++ + PN+      ET L +A +     + D L++  A VN++ KD  T LH +A+    E+V+LLL   A P+       + PLHL  R         + LL   +     +  +G   L  A + G +  A+ LLE++A      K  L                              NG T  H A ++R +D  + L    A  + Q+  G T LH+  +E   ++V  L S +A+ ++ +    TPLH+A+++G   I E L+ 
Sbjct:  410 IVKTLLQKGASPNVFSVKV-ETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDP-PTTAGHTPLHLTTRGGH---TQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVS 680          

HSP 4 Score: 78.5666 bits (192), Expect = 6.668e-15
Identity = 77/288 (26.74%), Postives = 125/288 (43.40%), Query Frame = 2
Query:  425 SMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNA---------------------------DPNICDNITK--YYPLHLACRRTIPPPGLISALLKATKNGRLQIDSE-GMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            ++  + + V +L+   +  NS      S  G T L +A +EN L +V  LLE GAN N  T+DG T L  + +   E +V  L+S                              DPN  D ++K  + PLH+A         L  A L   +   +    + G+++L  A   G V   + LL++ A I    K +L   T  H A R   +   ++L D  API  +   G + +H+  + +  + V+ L  Y+A  + +     TPLH+AA  G  ++ + L+DK
Sbjct:   77 ALAGQEDVVRELVNHGANVNS-----QSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPN-ADVLSKTGFTPLHIAAHYE----NLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDEL---TPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDK 351          

HSP 5 Score: 75.8702 bits (185), Expect = 5.310e-14
Identity = 58/228 (25.44%), Postives = 97/228 (42.54%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            G T L +ACK++ + +++ LL+ GA++++ T+ GLT LH ++      IVK LL K A PN+  ++    PLH+A R                                          A  L++  A +    K   +  T  H A R    + ++LL +  A  D   + G T LH+          + L   +A+   +     TPLH+AA+ G  +I E L+++
Sbjct:  362 GFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVF-SVKVETPLHMAAR------------------------------------AAHTDVADFLIQNKAKVNARAK---DDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLER 549          

HSP 6 Score: 69.707 bits (169), Expect = 4.334e-12
Identity = 62/236 (26.27%), Postives = 108/236 (45.76%), Query Frame = 2
Query:  500 KDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGA----VTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLID 1195
            K  NT   +  LA +E+   +V  L+  GANVNS+++ G T L+ +A+ +   +VK LL   A+ N+      + PL +A ++      +++ L+     G++++          A+ + A      TA  LL+ D +  +  K    G T  H A    +L+  +LL +  A ++     G + LHI     +  +V+ L    A  +     + TPLH A   G  +I E L+D
Sbjct:   67 KKGNTALHIAALAGQED---VVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATE-DGFTPLAVALQQGH--ENVVAYLISYGMKGKVRLP---------ALHIAARNDDTRTAAVLLQNDPNADVLSK---TGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLD 284          

HSP 7 Score: 59.3066 bits (142), Expect = 9.268e-9
Identity = 38/124 (30.65%), Postives = 64/124 (51.61%), Query Frame = 2
Query:  824 GMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLID 1195
            G+N+L  + + G V    ELL KD  ++   K+   G+TA H A      D ++ L +  A ++ Q+  G T L++  +EN   +VK+L    A+ N+      TPL +A ++G   +V +LI 
Sbjct:   36 GLNALHLSSKEGHVKMVTELLHKDIVLETTTKK---GNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLIS 156          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 102.449 bits (254), Expect = 9.252e-23
Identity = 77/234 (32.91%), Postives = 117/234 (50.00%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACR-RTIPPPGLISALLK--ATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKC 1207
            G T L +A K  K+ I + LLE  A+ NS  K GLT LH +  ++   IV+LLL+K A P+ C     Y PLH+A + R++       ALL+  AT N +     +G+  L  A + G       LL K A++ +  K  L   T  H A +   L+  ++L   +A +  +   G   LH+     +  +VK+L  ++A+ N V  +  TPLH AA++G T IV  L+    C
Sbjct:  496 GFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPH-CTARNGYTPLHMAVKQRSV---DTARALLQFGATCNAQ---SLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSL---TPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGAC 719          

HSP 2 Score: 83.1889 bits (204), Expect = 1.862e-16
Identity = 68/255 (26.67%), Postives = 110/255 (43.14%), Query Frame = 2
Query:  518 ETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKL------------------------------NGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
            ET L +A +     + D L++  A VN++ KD  T LH +A+    E+V+LLL   A P+       + PLHL  R         + LL   +     +  +G   L  A + G +  A+ LLE++A      K  L                              NG T  H A ++R +D  + L    A  + Q+  G T LH+  +E   ++V  L S +A+ ++ +    TPLH+A+++G   I E L+
Sbjct:  398 ETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPD-PPTTAGHTPLHLTTRGGH---TQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLV 648          

HSP 3 Score: 78.5666 bits (192), Expect = 7.158e-15
Identity = 77/289 (26.64%), Postives = 125/289 (43.25%), Query Frame = 2
Query:  422 CSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNA---------------------------DPNICDNITK--YYPLHLACRRTIPPPGLISALLKATKNGRLQIDSE-GMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
             ++  + + V +L+   +  NS      S  G T L +A +EN L +V  LLE GAN N  T+DG T L  + +   E +V  L+S                              DPN  D ++K  + PLH+A         L  A L   +   +    + G+++L  A   G V   + LL++ A I    K +L   T  H A R   +   ++L D  API  +   G + +H+  + +  + V+ L  Y+A  + +     TPLH+AA  G  ++ + L+DK
Sbjct:   71 AALAGQEDVVRELVNHGANVNS-----QSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPN-ADVLSKTGFTPLHIAAHYE----NLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDEL---TPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDK 346          

HSP 4 Score: 77.411 bits (189), Expect = 1.434e-14
Identity = 79/274 (28.83%), Postives = 118/274 (43.07%), Query Frame = 2
Query:  506 SNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNIC--DNITKYYPLHLACRRTIPPPGLI---------SALLKA-TKNG--RLQIDSEG-----------------------MNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKL-------NGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLID 1195
            S TG T L +A     L +   LL  GANVN   ++G++ALH +++     +V+LLL + A  + C  D +T   PLH A R      G +          A ++A TKNG   + + S+G                       +  L  A   G    AK LL+K A    +  R L       NG T  H AC++  +  ++LL  + A ID      +T LH+       ++  +L   KA  N     D+TPLH AA  G  ++V  L++
Sbjct:  189 SKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELT---PLHCAVRN-----GHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAK---SNARALIIILFTTNGFTPLHIACKKSHIRVMELLLKSGASIDAVTEKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLE 451          

HSP 5 Score: 73.9442 bits (180), Expect = 2.138e-13
Identity = 65/272 (23.90%), Postives = 118/272 (43.38%), Query Frame = 2
Query:  416 MNCSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPN------ICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNG-----DTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            ++C+++N    + ++L     ++  P    +  G + + +A + + L  V  LL+  A+++  T D LT LH +A      + KLLL K A  N      I      + PLH+AC+++      I  +    K+G        ++++   +E      A+      AD  +  K K+N       T  H A R    + ++LL +  A  D   + G T LH+          + L   +A+   +     TPLH+AA+ G  +I E L+++
Sbjct:  262 LHCAVRNGHVRISEILL----DHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALIIILFTTNGFTPLHIACKKS-----HIRVMELLLKSG------ASIDAVTEKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLER 518          

HSP 6 Score: 69.707 bits (169), Expect = 4.725e-12
Identity = 60/231 (25.97%), Postives = 105/231 (45.45%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGA----VTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLID 1195
            G T L +A    +  +V  L+  GANVNS+++ G T L+ +A+ +   +VK LL   A+ N+      + PL +A ++      +++ L+     G++++          A+ + A      TA  LL+ D +  +  K    G T  H A    +L+  +LL +  A ++     G + LHI     +  +V+ L    A  +     + TPLH A   G  +I E L+D
Sbjct:   64 GNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATE-DGFTPLAVALQQGH--ENVVAYLISYGMKGKVRLP---------ALHIAARNDDTRTAAVLLQNDPNADVLSK---TGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLD 279          

HSP 7 Score: 59.3066 bits (142), Expect = 9.474e-9
Identity = 38/123 (30.89%), Postives = 64/123 (52.03%), Query Frame = 2
Query:  824 GMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
            G+N+L  + + G V    ELL KD  ++   K+   G+TA H A      D ++ L +  A ++ Q+  G T L++  +EN   +VK+L    A+ N+      TPL +A ++G   +V +LI
Sbjct:   31 GLNALHLSSKEGHVKMVTELLHKDIVLETTTKK---GNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLI 150          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 102.449 bits (254), Expect = 1.055e-22
Identity = 77/234 (32.91%), Postives = 117/234 (50.00%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACR-RTIPPPGLISALLK--ATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKC 1207
            G T L +A K  K+ I + LLE  A+ NS  K GLT LH +  ++   IV+LLL+K A P+ C     Y PLH+A + R++       ALL+  AT N +     +G+  L  A + G       LL K A++ +  K  L   T  H A +   L+  ++L   +A +  +   G   LH+     +  +VK+L  ++A+ N V  +  TPLH AA++G T IV  L+    C
Sbjct:  511 GFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPH-CTARNGYTPLHMAVKQRSV---DTARALLQFGATCNAQ---SLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSL---TPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGAC 734          

HSP 2 Score: 83.1889 bits (204), Expect = 2.316e-16
Identity = 68/255 (26.67%), Postives = 110/255 (43.14%), Query Frame = 2
Query:  518 ETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKL------------------------------NGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
            ET L +A +     + D L++  A VN++ KD  T LH +A+    E+V+LLL   A P+       + PLHL  R         + LL   +     +  +G   L  A + G +  A+ LLE++A      K  L                              NG T  H A ++R +D  + L    A  + Q+  G T LH+  +E   ++V  L S +A+ ++ +    TPLH+A+++G   I E L+
Sbjct:  413 ETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPD-PPTTAGHTPLHLTTRGGH---TQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLV 663          

HSP 3 Score: 73.9442 bits (180), Expect = 2.182e-13
Identity = 92/337 (27.30%), Postives = 134/337 (39.76%), Query Frame = 2
Query:  422 CSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNA---------------------------DPNICDNITK--YYPLHLACRR----------------TIPPPGLISALLKATKNGRL-----------QIDS---EGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVE--------ENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
             ++  + + V +L+   +  NS      S  G T L +A +EN L +V  LLE GAN N  T+DG T L  + +   E +V  L+S                              DPN  D ++K  + PLH+A                      P   ISAL  A++ G +           QID+   + +  L  A+  G V  ++ LL+  A IQ   K   NG +  H A +   LD ++LL   +A ID       T LH+               + ++ L    AS + V     TPLH+AA    T + +FLI   K  V AR KD
Sbjct:  118 AALAGQEDVVRELVNHGANVNS-----QSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPN-ADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTK---NGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCAIYYYYFFALTSFMELLLKSGASIDAVTEKVETPLHMAARAAHTDVADFLIQN-KAKVNARAKD 444          

HSP 4 Score: 69.707 bits (169), Expect = 4.779e-12
Identity = 62/236 (26.27%), Postives = 108/236 (45.76%), Query Frame = 2
Query:  500 KDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGA----VTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLID 1195
            K  NT   +  LA +E+   +V  L+  GANVNS+++ G T L+ +A+ +   +VK LL   A+ N+      + PL +A ++      +++ L+     G++++          A+ + A      TA  LL+ D +  +  K    G T  H A    +L+  +LL +  A ++     G + LHI     +  +V+ L    A  +     + TPLH A   G  +I E L+D
Sbjct:  109 KKGNTALHIAALAGQED---VVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATE-DGFTPLAVALQQGH--ENVVAYLISYGMKGKVRLP---------ALHIAARNDDTRTAAVLLQNDPNADVLSK---TGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLD 326          

HSP 5 Score: 67.3958 bits (163), Expect = 2.313e-11
Identity = 61/234 (26.07%), Postives = 102/234 (43.59%), Query Frame = 2
Query:  521 TLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNIT--KYYPLHLACRRTIPPPGLISALLKATKNGRLQIDS-EGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNG-----DTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            T L  A +   + I + LL+ GA + +KTK+GL+ +H +++    + V+LLL   A     D+IT     PLH+A    I            T    L + S   ++++   +E      A+      AD  +  K K+N       T  H A R    + ++LL +  A  D   + G T LH+          + L   +A+   +     TPLH+AA+ G  +I E L+++
Sbjct:  307 TPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAH---IDDITLDHLTPLHVAAHCAI----YYYYFFALTSFMELLLKSGASIDAVTEKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLER 533          

HSP 6 Score: 65.4698 bits (158), Expect = 9.777e-11
Identity = 61/228 (26.75%), Postives = 103/228 (45.18%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            G   L L+ KE  + +V  LL     + + TK G TALH +A   +E++V+ L++  A+ N   +   + PL++A +    P  ++  LL+   N  L  + +G   L  A++ G       L+       M  K +L    A H A R  D     +L   +   D+ +  G T LHI     + N+ + L +  A+ N       + LHIA+ +G   +V  L+D+
Sbjct:   78 GLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVN-SQSQKGFTPLYMAAQENHLP--VVKFLLENGANQNLATE-DGFTPLAVALQQGHENVVAYLISYG----MKGKVRL---PALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDR 294          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ank2 (ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025])

HSP 1 Score: 97.4413 bits (241), Expect = 2.899e-21
Identity = 79/247 (31.98%), Postives = 117/247 (47.37%), Query Frame = 2
Query:  458 LLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            LL Q      + NI+    GET L +A +  ++ +V  LL  GA V+++ ++  T LH +++  K EIV+LLL   A P+       Y PLH++ R       + S LL+A     L    +G   L  A + G++  AK LL++ A      K   NG T  H A    +     LL +  A        G T LHI  ++N   I   L +Y A  N V     TPLH+A+++G T +V  L+DK
Sbjct:  428 LLLQNGASPDVTNIR----GETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAA-TTNGYTPLHISAREG--QVDVASVLLEAGAAHSLAT-KKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGK---NGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDK 663          

HSP 2 Score: 86.2705 bits (212), Expect = 1.550e-17
Identity = 76/273 (27.84%), Postives = 124/273 (45.42%), Query Frame = 2
Query:  416 MNCSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNG-RLQIDSEGMNSLIH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDK 1228
            ++C+ ++  + V +LL     E   P +  +  G + L +A + + +  V  LL+  A V+  T D LTALH +A      + KLLL K A+PN    +  + PLH+AC++       I  +    K G  +Q  +E   + IH A  +G +     LL+  A   +   R   G+TA H A R   ++ ++ L    A +D +    QT LHI        IV+ L  + A  +       TPLHI+A +G   +   L++    +  A  K
Sbjct:  282 LHCAARSGHDQVVELLL----ERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPN-ARALNGFTPLHIACKKN-----RIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIR---GETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKK 541          

HSP 3 Score: 79.7221 bits (195), Expect = 1.838e-15
Identity = 78/264 (29.55%), Postives = 117/264 (44.32%), Query Frame = 2
Query:  449 VEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITK--YYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            + QLL Q       P+   +N G T L ++ +E ++ +   LLE GA  +  TK G T LH +AKY   ++ KLLL + A     D+  K    PLH+A            ALL   K       ++   + +H A +   +  A  LL   A+     K+   G T  H A +    D + LL D  A I +    G T LH+  +E+  N+   L  + A  +    +  TPL +A   G  K+V FL+ K   NV A+ K+
Sbjct:  491 IVQLLLQHMAH---PDAATTN-GYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRA---AADSAGKNGLTPLHVAAHYD----NQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQ---GVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLL-KQGANVNAKTKN 739          

HSP 4 Score: 78.9518 bits (193), Expect = 3.198e-15
Identity = 69/238 (28.99%), Postives = 112/238 (47.06%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDS--EGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSF--------GQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            G   L LA KE  + +V  LL  G++V+S TK G TALH ++   + E+VK+L+ + A+ N   +   + PL++A +        I  +    +NG  Q  +  +G   L  A++ G       LLE D       K +L    A H A R+ D  +  LL   +   D+Q+          G T LHI     + N+   L +  A+ +       TPLH+A+++G T +V+ L+D+
Sbjct:   43 GLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANIN-AQSQNGFTPLYMAAQEN-----HIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDT----KGKVRL---PALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDR 267          

HSP 5 Score: 73.9442 bits (180), Expect = 1.325e-13
Identity = 78/307 (25.41%), Postives = 123/307 (40.07%), Query Frame = 2
Query:  422 CSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQ-------IDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIV---------------------------------KYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFAR 1222
             S+  +   V+ L+++ +  N+      S  G T L +A +EN + +V  LLE GAN ++ T+DG T L  + +    + V +LL  +    +     +   LH+A R+       +  LL+   N  +Q           G   L  A   G V  A  LL + A +    +   NG T  H A +R + + +KLL D    ID +   G T LH       + +V                                 K+L  YKA  + V     T LH+AA  G  ++ + L+DK + N  AR
Sbjct:   83 ASLAGQAEVVKVLVKEGANINA-----QSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKV-----RLPALHIAARKDDTKSAAL--LLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTAR---NGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDK-RANPNAR 373          

HSP 6 Score: 54.299 bits (129), Expect = 2.085e-7
Identity = 27/61 (44.26%), Postives = 39/61 (63.93%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPN 697
            G T L++AC    + +V+ LL+ GANVN+KTK+G T LH +A+     I+ +LL   A PN
Sbjct:  707 GYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPN 767          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ank2 (ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025])

HSP 1 Score: 97.4413 bits (241), Expect = 3.304e-21
Identity = 79/247 (31.98%), Postives = 117/247 (47.37%), Query Frame = 2
Query:  458 LLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            LL Q      + NI+    GET L +A +  ++ +V  LL  GA V+++ ++  T LH +++  K EIV+LLL   A P+       Y PLH++ R       + S LL+A     L    +G   L  A + G++  AK LL++ A      K   NG T  H A    +     LL +  A        G T LHI  ++N   I   L +Y A  N V     TPLH+A+++G T +V  L+DK
Sbjct:  445 LLLQNGASPDVTNIR----GETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAA-TTNGYTPLHISAREG--QVDVASVLLEAGAAHSLAT-KKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGK---NGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDK 680          

HSP 2 Score: 86.6557 bits (213), Expect = 1.228e-17
Identity = 76/273 (27.84%), Postives = 124/273 (45.42%), Query Frame = 2
Query:  416 MNCSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNG-RLQIDSEGMNSLIH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDK 1228
            ++C+ ++  + V +LL     E   P +  +  G + L +A + + +  V  LL+  A V+  T D LTALH +A      + KLLL K A+PN    +  + PLH+AC++       I  +    K G  +Q  +E   + IH A  +G +     LL+  A   +   R   G+TA H A R   ++ ++ L    A +D +    QT LHI        IV+ L  + A  +       TPLHI+A +G   +   L++    +  A  K
Sbjct:  299 LHCAARSGHDQVVELLL----ERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPN-ARALNGFTPLHIACKKN-----RIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIR---GETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKK 558          

HSP 3 Score: 85.1149 bits (209), Expect = 4.029e-17
Identity = 70/239 (29.29%), Postives = 113/239 (47.28%), Query Frame = 2
Query:  491 PNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDS---EGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            PN +  N G T L +ACK+N++ +++ L++ GA++ + T+ GLT +H +A      IV LLL   A P++  NI     LH+A R      G +  +    +NG L +D+   E    L  A  +G     + LL+  A          NG T  H + R   +D   +L +A A   +    G T LH+  +    ++ K L   +A+A+       TPLH+AA     K+   L++K
Sbjct:  387 PNARALN-GFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVT-NIRGETALHMAARA-----GQVEVVRCLLRNGAL-VDARAREEQTPLHIASRLGKTEIVQLLLQHMAH---PDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEK 614          

HSP 4 Score: 80.1073 bits (196), Expect = 1.564e-15
Identity = 78/264 (29.55%), Postives = 117/264 (44.32%), Query Frame = 2
Query:  449 VEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITK--YYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            + QLL Q       P+   +N G T L ++ +E ++ +   LLE GA  +  TK G T LH +AKY   ++ KLLL + A     D+  K    PLH+A            ALL   K       ++   + +H A +   +  A  LL   A+     K+   G T  H A +    D + LL D  A I +    G T LH+  +E+  N+   L  + A  +    +  TPL +A   G  K+V FL+ K   NV A+ K+
Sbjct:  508 IVQLLLQHMAH---PDAATTN-GYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRA---AADSAGKNGLTPLHVAAHYD----NQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQ---GVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLL-KQGANVNAKTKN 756          

HSP 5 Score: 79.337 bits (194), Expect = 2.822e-15
Identity = 69/238 (28.99%), Postives = 112/238 (47.06%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDS--EGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSF--------GQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            G   L LA KE  + +V  LL  G++V+S TK G TALH ++   + E+VK+L+ + A+ N   +   + PL++A +        I  +    +NG  Q  +  +G   L  A++ G       LLE D       K +L    A H A R+ D  +  LL   +   D+Q+          G T LHI     + N+   L +  A+ +       TPLH+A+++G T +V+ L+D+
Sbjct:   60 GLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANIN-AQSQNGFTPLYMAAQEN-----HIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDT----KGKVRL---PALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDR 284          

HSP 6 Score: 73.9442 bits (180), Expect = 1.580e-13
Identity = 78/307 (25.41%), Postives = 123/307 (40.07%), Query Frame = 2
Query:  422 CSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQ-------IDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIV---------------------------------KYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFAR 1222
             S+  +   V+ L+++ +  N+      S  G T L +A +EN + +V  LLE GAN ++ T+DG T L  + +    + V +LL  +    +     +   LH+A R+       +  LL+   N  +Q           G   L  A   G V  A  LL + A +    +   NG T  H A +R + + +KLL D    ID +   G T LH       + +V                                 K+L  YKA  + V     T LH+AA  G  ++ + L+DK + N  AR
Sbjct:  100 ASLAGQAEVVKVLVKEGANINA-----QSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKV-----RLPALHIAARKDDTKSAAL--LLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTAR---NGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDK-RANPNAR 390          

HSP 7 Score: 54.6842 bits (130), Expect = 1.768e-7
Identity = 27/61 (44.26%), Postives = 39/61 (63.93%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPN 697
            G T L++AC    + +V+ LL+ GANVN+KTK+G T LH +A+     I+ +LL   A PN
Sbjct:  724 GYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPN 784          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 96.6709 bits (239), Expect = 5.907e-21
Identity = 75/248 (30.24%), Postives = 117/248 (47.18%), Query Frame = 2
Query:  449 VEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
            V+QLL+Q +  N+      + +G T L LA +E    +   LL+ GA+++  TK G T LH +AKY K E+  LLL K+A P+     +   PLH+A         L+     A+ +   +    G   L  A +   +  A  LLE  AD     ++   G  + H A +   +D + LL    A +++ N  G T LH+  +E+  N+ + L +  A  +    M  TPLH+    G  KIV FL+
Sbjct:  498 VQQLLQQGASPNAA-----TTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGK-SGLTPLHVAAHYDNQKVALLLLDQGASPHAAAK---NGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQ---GIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLL 733          

HSP 2 Score: 93.5893 bits (231), Expect = 7.388e-20
Identity = 75/262 (28.63%), Postives = 120/262 (45.80%), Query Frame = 2
Query:  416 MNCSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNG-RLQIDSEGMNSLIH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLID 1195
            ++C  ++    V ++L     + S P +  +  G + L +A + + L  V  LL+    V+  T D LTALH +A     ++ K+LL K A PN    +  + PLH+AC++       I  +    K+G  +Q  +E   + IH A  +G V    +L+   A       R   G+TA H A R    + ++ L    A ++ +    QT LHI       +IV+ L    AS N       TPLH+AA +G   +  FL+D
Sbjct:  288 LHCGARSGHEQVVEMLL----DRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPN-AKALNGFTPLHIACKKN-----RIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVR---GETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLD 536          

HSP 3 Score: 92.0485 bits (227), Expect = 2.213e-19
Identity = 78/282 (27.66%), Postives = 123/282 (43.62%), Query Frame = 2
Query:  443 NTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRR----------------TIPPPGLISALLKATKNGRLQIDS--------------EGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            N V QL+   +  N+  N++    GET L +A +  +  +V  L++ GA V +K KD  T LH SA+  K +IV+ LL + A PN     + Y PLHLA R                 +I      + L  A K G+L++ S               G+  L  A        A  LL++ A      K   NG T  H A ++  +D    L +  A  +     G   +H+  +E   ++V  L S  A+ N+ +    TPLH+AA++    + E L+++
Sbjct:  430 NIVSQLMHHGASPNTT-NVR----GETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAA-TTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAK---NGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQ 702          

HSP 4 Score: 89.7373 bits (221), Expect = 1.059e-18
Identity = 73/238 (30.67%), Postives = 113/238 (47.48%), Query Frame = 2
Query:  521 TLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRL-QIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            T L +A K     +V  LL+ GA +++KT+DGLT LH  A+   E++V++LL ++A P +        PLH+A +       L    L    N  +  + ++ + +L  A   G    AK LL+K A       + LNG T  H AC++  +  ++LL    A I      G T +H+       NIV  L  + AS N  +    T LH+AA  G  ++V +L+      V A+ KD
Sbjct:  253 TPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSA-PILSKTKNGLSPLHMATQGD----HLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKAS---PNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQD-GAQVEAKAKD 481          

HSP 5 Score: 85.8853 bits (211), Expect = 2.075e-17
Identity = 68/230 (29.57%), Postives = 110/230 (47.83%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQ--IDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            G   L LA KE  + +V  LL+  ANV++ TK G TALH ++   + E+VK+L++  A+ N   +   + PL++A +        +  +     NG  Q     +G   L  A++ G       LLE D       K +L    A H A R+ D  A  LL   +   D+++  G T LHI     + N+   L +  A+ +     D TPLH+A+++G   +V+ L+D+
Sbjct:   57 GLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVN-AQSQNGFTPLYMAAQEN-----HLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDT----KGKVRL---PALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDR 273          

HSP 6 Score: 81.6481 bits (200), Expect = 5.441e-16
Identity = 61/236 (25.85%), Postives = 100/236 (42.37%), Query Frame = 2
Query:  491 PNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            PN K  N G T L +ACK+N++ +++ LL+ GA++ + T+ GLT +H +A      IV  L+   A PN   N+     LH+A R                                     G     + L++  A ++   K   +  T  H + R    D ++ L    A  +   + G T LH+   E  E++  +L  + AS +I      TPLH+AA+ G  ++   L+ K
Sbjct:  376 PNAKALN-GFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTT-NVRGETALHMAARS------------------------------------GQAEVVRYLVQDGAQVEAKAK---DDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQK 570          

HSP 7 Score: 53.1434 bits (126), Expect = 5.623e-7
Identity = 27/61 (44.26%), Postives = 37/61 (60.66%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPN 697
            G T L + C    + IV+ LL+  A VN+KTK+G TALH +A+     I+ +LL  NA PN
Sbjct:  713 GYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPN 773          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 96.6709 bits (239), Expect = 6.710e-21
Identity = 75/248 (30.24%), Postives = 117/248 (47.18%), Query Frame = 2
Query:  449 VEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
            V+QLL+Q +  N+      + +G T L LA +E    +   LL+ GA+++  TK G T LH +AKY K E+  LLL K+A P+     +   PLH+A         L+     A+ +   +    G   L  A +   +  A  LLE  AD     ++   G  + H A +   +D + LL    A +++ N  G T LH+  +E+  N+ + L +  A  +    M  TPLH+    G  KIV FL+
Sbjct:  498 VQQLLQQGASPNAA-----TTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGK-SGLTPLHVAAHYDNQKVALLLLDQGASPHAAAK---NGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQ---GIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLL 733          

HSP 2 Score: 93.2041 bits (230), Expect = 7.944e-20
Identity = 75/262 (28.63%), Postives = 120/262 (45.80%), Query Frame = 2
Query:  416 MNCSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNG-RLQIDSEGMNSLIH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLID 1195
            ++C  ++    V ++L     + S P +  +  G + L +A + + L  V  LL+    V+  T D LTALH +A     ++ K+LL K A PN    +  + PLH+AC++       I  +    K+G  +Q  +E   + IH A  +G V    +L+   A       R   G+TA H A R    + ++ L    A ++ +    QT LHI       +IV+ L    AS N       TPLH+AA +G   +  FL+D
Sbjct:  288 LHCGARSGHEQVVEMLL----DRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPN-AKALNGFTPLHIACKKN-----RIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVR---GETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLD 536          

HSP 3 Score: 92.0485 bits (227), Expect = 2.253e-19
Identity = 78/282 (27.66%), Postives = 123/282 (43.62%), Query Frame = 2
Query:  443 NTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRR----------------TIPPPGLISALLKATKNGRLQIDS--------------EGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            N V QL+   +  N+  N++    GET L +A +  +  +V  L++ GA V +K KD  T LH SA+  K +IV+ LL + A PN     + Y PLHLA R                 +I      + L  A K G+L++ S               G+  L  A        A  LL++ A      K   NG T  H A ++  +D    L +  A  +     G   +H+  +E   ++V  L S  A+ N+ +    TPLH+AA++    + E L+++
Sbjct:  430 NIVSQLMHHGASPNTT-NVR----GETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAA-TTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAK---NGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQ 702          

HSP 4 Score: 89.7373 bits (221), Expect = 1.158e-18
Identity = 73/238 (30.67%), Postives = 113/238 (47.48%), Query Frame = 2
Query:  521 TLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRL-QIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            T L +A K     +V  LL+ GA +++KT+DGLT LH  A+   E++V++LL ++A P +        PLH+A +       L    L    N  +  + ++ + +L  A   G    AK LL+K A       + LNG T  H AC++  +  ++LL    A I      G T +H+       NIV  L  + AS N  +    T LH+AA  G  ++V +L+      V A+ KD
Sbjct:  253 TPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSA-PILSKTKNGLSPLHMATQGD----HLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKAS---PNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQD-GAQVEAKAKD 481          

HSP 5 Score: 85.8853 bits (211), Expect = 2.131e-17
Identity = 68/230 (29.57%), Postives = 110/230 (47.83%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQ--IDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            G   L LA KE  + +V  LL+  ANV++ TK G TALH ++   + E+VK+L++  A+ N   +   + PL++A +        +  +     NG  Q     +G   L  A++ G       LLE D       K +L    A H A R+ D  A  LL   +   D+++  G T LHI     + N+   L +  A+ +     D TPLH+A+++G   +V+ L+D+
Sbjct:   57 GLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVN-AQSQNGFTPLYMAAQEN-----HLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDT----KGKVRL---PALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDR 273          

HSP 6 Score: 81.2629 bits (199), Expect = 6.108e-16
Identity = 61/236 (25.85%), Postives = 100/236 (42.37%), Query Frame = 2
Query:  491 PNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            PN K  N G T L +ACK+N++ +++ LL+ GA++ + T+ GLT +H +A      IV  L+   A PN   N+     LH+A R                                     G     + L++  A ++   K   +  T  H + R    D ++ L    A  +   + G T LH+   E  E++  +L  + AS +I      TPLH+AA+ G  ++   L+ K
Sbjct:  376 PNAKALN-GFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTT-NVRGETALHMAARS------------------------------------GQAEVVRYLVQDGAQVEAKAK---DDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQK 570          

HSP 7 Score: 53.1434 bits (126), Expect = 5.956e-7
Identity = 27/61 (44.26%), Postives = 37/61 (60.66%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPN 697
            G T L + C    + IV+ LL+  A VN+KTK+G TALH +A+     I+ +LL  NA PN
Sbjct:  713 GYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPN 773          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 96.6709 bits (239), Expect = 7.048e-21
Identity = 75/248 (30.24%), Postives = 117/248 (47.18%), Query Frame = 2
Query:  449 VEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
            V+QLL+Q +  N+      + +G T L LA +E    +   LL+ GA+++  TK G T LH +AKY K E+  LLL K+A P+     +   PLH+A         L+     A+ +   +    G   L  A +   +  A  LLE  AD     ++   G  + H A +   +D + LL    A +++ N  G T LH+  +E+  N+ + L +  A  +    M  TPLH+    G  KIV FL+
Sbjct:  509 VQQLLQQGASPNAA-----TTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGK-SGLTPLHVAAHYDNQKVALLLLDQGASPHAAAK---NGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQ---GIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLL 744          

HSP 2 Score: 93.2041 bits (230), Expect = 9.219e-20
Identity = 75/262 (28.63%), Postives = 120/262 (45.80%), Query Frame = 2
Query:  416 MNCSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNG-RLQIDSEGMNSLIH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLID 1195
            ++C  ++    V ++L     + S P +  +  G + L +A + + L  V  LL+    V+  T D LTALH +A     ++ K+LL K A PN    +  + PLH+AC++       I  +    K+G  +Q  +E   + IH A  +G V    +L+   A       R   G+TA H A R    + ++ L    A ++ +    QT LHI       +IV+ L    AS N       TPLH+AA +G   +  FL+D
Sbjct:  299 LHCGARSGHEQVVEMLL----DRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPN-AKALNGFTPLHIACKKN-----RIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVR---GETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLD 547          

HSP 3 Score: 91.6633 bits (226), Expect = 2.836e-19
Identity = 78/282 (27.66%), Postives = 123/282 (43.62%), Query Frame = 2
Query:  443 NTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRR----------------TIPPPGLISALLKATKNGRLQIDS--------------EGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            N V QL+   +  N+  N++    GET L +A +  +  +V  L++ GA V +K KD  T LH SA+  K +IV+ LL + A PN     + Y PLHLA R                 +I      + L  A K G+L++ S               G+  L  A        A  LL++ A      K   NG T  H A ++  +D    L +  A  +     G   +H+  +E   ++V  L S  A+ N+ +    TPLH+AA++    + E L+++
Sbjct:  441 NIVSQLMHHGASPNTT-NVR----GETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAA-TTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAK---NGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQ 713          

HSP 4 Score: 89.3521 bits (220), Expect = 1.419e-18
Identity = 73/238 (30.67%), Postives = 113/238 (47.48%), Query Frame = 2
Query:  521 TLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRL-QIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            T L +A K     +V  LL+ GA +++KT+DGLT LH  A+   E++V++LL ++A P +        PLH+A +       L    L    N  +  + ++ + +L  A   G    AK LL+K A       + LNG T  H AC++  +  ++LL    A I      G T +H+       NIV  L  + AS N  +    T LH+AA  G  ++V +L+      V A+ KD
Sbjct:  264 TPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSA-PILSKTKNGLSPLHMATQGD----HLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKAS---PNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQD-GAQVEAKAKD 492          

HSP 5 Score: 85.5001 bits (210), Expect = 2.584e-17
Identity = 68/228 (29.82%), Postives = 112/228 (49.12%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            G   L LA KE  + +V  LL+  ANV++ TK G TALH ++   + E+VK+L++  A+ N   +   + PL++A +       ++  LL    +  L  + +G   L  A++ G       LLE D       K +L    A H A R+ D  A  LL   +   D+++  G T LHI     + N+   L +  A+ +     D TPLH+A+++G   +V+ L+D+
Sbjct:   68 GLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVN-AQSQNGFTPLYMAAQENHLE--VVRFLLDNGASQSLATE-DGFTPLAVALQQGHDQVVSLLLENDT----KGKVRL---PALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDR 284          

HSP 6 Score: 81.2629 bits (199), Expect = 6.647e-16
Identity = 61/236 (25.85%), Postives = 100/236 (42.37%), Query Frame = 2
Query:  491 PNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            PN K  N G T L +ACK+N++ +++ LL+ GA++ + T+ GLT +H +A      IV  L+   A PN   N+     LH+A R                                     G     + L++  A ++   K   +  T  H + R    D ++ L    A  +   + G T LH+   E  E++  +L  + AS +I      TPLH+AA+ G  ++   L+ K
Sbjct:  387 PNAKALN-GFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTT-NVRGETALHMAARS------------------------------------GQAEVVRYLVQDGAQVEAKAK---DDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQK 581          

HSP 7 Score: 53.1434 bits (126), Expect = 6.146e-7
Identity = 27/61 (44.26%), Postives = 37/61 (60.66%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPN 697
            G T L + C    + IV+ LL+  A VN+KTK+G TALH +A+     I+ +LL  NA PN
Sbjct:  724 GYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPN 784          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|G5E8K5|ANK3_MOUSE (Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 5.821e-20
Identity = 75/248 (30.24%), Postives = 117/248 (47.18%), Query Frame = 2
Query:  449 VEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
            V+QLL+Q +  N+      + +G T L LA +E    +   LL+ GA+++  TK G T LH +AKY K E+  LLL K+A P+     +   PLH+A         L+     A+ +   +    G   L  A +   +  A  LLE  AD     ++   G  + H A +   +D + LL    A +++ N  G T LH+  +E+  N+ + L +  A  +    M  TPLH+    G  KIV FL+
Sbjct:  498 VQQLLQQGASPNAA-----TTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGK-SGLTPLHVAAHYDNQKVALLLLDQGASPHAAAK---NGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQ---GIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLL 733          

HSP 2 Score: 93.2041 bits (230), Expect = 7.204e-19
Identity = 75/262 (28.63%), Postives = 120/262 (45.80%), Query Frame = 2
Query:  416 MNCSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNG-RLQIDSEGMNSLIH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLID 1195
            ++C  ++    V ++L     + S P +  +  G + L +A + + L  V  LL+    V+  T D LTALH +A     ++ K+LL K A PN    +  + PLH+AC++       I  +    K+G  +Q  +E   + IH A  +G V    +L+   A       R   G+TA H A R    + ++ L    A ++ +    QT LHI       +IV+ L    AS N       TPLH+AA +G   +  FL+D
Sbjct:  288 LHCGARSGHEQVVEMLL----DRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPN-AKALNGFTPLHIACKKN-----RIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVR---GETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLD 536          

HSP 3 Score: 91.2781 bits (225), Expect = 2.404e-18
Identity = 78/282 (27.66%), Postives = 123/282 (43.62%), Query Frame = 2
Query:  443 NTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRR----------------TIPPPGLISALLKATKNGRLQIDS--------------EGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            N V QL+   +  N+  N++    GET L +A +  +  +V  L++ GA V +K KD  T LH SA+  K +IV+ LL + A PN     + Y PLHLA R                 +I      + L  A K G+L++ S               G+  L  A        A  LL++ A      K   NG T  H A ++  +D    L +  A  +     G   +H+  +E   ++V  L S  A+ N+ +    TPLH+AA++    + E L+++
Sbjct:  430 NIVSQLMHHGASPNTT-NVR----GETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAA-TTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAK---NGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQ 702          

HSP 4 Score: 89.7373 bits (221), Expect = 8.999e-18
Identity = 73/238 (30.67%), Postives = 113/238 (47.48%), Query Frame = 2
Query:  521 TLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRL-QIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            T L +A K     +V  LL+ GA +++KT+DGLT LH  A+   E++V++LL ++A P +        PLH+A +       L    L    N  +  + ++ + +L  A   G    AK LL+K A       + LNG T  H AC++  +  ++LL    A I      G T +H+       NIV  L  + AS N  +    T LH+AA  G  ++V +L+      V A+ KD
Sbjct:  253 TPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSA-PILSKTKNGLSPLHMATQGD----HLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKAS---PNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQD-GAQVEAKAKD 481          

HSP 5 Score: 85.8853 bits (211), Expect = 1.684e-16
Identity = 68/230 (29.57%), Postives = 110/230 (47.83%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQ--IDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            G   L LA KE  + +V  LL+  ANV++ TK G TALH ++   + E+VK+L++  A+ N   +   + PL++A +        +  +     NG  Q     +G   L  A++ G       LLE D       K +L    A H A R+ D  A  LL   +   D+++  G T LHI     + N+   L +  A+ +     D TPLH+A+++G   +V+ L+D+
Sbjct:   57 GLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVN-AQSQNGFTPLYMAAQEN-----HLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDT----KGKVRL---PALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDR 273          

HSP 6 Score: 81.2629 bits (199), Expect = 5.088e-15
Identity = 61/236 (25.85%), Postives = 100/236 (42.37%), Query Frame = 2
Query:  491 PNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            PN K  N G T L +ACK+N++ +++ LL+ GA++ + T+ GLT +H +A      IV  L+   A PN   N+     LH+A R                                     G     + L++  A ++   K   +  T  H + R    D ++ L    A  +   + G T LH+   E  E++  +L  + AS +I      TPLH+AA+ G  ++   L+ K
Sbjct:  376 PNAKALN-GFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTT-NVRGETALHMAARS------------------------------------GQAEVVRYLVQDGAQVEAKAK---DDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQK 570          

HSP 7 Score: 53.1434 bits (126), Expect = 4.507e-6
Identity = 27/61 (44.26%), Postives = 37/61 (60.66%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPN 697
            G T L + C    + IV+ LL+  A VN+KTK+G TALH +A+     I+ +LL  NA PN
Sbjct:  713 GYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPN 773          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q01484|ANK2_HUMAN (Ankyrin-2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=4)

HSP 1 Score: 95.9005 bits (237), Expect = 8.174e-20
Identity = 80/247 (32.39%), Postives = 118/247 (47.77%), Query Frame = 2
Query:  458 LLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            LL Q      + NI+    GET L +A +  ++ +V  LL  GA V+++ ++  T LH +++  K EIV+LLL   A P+       Y PLH++ R       + S LL+A     L    +G   L  A + G++  AK LL++ A      K   NG T  H A    +     LL +  A        G T LHI  ++N   I   L +Y A  NIV     TPLH+A+++G T +V  L+DK
Sbjct:  449 LLLQNGASPDVTNIR----GETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAA-TTNGYTPLHISAREG--QVDVASVLLEAGAAHSLAT-KKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGK---NGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDK 684          

HSP 2 Score: 82.0333 bits (201), Expect = 2.641e-15
Identity = 73/271 (26.94%), Postives = 120/271 (44.28%), Query Frame = 2
Query:  416 MNCSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDK 1228
            ++C+ ++  + V +LL     E   P +  +  G + L +A + + +  V  LL+  A V+  T D LTALH +A      + KLLL K A+PN    +  + PLH+AC++       +  LL         I   G+  +  A  +G +     LL+  A   +   R   G+TA H A R   ++ ++ L    A +D +    QT LHI        IV+ L  + A  +       TPLHI+A +G   +   L++    +  A  K
Sbjct:  303 LHCAARSGHDQVVELLL----ERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPN-ARALNGFTPLHIACKKNRIK---VMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIR---GETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKK 562          

HSP 3 Score: 81.6481 bits (200), Expect = 3.454e-15
Identity = 69/232 (29.74%), Postives = 109/232 (46.98%), Query Frame = 2
Query:  506 SNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSL--IH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
            +  G T L +A K     +V  LL+ G  +++KT+DGLT LH +A+   +++V+LLL + A P +        PLH+A +      G     +K     +  +D   ++ L  +H A   G     K LL+K A+      R LNG T  H AC++  +  ++LL    A I      G T +H+       NIV  L    AS ++ +    T LH+AA  G  ++V  L+
Sbjct:  263 ARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGA-PLLARTKNGLSPLHMAAQ------GDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRAN---PNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLL 484          

HSP 4 Score: 77.7962 bits (190), Expect = 6.620e-14
Identity = 68/239 (28.45%), Postives = 113/239 (47.28%), Query Frame = 2
Query:  506 SNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSF--------GQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            +  G   L LA KE  + +V  LL  G++V+S TK G TALH ++   + E+VK+L+ + A+ N   +   + PL++A +       ++  LL+   N     + +G   L  A++ G       LLE D       K +L    A H A R+ D  +  LL   +   D+Q+          G T LHI     + N+   L +  A+ +       TPLH+A+++G T +V+ L+D+
Sbjct:   61 NQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANIN-AQSQNGFTPLYMAAQEN--HIDVVKYLLENGANQSTATE-DGFTPLAVALQQGHNQAVAILLENDT----KGKVRL---PALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDR 288          

HSP 5 Score: 77.411 bits (189), Expect = 8.342e-14
Identity = 69/242 (28.51%), Postives = 107/242 (44.21%), Query Frame = 2
Query:  506 SNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            +  G T L ++ +E ++ +   LLE GA  +  TK G T LH +AKY   ++ KLLL + A  +         PLH+A         L+     A+ +   +    G   L  A +   +  A  LL   A+  +  K+   G T  H A +    D + LL D  A I +    G T LH+  +E+  N+   L  + A  +    +  TPL +A   G  K+V FL+ K   NV A+ K+
Sbjct:  527 TTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGK-NGLTPLHVAAHYDNQKVALLLLEKGASPHATAK---NGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQ---GVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLL-KQGANVNAKTKN 760          

HSP 6 Score: 70.8626 bits (172), Expect = 1.180e-11
Identity = 73/288 (25.35%), Postives = 116/288 (40.28%), Query Frame = 2
Query:  455 QLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQ-------IDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIV---------------------------------KYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            ++++   KE +  N +  N G T L +A +EN + +V  LLE GAN ++ T+DG T L  + +    + V +LL  +    +     +   LH+A R+       +  LL+   N  +Q           G   L  A   G V  A  LL + A +    +   NG T  H A +R + + +KLL D    ID +   G T LH       + +V                                 K+L  +KA  + V     T LH+AA  G  ++ + L+DK
Sbjct:  111 EVVKVLVKEGANINAQSQN-GFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKV-----RLPALHIAARKDDTKSAAL--LLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTAR---NGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDK 387          

HSP 7 Score: 53.5286 bits (127), Expect = 3.538e-6
Identity = 29/68 (42.65%), Postives = 44/68 (64.71%), Query Frame = 2
Query:  500 KDSNT--GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPN 697
            +D++T  G T L++AC    + +V+ LL+ GANVN+KTK+G T LH +A+     I+ +LL   A PN
Sbjct:  721 QDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPN 788          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|O70511|ANK3_RAT (Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3)

HSP 1 Score: 94.7449 bits (234), Expect = 2.017e-19
Identity = 77/280 (27.50%), Postives = 129/280 (46.07%), Query Frame = 2
Query:  449 VEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNIC--------------DNI------------------TKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
            V+QLL+Q +  N+      + +G T L L+ +E    +   LL+ GA+++  TK G T LH +AKY K E+  LLL K+A P+                DN                     Y PLH+A ++      + ++LL+   +    +  +G+ S+  A + G V     LL ++A++ ++ K   +G T  H A +   ++  ++L +  A +D Q   G T LH+     +  IV +L  + A  N       TPLH AA++G T I+  L+
Sbjct:  523 VQQLLQQGASPNAA-----TTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQM--DIATSLLEYGADAN-AVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNK---SGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLL 791          

HSP 2 Score: 90.5077 bits (223), Expect = 5.216e-18
Identity = 73/262 (27.86%), Postives = 121/262 (46.18%), Query Frame = 2
Query:  416 MNCSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNG-RLQIDSEGMNSLIH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLID 1195
            ++C  ++    V ++L     + + P +  +  G + L +A + + L  V  LL+    V+  T D LTALH +A     ++ K+LL K A+PN    +  + PLH+AC++       I  +    K+G  +Q  +E   + IH A  +G V    +L+   A       R   G+TA H A R    + ++ L    A ++ +    QT LHI       +IV+ L    AS N       TPLH++A +G   +  FL+D
Sbjct:  313 LHCGARSGHEQVVEMLL----DRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPN-AKALNGFTPLHIACKKN-----RIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVR---GETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLD 561          

HSP 3 Score: 90.1225 bits (222), Expect = 6.718e-18
Identity = 77/282 (27.30%), Postives = 123/282 (43.62%), Query Frame = 2
Query:  443 NTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRR----------------TIPPPGLISALLKATKNGRLQIDS--------------EGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            N V QL+   +  N+  N++    GET L +A +  +  +V  L++ GA V +K KD  T LH SA+  K +IV+ LL + A PN     + Y PLHL+ R                 +I      + L  A K G+L++ S               G+  L  A        A  LL++ A      K   NG T  H A ++  +D    L +  A  +     G   +H+  +E   ++V  L S  A+ N+ +    TPLH+AA++    + E L+++
Sbjct:  455 NIVSQLMHHGASPNTT-NVR----GETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAA-TTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAK---NGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQ 727          

HSP 4 Score: 88.9669 bits (219), Expect = 1.687e-17
Identity = 73/238 (30.67%), Postives = 113/238 (47.48%), Query Frame = 2
Query:  521 TLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQ-IDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            T L +A K     +V  LL+ GA +++KT+DGLT LH  A+   E++V++LL + A P +        PLH+A +       L    L    N  +  + ++ + +L  A   G    AK LL+K A+      + LNG T  H AC++  +  ++LL    A I      G T +H+       NIV  L  + AS N  +    T LH+AA  G  ++V +L+      V A+ KD
Sbjct:  278 TPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAA-PILSKTKNGLSPLHMATQGD----HLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKAN---PNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQD-GAQVEAKAKD 506          

HSP 5 Score: 79.7221 bits (195), Expect = 1.768e-14
Identity = 72/248 (29.03%), Postives = 114/248 (45.97%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQ--IDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSF--------GQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK-FKCNVFARD 1225
            G   L LA KE  + +V  LL+  ANV++ TK G TALH ++   + E+VK+L++  A+ N   +   + PL++A +        +  +     NG  Q     +G   L  A++ G       LLE D       K +L    A H A R+ D  A  LL   +   DI++          G T LHI     + N+   L +  A+ +     D TPLH+A+++G   +V+ L+D+  K +   RD
Sbjct:   74 GLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVN-AQSQNGFTPLYMAAQEN-----HLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDT----KGKVRL---PALHIAARKDDTKAAALLLQNDTNADIESKMVVNRATESGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRD 308          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8C8R3|ANK2_MOUSE (Ankyrin-2 OS=Mus musculus OX=10090 GN=Ank2 PE=1 SV=2)

HSP 1 Score: 94.7449 bits (234), Expect = 2.299e-19
Identity = 79/247 (31.98%), Postives = 117/247 (47.37%), Query Frame = 2
Query:  458 LLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            LL Q      + NI+    GET L +A +  ++ +V  LL  GA V+++ ++  T LH +++  K EIV+LLL   A P+       Y PLH++ R       + S LL+A     L    +G   L  A + G++  AK LL++ A      K   NG T  H A    +     LL +  A        G T LHI  ++N   I   L +Y A  N V     TPLH+A+++G T +V  L+DK
Sbjct:  449 LLLQNGASPDVTNIR----GETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAA-TTNGYTPLHISAREG--QVDVASVLLEAGAAHSLAT-KKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGK---NGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDK 684          

HSP 2 Score: 83.1889 bits (204), Expect = 1.117e-15
Identity = 73/271 (26.94%), Postives = 120/271 (44.28%), Query Frame = 2
Query:  416 MNCSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDK 1228
            ++C+ ++  + V +LL     E   P +  +  G + L +A + + +  V  LL+  A V+  T D LTALH +A      + KLLL K A+PN    +  + PLH+AC++       +  LL         I   G+  +  A  +G +     LL+  A   +   R   G+TA H A R   ++ ++ L    A +D +    QT LHI        IV+ L  + A  +       TPLHI+A +G   +   L++    +  A  K
Sbjct:  303 LHCAARSGHDQVVELLL----ERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPN-ARALNGFTPLHIACKKNRIK---VMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIR---GETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKK 562          

HSP 3 Score: 82.4185 bits (202), Expect = 2.412e-15
Identity = 70/239 (29.29%), Postives = 113/239 (47.28%), Query Frame = 2
Query:  491 PNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDS---EGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            PN +  N G T L +ACK+N++ +++ L++ GA++ + T+ GLT +H +A      IV LLL   A P++  NI     LH+A R      G +  +    +NG L +D+   E    L  A  +G     + LL+  A          NG T  H + R   +D   +L +A A   +    G T LH+  +    ++ K L   +A+A+       TPLH+AA     K+   L++K
Sbjct:  391 PNARALN-GFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVT-NIRGETALHMAAR-----AGQVEVVRCLLRNGAL-VDARAREEQTPLHIASRLGKTEIVQLLLQHMAH---PDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEK 618          

HSP 4 Score: 78.1814 bits (191), Expect = 4.842e-14
Identity = 68/239 (28.45%), Postives = 113/239 (47.28%), Query Frame = 2
Query:  506 SNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSF--------GQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            +  G   L LA KE  + +V  LL  G++V+S TK G TALH ++   + E+VK+L+ + A+ N   +   + PL++A +       ++  LL+   N     + +G   L  A++ G       LLE D       K +L    A H A R+ D  +  LL   +   D+Q+          G T LHI     + N+   L +  A+ +       TPLH+A+++G T +V+ L+D+
Sbjct:   61 NQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANIN-AQSQNGFTPLYMAAQEN--HIDVVKYLLENGANQSTATE-DGFTPLAVALQQGHNQAVAILLENDT----KGKVRL---PALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDR 288          

HSP 5 Score: 77.7962 bits (190), Expect = 7.292e-14
Identity = 69/242 (28.51%), Postives = 106/242 (43.80%), Query Frame = 2
Query:  506 SNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            +  G T L ++ +E ++ +   LLE GA  +  TK G T LH +AKY   ++ KLLL + A  +         PLH+A         L+     A+ +   +    G   L  A +   +  A  LL   A+     K+   G T  H A +    D + LL D  A I +    G T LH+  +E+  N+   L  + A  +    +  TPL +A   G  K+V FL+ K   NV A+ K+
Sbjct:  527 TTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGK-NGLTPLHVAAHYDNQKVALLLLEKGASPHATAK---NGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQ---GVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLL-KQGANVNAKTKN 760          

HSP 6 Score: 73.1738 bits (178), Expect = 2.162e-12
Identity = 74/288 (25.69%), Postives = 116/288 (40.28%), Query Frame = 2
Query:  455 QLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQ-------IDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIV---------------------------------KYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            ++++   KE +  N +  N G T L +A +EN + +V  LLE GAN ++ T+DG T L  + +    + V +LL  +    +     +   LH+A R+       +  LL+   N  +Q           G   L  A   G V  A  LL + A +    +   NG T  H A +R + + +KLL D    ID +   G T LH       + +V                                 K+L  YKA  + V     T LH+AA  G  ++ + L+DK
Sbjct:  111 EVVKVLVKEGANINAQSQN-GFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKV-----RLPALHIAARKDDTKSAAL--LLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTAR---NGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDK 387          

HSP 7 Score: 53.1434 bits (126), Expect = 3.957e-6
Identity = 27/61 (44.26%), Postives = 39/61 (63.93%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPN 697
            G T L++AC    + +V+ LL+ GANVN+KTK+G T LH +A+     I+ +LL   A PN
Sbjct:  728 GYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPN 788          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q12955|ANK3_HUMAN (Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=3)

HSP 1 Score: 92.4337 bits (228), Expect = 1.197e-18
Identity = 79/278 (28.42%), Postives = 129/278 (46.40%), Query Frame = 2
Query:  449 VEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLI-----SALLKATKNG---------RLQID----------------SEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
            V+QLL+Q +  N+      + +G T L L+ +E    +   LL+ GA+++  TK G T LH +AKY K E+  LLL K+A P+     +   PLH+A         L+     ++   A KNG         + Q+D                 +G+ S+  A + G V     LL ++A++ ++ K   +G T  H A +   ++  ++L +  A +D Q   G T LH+     +  IV +L  + A  N       TPLH AA++G T I+  L+
Sbjct:  515 VQQLLQQGASPNAA-----TTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGK-SGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNK---SGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLL 783          

HSP 2 Score: 88.9669 bits (219), Expect = 1.559e-17
Identity = 74/251 (29.48%), Postives = 116/251 (46.22%), Query Frame = 2
Query:  449 VEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNG-RLQIDSEGMNSLIH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLID 1195
            VE LL     + + P +  +  G + L +A + + L  V  LL+    V+  T D LTALH +A     ++ K+LL K A+PN    +  + PLH+AC++       I  +    K+G  +Q  +E   + IH A  +G V    +L+   A       R   G+TA H A R    + ++ L    A ++ +    QT LHI       +IV+ L    AS N       TPLH++A +G   +  FL+D
Sbjct:  317 VEMLL-----DRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPN-AKALNGFTPLHIACKKN-----RIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVR---GETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLD 553          

HSP 3 Score: 87.8113 bits (216), Expect = 3.510e-17
Identity = 73/238 (30.67%), Postives = 113/238 (47.48%), Query Frame = 2
Query:  521 TLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQ-IDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            T L +A K     +V  LL+ GA +++KT+DGLT LH  A+   E++V++LL + A P +        PLH+A +       L    L    N  +  + ++ + +L  A   G    AK LL+K A+      + LNG T  H AC++  +  ++LL    A I      G T +H+       NIV  L  + AS N  +    T LH+AA  G  ++V +L+      V A+ KD
Sbjct:  270 TPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAA-PILSKTKNGLSPLHMATQGD----HLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNA---KALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQD-GAQVEAKAKD 498          

HSP 4 Score: 86.6557 bits (213), Expect = 8.636e-17
Identity = 77/283 (27.21%), Postives = 125/283 (44.17%), Query Frame = 2
Query:  443 NTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRR----------------TIPPPGLISALLKATKNGRLQI-----------DSEGMNSLIHAIEVGA----VTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            N V QL+   +  N+  N++    GET L +A +  +  +V  L++ GA V +K KD  T LH SA+  K +IV+ LL + A PN     + Y PLHL+ R                 +I      + L  A K G+L++           D+ G + L   + V A       A  LL++ A      K   NG T  H A ++  +D    L +  A  +     G   +H+  +E   ++V  L    A+ N+ +    TPLH+AA++    + E L+++
Sbjct:  447 NIVSQLMHHGASPNTT-NVR----GETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAA-TTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLT-PLHVAAHYDNQKVALLLLDQGASPHAAAK---NGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQ 719          

HSP 5 Score: 83.5741 bits (205), Expect = 8.228e-16
Identity = 71/238 (29.83%), Postives = 116/238 (48.74%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK-FKCNVFARD 1225
            G   L LA KE  + +V  LL+  ANV++ TK G TALH ++   + E+VK+L++  A+ N   +   + PL++A +       ++  LL    +  L  + +G   L  A++ G       LLE D       K +L    A H A R+ D  A  LL   +   D+++  G T LHI     + N+   L +  A+ +     D TPLH+A+++G   +V+ L+D+  K +   RD
Sbjct:   74 GLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVN-AQSQNGFTPLYMAAQENHL--EVVKFLLDNGASQSLATE-DGFTPLAVALQQGHDQVVSLLLENDT----KGKVRL---PALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRD 300          

HSP 6 Score: 79.337 bits (194), Expect = 1.984e-14
Identity = 61/236 (25.85%), Postives = 100/236 (42.37%), Query Frame = 2
Query:  491 PNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            PN K  N G T L +ACK+N++ +++ LL+ GA++ + T+ GLT +H +A      IV  L+   A PN   N+     LH+A R                                     G     + L++  A ++   K   +  T  H + R    D ++ L    A  +   + G T LH+   E  E++  +L  + AS +I      TPLH+AA+ G  ++   L+ K
Sbjct:  393 PNAKALN-GFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTT-NVRGETALHMAARS------------------------------------GQAEVVRYLVQDGAQVEAKAK---DDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQK 587          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A267DZS7 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025367g1 PE=3 SV=1)

HSP 1 Score: 269.24 bits (687), Expect = 1.684e-76
Identity = 131/274 (47.81%), Postives = 187/274 (68.25%), Query Frame = 2
Query:  410 KIMNCSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            +I+  + + EW  VE LLR+   +    +  D  +GET LM+ACK+NKLVIVDRLLE GA+V+ K+ DG T LH++++++K++++KLLLS+ ADP+    +    PLH AC+RT      +  LLKAT+NGRL  D      L +A+E G     KELL++D + Q+  K+  NG+TA H A  R+D++AIK+LCDA A +++QN+ G T LHI   E DE  +K+ H+ KA A+++D  DR+PLH+AAE+G T++VE LIDKFKCNV AR KD
Sbjct:  181 RILLFAKRGEWANVESLLRKGDFQPGDVSEADEVSGETPLMMACKDNKLVIVDRLLENGASVSDKSSDGRTPLHFASQFAKDDVIKLLLSRKADPSQPGGVKNQTPLHYACQRTQAALPAVQLLLKATRNGRLLPDKVDNIPLFYAVEQGNAVVVKELLDRDTEAQVKWKKSFNGETALHIAASRKDMEAIKILCDAGAEVNVQNNDGLTPLHISAHEGDETAIKFFHTCKADASLLDKFDRSPLHMAAERGQTRVVELLIDKFKCNVLARTKD 454          

HSP 2 Score: 73.1738 bits (178), Expect = 6.321e-10
Identity = 75/264 (28.41%), Postives = 113/264 (42.80%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPP--PGLI--SALLKAT-KNGRLQI-------------------------DSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDR-TPLHIAAEKGFTKIVEFLIDKFKCNV 1213
            G   L LA K N   +V  LL + A VN+K+K+  T LH +A+    E+V +LL ++        +    PLHLA +R        L+  SA  KAT  NG+  +                          ++GM     A   G+++   ELL  + ++    K K NG TA H A +      +KLL +A A    +N  G T LH+  +     +++ L   K    I       TPLHIAA  G    V+ +++K   N+
Sbjct:  779 GFAALHLAAKNNNANVVRALLRMNAFVNAKSKECYTPLHLAAQEGHNEVVLILLKQDGVEVDARTLHSKTPLHLAAQRGHKEVCETLVDHSADCKATDNNGQTPLHLAAEHDRSHVVKMFLRKKDIVTLASAKGMTCAHIAASKGSISVINELLRSNRNLLCTGKIKTNGCTALHLAAQEGHERVVKLLVEAGASPSDENIDGMTPLHLAAQNGHSKVLQALKE-KVDLRIASRKSGLTPLHIAAHAGKQDFVQEILNKVPANL 1041          

HSP 3 Score: 68.9366 bits (167), Expect = 1.209e-8
Identity = 74/290 (25.52%), Postives = 123/290 (42.41%), Query Frame = 2
Query:  407 SKIMNCS----MKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIP----------PPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEA-PIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            +K M C+     K   + + +LLR  S  N L   K    G T L LA +E    +V  L+E GA+ + +  DG+T LH +A+    ++++ L  K  D  I    +   PLH+A                P  L S   K     +  +   G   L  A + G  +  + LL   + ++++     +G    H A +  + +   LL   +   I + +S G+T LH    +   ++   L    A  N  D+ +  PLH AA+ G  ++++ L+D  K N  A  KD
Sbjct:  910 AKGMTCAHIAASKGSISVINELLR--SNRNLLCTGKIKTNGCTALHLAAQEGHERVVKLLVEAGASPSDENIDGMTPLHLAAQNGHSKVLQALKEK-VDLRIASRKSGLTPLHIAAHAGKQDFVQEILNKVPANLASIKPKDYNLFKEMVSDYGFTPLHLASQSGHESLVRYLLNSTS-VKVDSATIKHGMIPLHLAAQNGETNVASLLLSRDTNQIRLADSHGRTALHWAANKGHYDMTALLVGQGADVNGRDHSNWAPLHFAAKMGHLRVMQLLVDS-KANCEAETKD 1194          

HSP 4 Score: 63.5438 bits (153), Expect = 7.246e-7
Identity = 74/257 (28.79%), Postives = 109/257 (42.41%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTA---CRRRDLDAI-------KLLCDAEAPIDIQNSFGQTGLHICVEEN---------DENIVKYLHSYKASANI-VDNMDRTPLHIAAEKG----FTKIVEFLIDKFKCNV 1213
            G   L  A K     +V  LL+ GANVN++TKD LTALH +       +V+ LL   A  +      +  PLHLA  RT         LLK+  +   + +  G   L  A + G +   + LL++  D     +    G++  H A   CR+    AI       K   DA   +++ N  G+T LH   E           D ++VK L  Y+   ++     + TPLH  A  G      +IV+FL  K +  V
Sbjct:  488 GGVCLHAAAKSGHASVVRGLLDKGANVNARTKDKLTALHAAVACGHPHVVETLLGFGASVDFKGGEDEDTPLHLAA-RTRGGERCAEMLLKSGADVN-RTNRLGQTPLHTAAKGGNLNMLRALLDEGGD---PTRVCQQGNSPLHMAARHCRQAVAAAIIEHVTQTKSRHDAVNLVNLGNKEGETALHYAAELTKEKARTDFEDTDLVKLLLRYEGDVSVQTKYTNETPLHYCARSGNEDILLEIVKFLDHKIQLVV 739          

HSP 5 Score: 62.7734 bits (151), Expect = 1.020e-6
Identity = 75/282 (26.60%), Postives = 120/282 (42.55%), Query Frame = 2
Query:  500 KDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNS---LIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTAC------------RRRDL----DAIKLLC----DAEAPIDIQNSF----------------GQTGLHICVEENDENIVKYLHSYKASANI--VDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFAR 1222
            K +  G + L++A    +  IVD LL   A V+     G  ALH +AK +   +V+ LL  NA  N   +   Y PLHLA +      G    +L   K   +++D+  ++S   L  A + G     + L++  AD +       NG T  H A             R++D+     A  + C     ++  I + N                  G T LH+  +E  E +VK L    AS +   +D M  TPLH+AA+ G +K+++ L +K    + +R
Sbjct:  741 KQTTNGWSPLLIASDCGRDGIVDILLRKHARVDVFDTKGFAALHLAAKNNNANVVRALLRMNAFVN-AKSKECYTPLHLAAQE-----GHNEVVLILLKQDGVEVDARTLHSKTPLHLAAQRGHKEVCETLVDHSADCKATDN---NGQTPLHLAAEHDRSHVVKMFLRKKDIVTLASAKGMTCAHIAASKGSISVINELLRSNRNLLCTGKIKTNGCTALHLAAQEGHERVVKLLVEAGASPSDENIDGM--TPLHLAAQNGHSKVLQALKEKVDLRIASR 1011          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A267GWH2 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig007249g1 PE=3 SV=1)

HSP 1 Score: 268.855 bits (686), Expect = 2.637e-76
Identity = 130/274 (47.45%), Postives = 187/274 (68.25%), Query Frame = 2
Query:  410 KIMNCSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            +I+  + + EW  +E LLR+   +    +  D  +GET LM+ACK+NKLVIVDRLLE GA+V+ K+ DG T LH++++++K++++KLLLS+ ADP+    +    PLH AC+RT      +  LLKAT+NGRL  D      L +A+E G     KELL++D + Q+  K+  NG+TA H A  R+D++AIK+LCDA A +++QN+ G T LHI   E DE  +K+ H+ KA A+++D  DR+PLH+AAE+G T++VE LIDKFKCNV AR KD
Sbjct:  181 RILLFAKRGEWANIESLLRKGDFQPGDVSEADEVSGETPLMMACKDNKLVIVDRLLENGASVSDKSSDGRTPLHFASQFAKDDVIKLLLSRKADPSQPGGVKNQTPLHYACQRTQAALPAVQLLLKATRNGRLLPDKVDNIPLFYAVEQGNAVVVKELLDRDTEAQVKWKKSFNGETALHIAASRKDMEAIKILCDAGAEVNVQNNDGLTPLHISAHEGDETAIKFFHTCKADASLLDKFDRSPLHMAAERGQTRVVELLIDKFKCNVLARTKD 454          

HSP 2 Score: 74.3294 bits (181), Expect = 2.703e-10
Identity = 75/264 (28.41%), Postives = 113/264 (42.80%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPP--PGLI--SALLKAT-KNGRLQI-------------------------DSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDR-TPLHIAAEKGFTKIVEFLIDKFKCNV 1213
            G   L LA K N   +V  LL + A VN+K+K+  T LH +A+    E+V +LL ++        +    PLHLA +R        L+  SA  KAT  NG+  +                          ++GM     A   G+++   ELL  + ++    K K NG TA H A +      +KLL +A A    +N  G T LH+  +     +++ L   K    I       TPLHIAA  G    V+ +++K   N+
Sbjct:  779 GFAALHLAAKNNHANVVRALLRMNAFVNAKSKECYTPLHLAAQEGHNEVVLILLKQDGSEVDARTLHSKTPLHLAAQRGHKEVCETLVDHSADCKATDNNGQTPLHLAAEHDRSHVVKMFLRKKDLVTLASAKGMTCAHIAASKGSISVINELLRSNRNLLCTGKIKTNGCTALHLAAQEGHERVVKLLVEAGASPSDENIDGMTPLHLAAQNGHSKVLQALKE-KVDLRIASRKSGLTPLHIAAHAGKQDFVQEILNKVPANL 1041          

HSP 3 Score: 68.9366 bits (167), Expect = 1.128e-8
Identity = 74/290 (25.52%), Postives = 123/290 (42.41%), Query Frame = 2
Query:  407 SKIMNCS----MKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIP----------PPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEA-PIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            +K M C+     K   + + +LLR  S  N L   K    G T L LA +E    +V  L+E GA+ + +  DG+T LH +A+    ++++ L  K  D  I    +   PLH+A                P  L S   K     +  +   G   L  A + G  +  + LL   + ++++     +G    H A +  + +   LL   +   I + +S G+T LH    +   ++   L    A  N  D+ +  PLH AA+ G  ++++ L+D  K N  A  KD
Sbjct:  910 AKGMTCAHIAASKGSISVINELLR--SNRNLLCTGKIKTNGCTALHLAAQEGHERVVKLLVEAGASPSDENIDGMTPLHLAAQNGHSKVLQALKEK-VDLRIASRKSGLTPLHIAAHAGKQDFVQEILNKVPANLASIKPKDYNLFKEMVSDYGFTPLHLASQSGHESLVRYLLNSTS-VKVDSATIKHGMIPLHLAAQNGETNVASLLLSRDTNQIRLADSHGRTALHWAANKGHYDMTALLVGQGADVNGRDHSNWAPLHFAAKMGHLRVMQLLVDS-KANCEAETKD 1194          

HSP 4 Score: 63.1586 bits (152), Expect = 7.655e-7
Identity = 74/257 (28.79%), Postives = 109/257 (42.41%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTA---CRRRDLDAI-------KLLCDAEAPIDIQNSFGQTGLHICVEEN---------DENIVKYLHSYKASANI-VDNMDRTPLHIAAEKG----FTKIVEFLIDKFKCNV 1213
            G   L  A K     +V  LL+ GANVN++TKD LTALH +       +V+ LL   A  +      +  PLHLA  RT         LLK+  +   + +  G   L  A + G +   + LL++  D     +    G++  H A   CR+    AI       K   DA   +++ N  G+T LH   E           D ++VK L  Y+   ++     + TPLH  A  G      +IV+FL  K +  V
Sbjct:  488 GGVCLHAAAKSGHASVVRGLLDKGANVNARTKDKLTALHAAVACGHPHVVETLLGFGASVDFKGGEDEDTPLHLAA-RTRGGERCAEMLLKSGADVN-RTNRLGQTPLHTAAKGGNLNMLRALLDEGGD---PTRVCQQGNSPLHMAARHCRQAVAAAIIEHVTQTKSRHDAVNLVNLGNKEGETALHYAAELTKEKARTDFEDTDLVKLLLRYEGDVSVQTKYTNETPLHYCARSGNEDILLEIVKFLDHKIQLVV 739          

HSP 5 Score: 62.3882 bits (150), Expect = 1.515e-6
Identity = 76/282 (26.95%), Postives = 119/282 (42.20%), Query Frame = 2
Query:  500 KDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNS---LIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTAC------------RRRDL----DAIKLLC----DAEAPIDIQNSF----------------GQTGLHICVEENDENIVKYLHSYKASANI--VDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFAR 1222
            K +  G + L++A    +  IVD LL   A V+     G  ALH +AK +   +V+ LL  NA  N   +   Y PLHLA +      G    +L   K    ++D+  ++S   L  A + G     + L++  AD +       NG T  H A             R++DL     A  + C     ++  I + N                  G T LH+  +E  E +VK L    AS +   +D M  TPLH+AA+ G +K+++ L +K    + +R
Sbjct:  741 KQTTNGWSPLLIASDCGRDGIVDILLRKHARVDVFDTKGFAALHLAAKNNHANVVRALLRMNAFVN-AKSKECYTPLHLAAQE-----GHNEVVLILLKQDGSEVDARTLHSKTPLHLAAQRGHKEVCETLVDHSADCKATDN---NGQTPLHLAAEHDRSHVVKMFLRKKDLVTLASAKGMTCAHIAASKGSISVINELLRSNRNLLCTGKIKTNGCTALHLAAQEGHERVVKLLVEAGASPSDENIDGM--TPLHLAAQNGHSKVLQALKEKVDLRIASR 1011          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A267FPR4 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014653g1 PE=3 SV=1)

HSP 1 Score: 268.855 bits (686), Expect = 2.721e-76
Identity = 130/274 (47.45%), Postives = 187/274 (68.25%), Query Frame = 2
Query:  410 KIMNCSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            +I+  + + EW  +E LLR+   +    +  D  +GET LM+ACK+NKLVIVDRLLE GA+V+ K+ DG T LH++++++K++++KLLLS+ ADP+    +    PLH AC+RT      +  LLKAT+NGRL  D      L +A+E G     KELL++D + Q+  K+  NG+TA H A  R+D++AIK+LCDA A +++QN+ G T LHI   E DE  +K+ H+ KA A+++D  DR+PLH+AAE+G T++VE LIDKFKCNV AR KD
Sbjct:  181 RILLFAKRGEWANIESLLRKGDFQPGDVSEADEVSGETPLMMACKDNKLVIVDRLLENGASVSDKSSDGRTPLHFASQFAKDDVIKLLLSRKADPSQPGGVKNQTPLHYACQRTQAALPAVQLLLKATRNGRLLPDKVDNIPLFYAVEQGNAVVVKELLDRDTEAQVKWKKSFNGETALHIAASRKDMEAIKILCDAGAEVNVQNNDGLTPLHISAHEGDETAIKFFHTCKADASLLDKFDRSPLHMAAERGQTRVVELLIDKFKCNVLARTKD 454          

HSP 2 Score: 73.1738 bits (178), Expect = 5.020e-10
Identity = 75/264 (28.41%), Postives = 113/264 (42.80%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPP--PGLI--SALLKAT-KNGRLQI-------------------------DSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDR-TPLHIAAEKGFTKIVEFLIDKFKCNV 1213
            G   L LA K N   +V  LL + A VN+K+K+  T LH +A+    E+V +LL ++        +    PLHLA +R        L+  SA  KAT  NG+  +                          ++GM     A   G+++   ELL  + ++    K K NG TA H A +      +KLL +A A    +N  G T LH+  +     +++ L   K    I       TPLHIAA  G    V+ +++K   N+
Sbjct:  779 GFAALHLAAKNNNANVVRALLRMNAFVNAKSKECYTPLHLAAQEGHNEVVLILLKQDGVEVDARTLHSKTPLHLAAQRGHKEVCETLVDHSADCKATDNNGQTPLHLAAEHDRSHVVKMFLRKKDIVTLASAKGMTCAHIAASKGSISVINELLRSNRNLLCTGKIKTNGCTALHLAAQEGHERVVKLLVEAGASPSDENVDGMTPLHLAAQNGHSKVLQALKE-KVDLRIASRKSGLTPLHIAAHAGKQDFVQEILNKVPANL 1041          

HSP 3 Score: 70.8626 bits (172), Expect = 3.423e-9
Identity = 75/290 (25.86%), Postives = 124/290 (42.76%), Query Frame = 2
Query:  407 SKIMNCS----MKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIP----------PPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEA-PIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            +K M C+     K   + + +LLR  S  N L   K    G T L LA +E    +V  L+E GA+ + +  DG+T LH +A+    ++++ L  K  D  I    +   PLH+A                P  L S   K     +  +   G   L  A + G  +  + LL   + ++++     +G    H A +  + +   LL   +   I + +S G+T LH    +   ++   L    A  N  D+ + TPLH AA+ G  ++++ L+D  K N  A  KD
Sbjct:  910 AKGMTCAHIAASKGSISVINELLR--SNRNLLCTGKIKTNGCTALHLAAQEGHERVVKLLVEAGASPSDENVDGMTPLHLAAQNGHSKVLQALKEK-VDLRIASRKSGLTPLHIAAHAGKQDFVQEILNKVPANLASIKPKDYNLFKDMVSDYGFTPLHLASQSGHESLVRYLLNSTS-VKVDSATIKHGMIPLHLAAQNGETNVASLLLSRDTNQIRLADSHGRTALHWAANKGHYDMTALLVGQGADVNGRDHSNWTPLHFAAKMGHLRVMQLLVDS-KANCEAETKD 1194          

HSP 4 Score: 63.5438 bits (153), Expect = 7.183e-7
Identity = 74/257 (28.79%), Postives = 109/257 (42.41%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTA---CRRRDLDAI-------KLLCDAEAPIDIQNSFGQTGLHICVEEN---------DENIVKYLHSYKASANI-VDNMDRTPLHIAAEKG----FTKIVEFLIDKFKCNV 1213
            G   L  A K     +V  LL+ GANVN++TKD LTALH +       +V+ LL   A  +      +  PLHLA  RT         LLK+  +   + +  G   L  A + G +   + LL++  D     +    G++  H A   CR+    AI       K   DA   +++ N  G+T LH   E           D ++VK L  Y+   ++     + TPLH  A  G      +IV+FL  K +  V
Sbjct:  488 GGVCLHAAAKSGHASVVRGLLDKGANVNARTKDKLTALHAAVACGHPHVVETLLGFGASVDFKGGEDEDTPLHLAA-RTRGGERCAEMLLKSGADVN-RTNRLGQTPLHTAAKGGNLNMLRALLDEGGD---PTRVCQQGNSPLHMAARHCRQAVAAAIIEHVTQTKSRHDAVNLVNLGNKEGETALHYAAELTKEKARTDFEDTDLVKLLLRYEGDVSVQTKYTNETPLHYCARSGNEDILLEIVKFLDHKIQLVV 739          

HSP 5 Score: 63.5438 bits (153), Expect = 7.310e-7
Identity = 76/282 (26.95%), Postives = 120/282 (42.55%), Query Frame = 2
Query:  500 KDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNS---LIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTAC------------RRRDL----DAIKLLC----DAEAPIDIQNSF----------------GQTGLHICVEENDENIVKYLHSYKASANI--VDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFAR 1222
            K +  G + L++A    +  IVD LL   A V+     G  ALH +AK +   +V+ LL  NA  N   +   Y PLHLA +      G    +L   K   +++D+  ++S   L  A + G     + L++  AD +       NG T  H A             R++D+     A  + C     ++  I + N                  G T LH+  +E  E +VK L    AS +   VD M  TPLH+AA+ G +K+++ L +K    + +R
Sbjct:  741 KQTTNGWSPLLIASDCGRDGIVDILLRKHARVDVFDTKGFAALHLAAKNNNANVVRALLRMNAFVN-AKSKECYTPLHLAAQE-----GHNEVVLILLKQDGVEVDARTLHSKTPLHLAAQRGHKEVCETLVDHSADCKATDN---NGQTPLHLAAEHDRSHVVKMFLRKKDIVTLASAKGMTCAHIAASKGSISVINELLRSNRNLLCTGKIKTNGCTALHLAAQEGHERVVKLLVEAGASPSDENVDGM--TPLHLAAQNGHSKVLQALKEKVDLRIASR 1011          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A267F7B0 (ANK_REP_REGION domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029072g1 PE=4 SV=1)

HSP 1 Score: 267.314 bits (682), Expect = 9.492e-76
Identity = 132/275 (48.00%), Postives = 181/275 (65.82%), Query Frame = 2
Query:  407 SKIMNCSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
             +++    + EW  VE  LR+           +  +GET LM+AC++NKLVIVDRLLE GA V  K  DG TALH++ +Y+K++I+KLLL++ ADPN      +  PLH AC+R+      +  L+K TKNGRL  D  G   L +A++ G     KELL++D D+Q+  +   +G+TA H A  +RDL+ +K+LCD+ A I+ QN+ GQT LHI   E DE +V++LHS KA A+I+D  DR+PLH+AAE+G TKIVE LIDKFKCNV AR KD
Sbjct:  162 GRVLQHCCRGEWANVEAQLRKGDFHPWELTEAEEGSGETPLMMACRDNKLVIVDRLLESGAGVFEKCSDGRTALHFAGQYAKDDIIKLLLARKADPNQTGGPLEQTPLHYACQRSQSALPAVLTLIKVTKNGRLVTDKPGNIPLYYAVDSGNALVMKELLDRDTDVQVRWRHGASGNTALHVAAGKRDLEMVKILCDSGADINAQNNVGQTPLHISANEGDEAVVRFLHSNKADASILDKQDRSPLHMAAERGQTKIVELLIDKFKCNVLARTKD 436          

HSP 2 Score: 78.5666 bits (192), Expect = 1.016e-11
Identity = 82/306 (26.80%), Postives = 133/306 (43.46%), Query Frame = 2
Query:  413 IMNCSMKNEWNTV--------EQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPP--PGLI--SALLKAT-KNGRLQI-------------------------DSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDR-TPLHIAAEKGFTKIVEFLIDKFKCNV 1213
            ++N    N W+ +        E +++   K+++  ++ D+  G   L LA K N   +V  LL + A VN+K+K+  T LH +A+    E+VKLLL ++        +    PLHLA +R        L+  +A  KAT  NG+  +                          ++GM     A   G+++   ELL  +  +    K K NG TA H A +      ++LL +A A    +NS G T LH+  +     +++ L   K    I       TPLHIAA  G  + V+ ++ K   N+
Sbjct:  720 VVNRQSSNGWSPLLIASDCGREGIVQILLKKHARVDVFDTK-GFAALHLAAKNNHANVVRSLLRMNAFVNAKSKECYTPLHLAAQEGHNEVVKLLLKQDGVEVDARTLHSKTPLHLAAQRGHKEVCETLVDHNADTKATDNNGQTPLHLAAEHDKSHVVKMFLRKKDIVTLASAKGMTCAHIAASKGSISVINELLRSNRSLLCTGKIKTNGCTALHLAAQEGHEKVVRLLVEAGASPSEENSEGLTPLHLAAQSGHSKVLQALKE-KVDLRIASKKSGLTPLHIAAHAGKQEFVQEILTKVPANL 1023          

HSP 3 Score: 68.1662 bits (165), Expect = 2.108e-8
Identity = 75/290 (25.86%), Postives = 120/290 (41.38%), Query Frame = 2
Query:  407 SKIMNCS----MKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRR----------TIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCD-AEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            +K M C+     K   + + +LLR  S  + L   K    G T L LA +E    +V  L+E GA+ + +  +GLT LH +A+    ++++ L  K  D  I    +   PLH+A             T  P  L S   K     +  +   G   L  A + G  +  + LL     ++++     +G    H A +    +   LL       + + +S G+T LH    +   ++   L       N  D  + TPLH AA+ G  ++V+ LID  K N  A  KD
Sbjct:  892 AKGMTCAHIAASKGSISVINELLR--SNRSLLCTGKIKTNGCTALHLAAQEGHEKVVRLLVEAGASPSEENSEGLTPLHLAAQSGHSKVLQALKEK-VDLRIASKKSGLTPLHIAAHAGKQEFVQEILTKVPANLASLKPKDHSLVKEMVADYGFTPLHLASQSGHESLVRYLLNSTG-VKVDSATIKHGMIPLHLAAQNGQTNVASLLLSRGTNQVRLADSHGRTSLHWAANKGHYDMAALLVGQGGDVNCRDQNNWTPLHYAAKMGHLRVVQLLIDS-KANCEAETKD 1176          

HSP 4 Score: 64.6994 bits (156), Expect = 2.743e-7
Identity = 83/298 (27.85%), Postives = 117/298 (39.26%), Query Frame = 2
Query:  488 LPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACR-----------------------------RTIPPPGLISALLK--ATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLE--------KDADIQMNKKRKLNGDTAFHTACRRR---------DLDAIKLLCDAEAPIDIQNSF-GQTGLHICVEENDEN----IVKYL-HSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKF-KCNVF 1216
            +PN     +G   L  A K     +V  LLE GANVN+ TKD LTALH +       +V+ LL   A  ++     +  PLHLA R                              T    G +  LL   A      ++  +G + L  A        AK ++E         DA   +N   K  G+TA H A             D D +KLL   E  I +   F  +T LH C    +E+    IVK+L H  +   N   +   +PL IA++ G   IV+ L+ K  + +VF
Sbjct:  465 MPN----KSGGVCLHAAAKSGHASVVRSLLEKGANVNAVTKDRLTALHEAVARGHPAVVETLLGFGAQVDVKGGEEEDTPLHLAARTSGGERCAEMLLKSGANVNKANRLGQTPLHTAAKGGNVDMLLALLAEAGDPTRVCQQGNSPLHLAARHCRYPVAKAIIEHVESTKSHHDAVHLVNLGNK-EGETALHYAAELSKDKAGGDFDDTDLVKLLLRYEGDISVPTKFTAETPLHYCARSGNEDILLEIVKFLDHRIQLVVNRQSSNGWSPLLIASDCGREGIVQILLKKHARVDVF 757          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A267DZ63 (ANK_REP_REGION domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005281g1 PE=4 SV=1)

HSP 1 Score: 262.692 bits (670), Expect = 3.734e-74
Identity = 131/275 (47.64%), Postives = 180/275 (65.45%), Query Frame = 2
Query:  407 SKIMNCSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
             +++    + EW  VE  LR+           +  +GET LM+AC++NKLVIVDRLLE GA V  K  DG TALH++ +Y+K++I+KLLL++ ADPN      +   LH AC+R+      +  L+K TKNGRL  D  G   L +A++ G     KELL++D D+Q+  +   +G+TA H A  +RDL+ +K+LCD+ A I+ QN+ GQT LHI   E DE +V++LHS KA A+I+D  DR+PLH+AAE+G TKIVE LIDKFKCNV AR KD
Sbjct:  162 GRVLQHCRRGEWANVEAQLRKGDFHPWELAEAEEGSGETPLMMACRDNKLVIVDRLLESGAGVFEKCSDGRTALHFAGQYAKDDIIKLLLARKADPNQTGGPLEQTSLHYACQRSQSALPAVLTLIKVTKNGRLVTDKPGNIPLYYAVDSGNALVMKELLDRDTDVQVRWRHGASGNTALHVAAGKRDLEMVKILCDSGADINAQNNAGQTPLHISANEGDEAVVRFLHSNKADASILDKQDRSPLHMAAERGQTKIVELLIDKFKCNVLARTKD 436          

HSP 2 Score: 78.5666 bits (192), Expect = 9.873e-12
Identity = 82/306 (26.80%), Postives = 133/306 (43.46%), Query Frame = 2
Query:  413 IMNCSMKNEWNTV--------EQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPP--PGLI--SALLKAT-KNGRLQI-------------------------DSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDR-TPLHIAAEKGFTKIVEFLIDKFKCNV 1213
            ++N    N W+ +        E +++   K+++  ++ D+  G   L LA K N   +V  LL + A VN+K+K+  T LH +A+    E+VKLLL ++        +    PLHLA +R        L+  +A  KAT  NG+  +                          ++GM     A   G+++   ELL  +  +    K K NG TA H A +      ++LL +A A    +NS G T LH+  +     +++ L   K    I       TPLHIAA  G  + V+ ++ K   N+
Sbjct:  720 VVNRQSSNGWSPLLIASDCGREGIVQILLKKHARVDVFDTK-GFAALHLAAKNNHANVVRSLLRMNAFVNAKSKECYTPLHLAAQEGHNEVVKLLLKQDGVEVDARTLHSKTPLHLAAQRGHKEVCETLVDHNADTKATDNNGQTPLHLAAEHDKSHVVKMFLRKKDIVTLASAKGMTCAHIAASKGSISVINELLRSNRSLLCTGKIKTNGCTALHLAAQEGHEKVVRLLVEAGASPSEENSEGLTPLHLAAQSGHSKVLQALKE-KVDLRIASKKSGLTPLHIAAHAGKQEFVQEILTKVPANL 1023          

HSP 3 Score: 68.1662 bits (165), Expect = 2.200e-8
Identity = 75/290 (25.86%), Postives = 120/290 (41.38%), Query Frame = 2
Query:  407 SKIMNCS----MKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRR----------TIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCD-AEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            +K M C+     K   + + +LLR  S  + L   K    G T L LA +E    +V  L+E GA+ + +  +GLT LH +A+    ++++ L  K  D  I    +   PLH+A             T  P  L S   K     +  +   G   L  A + G  +  + LL     ++++     +G    H A +    +   LL       + + +S G+T LH    +   ++   L       N  D  + TPLH AA+ G  ++V+ LID  K N  A  KD
Sbjct:  892 AKGMTCAHIAASKGSISVINELLR--SNRSLLCTGKIKTNGCTALHLAAQEGHEKVVRLLVEAGASPSEENSEGLTPLHLAAQSGHSKVLQALKEK-VDLRIASKKSGLTPLHIAAHAGKQEFVQEILTKVPANLASLKPKDHSLVKEMVADYGFTPLHLASQSGHESLVRYLLNSTG-VKVDSATIKHGMIPLHLAAQNGQTNVASLLLSRGTNQVRLADSHGRTSLHWAANKGHYDMAALLVGQGGDVNCRDQNNWTPLHYAAKMGHLRVVQLLIDS-KANCEAETKD 1176          

HSP 4 Score: 64.6994 bits (156), Expect = 2.812e-7
Identity = 83/298 (27.85%), Postives = 117/298 (39.26%), Query Frame = 2
Query:  488 LPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACR-----------------------------RTIPPPGLISALLK--ATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLE--------KDADIQMNKKRKLNGDTAFHTACRRR---------DLDAIKLLCDAEAPIDIQNSF-GQTGLHICVEENDEN----IVKYL-HSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKF-KCNVF 1216
            +PN     +G   L  A K     +V  LLE GANVN+ TKD LTALH +       +V+ LL   A  ++     +  PLHLA R                              T    G +  LL   A      ++  +G + L  A        AK ++E         DA   +N   K  G+TA H A             D D +KLL   E  I +   F  +T LH C    +E+    IVK+L H  +   N   +   +PL IA++ G   IV+ L+ K  + +VF
Sbjct:  465 MPN----KSGGVCLHAAAKSGHASVVRSLLEKGANVNAVTKDRLTALHEAVARGHPAVVETLLGFGAQVDVKGGEDEDTPLHLAARTSGGERCAEMLLKSGANVNKANRLGQTPLHTAAKGGNVDMLLALLAEAGDPTRVCQQGNSPLHLAARHCRYPVAKAIIEHVESTKSHHDAVHLVNLGNK-EGETALHYAAELSKDKAGGDFDDTDLVKLLLRYEGDISVPTKFTAETPLHYCARSGNEDILLEIVKFLDHRVQLVVNRQSSNGWSPLLIASDCGREGIVQILLKKHARVDVF 757          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000016978.2 (serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B-like [Source:NCBI gene;Acc:103025232])

HSP 1 Score: 222.631 bits (566), Expect = 9.154e-64
Identity = 116/275 (42.18%), Postives = 166/275 (60.36%), Query Frame = 2
Query:  410 KIMNCSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLK-ATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            +++   ++ EW  +EQ L+   K +      D  +G +L+M+A +EN+L IV+RLLELG +   K KDG TALH +A +SK+++VKLL ++  DPN         PLH A  R    P ++  LLK + K  RL  D +G   L+ A+E G V   KELL    + Q+  +R  +GDTA H  CR++D++  K+L +  A +D QN  GQT LHI   E DE ++K+ +  KA+ NI D +DR+PLHI AE+G T +VE L +KFK NV AR KD
Sbjct:   14 RLLQLCLRGEWVALEQNLKSLEKGDPEICQTDEESGLSLMMIAVRENRLSIVERLLELGVSPAEKAKDGRTALHIAAAHSKDDLVKLL-ARKVDPNAPGGPKAQLPLHYAASRPAGSPAVVQTLLKLSNKEARLTADKDGCIPLLLAVEAGNVGIIKELLSGQTEPQLQTQRTGHGDTALHICCRKKDVEMAKVLVELGASMDFQNVEGQTPLHIAAWEGDEAMLKFFYQSKANPNISDKLDRSPLHITAERGHTNVVEILTEKFKSNVLARTKD 287          

HSP 2 Score: 70.0922 bits (170), Expect = 2.052e-12
Identity = 74/270 (27.41%), Postives = 123/270 (45.56%), Query Frame = 2
Query:  449 VEQLLRQFSKENS-----LPNIKDSNTGETLLMLACK---------ENKLVIVDRLLELGANVNSKTKD-GLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYY-----PLHLACRRTIPPPGLISALLKATKNGRLQI-DSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDA-EAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
            VE +L   S E S     L   +++ +GET L LA +         E  +VI+  L+E  A++ + T+  G T LHY A+     +++ +L       +   I K+      PL LA  R      ++  LL+   + R+ + D EG+ +L  A E G    A  LL   A +  N K KL G T  H + +      ++LL +  +A +D  +   QT LH+       ++   L + +A     D   +TPLH+AAE   +++V+  +
Sbjct:  471 VEAILNSLSSERSREEAELCVRQENQSGETALHLAAELKNETVHRDEEDVVIIRTLMEYNADITAATRQMGETPLHYCARVGNAAVLQEMLDNVPSSRLQSAINKHSKNGRSPLLLAAERG--HTAVVRVLLE--NSARVDVFDEEGIAALHLAAEQGHDDIADILLSHKAFV--NAKTKL-GLTPLHLSAQSGSARLVRLLVETHQACVDALSLSKQTPLHLAAISGQLDVCSNLLNLRADITATDIHGQTPLHLAAENDHSEVVKLFL 733          

HSP 3 Score: 67.781 bits (164), Expect = 9.944e-12
Identity = 69/257 (26.85%), Postives = 109/257 (42.41%), Query Frame = 2
Query:  488 LPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLC----------DAEAPIDIQNSFGQTGLHICVE---------ENDENIVKYLHSYKASANIVD-NMDRTPLHIAAEKGFTKIVEFLID 1195
            +PN     +G   L  A K     +V  LL  GA+V++ TKDG TALH + +  K ++V++LL   A   +        PLH+A  R      +   LLK+     +  + E   + +H A   GA+   + L E+ AD+    K    G+T  H A        ++ +           +AE  +  +N  G+T LH+  E         E D  I++ L  Y A        M  TPLH  A  G   +++ ++D
Sbjct:  316 MPN----KSGAVCLHAAAKRGHTAVVKALLLKGAHVDATTKDGQTALHIAVQNCKPQVVQMLLGFGAQVQLRGGKDLETPLHVAA-RVKEGEKVAEMLLKS--GAEVNAEQENGETAMHVAARYGALQMMRALTEEGADLTWRSKV---GETPLHVAVHHCHAHMVEAILNSLSSERSREEAELCVRQENQSGETALHLAAELKNETVHRDEEDVVIIRTLMEYNADITAATRQMGETPLHYCARVGNAAVLQEMLD 562          

HSP 4 Score: 65.0846 bits (157), Expect = 7.512e-11
Identity = 66/276 (23.91%), Postives = 123/276 (44.57%), Query Frame = 2
Query:  452 EQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSK------NADPNIC---DNITKYYPLHLACR-------RTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEK--DADIQ--MNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFA 1219
            E LL+  ++ N+     +   GET + +A +   L ++  L E GA++  ++K G T LH +  +    +V+ +L+         +  +C   +N +    LHLA         R      +I  L++   +        G   L +   VG     +E+L+    + +Q  +NK  K NG +    A  R     +++L +  A +D+ +  G   LH+  E+  ++I   L S+KA  N    +  TPLH++A+ G  ++V  L++  +  V A
Sbjct:  406 EMLLKSGAEVNA-----EQENGETAMHVAARYGALQMMRALTEEGADLTWRSKVGETPLHVAVHHCHAHMVEAILNSLSSERSREEAELCVRQENQSGETALHLAAELKNETVHRDEEDVVIIRTLMEYNADITAATRQMGETPLHYCARVGNAAVLQEMLDNVPSSRLQSAINKHSK-NGRSPLLLAAERGHTAVVRVLLENSARVDVFDEEGIAALHLAAEQGHDDIADILLSHKAFVNAKTKLGLTPLHLSAQSGSARLVRLLVETHQACVDA 675          

HSP 5 Score: 53.1434 bits (126), Expect = 4.955e-7
Identity = 59/258 (22.87%), Postives = 112/258 (43.41%), Query Frame = 2
Query:  440 WNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDS---EGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAI-KLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKF 1201
            W   E +L+ F +  + PNI D      L + A + +  V+     +  +NV ++TKDG T LH +++    E     L K   P    N +    LH A +R        +A++KA       +D+   +G  +L  A++       + LL   A +Q+   + L  +T  H A R ++ + + ++L  + A ++ +   G+T +H+        +++ L    A       +  TPLH+A       +VE +++  
Sbjct:  230 WEGDEAMLKFFYQSKANPNISDKLDRSPLHITAERGHTNVVEILTEKFKSNVLARTKDGSTLLHIASQCGHPETALTFLKKGV-PLHMPNKSGAVCLHAAAKRG------HTAVVKALLLKGAHVDATTKDGQTALHIAVQNCKPQVVQMLLGFGAQVQLRGGKDL--ETPLHVAARVKEGEKVAEMLLKSGAEVNAEQENGETAMHVAARYGALQMMRALTEEGADLTWRSKVGETPLHVAVHHCHAHMVEAILNSL 478          

HSP 6 Score: 50.447 bits (119), Expect = 3.395e-6
Identity = 66/245 (26.94%), Postives = 107/245 (43.67%), Query Frame = 2
Query:  500 KDSNTGETLLMLACKENKLVIVDRLLELGANVNSK---TKDGLTALHYSAKYSKEEIVKLLLSKNAD------PNICDNITK--YYPLHLACRRTIPPPGLISALLKATK-NGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            ++ + G T + LA +     I   L+ L A+V  K   +K GLTALH +A + + + V+ +L++ +       P     I++  Y PLHLA +       ++  LL +       + DSEG   L  A   G       LL K A +   + R+  G T  H A     +  +++L    A I+  +  G T LH   +     +V++L    AS     +  RTPL   AE+     V FL+ +
Sbjct:  811 EEDSEGMTAVHLAARSGHTHI---LVVLKASVPLKIISSKTGLTALHVAASFGQVDFVREILTRVSAAIRSELPAGSAGISRDGYTPLHLAAQSG--HESVVRLLLNSPGVQADAETDSEGSTPLHLAACNGHTAVVGLLLSKSASLLHLRDRR--GRTCLHLASANGHVATVRVLLGQGADINQTDKSGCTALHYAGKAGCLEVVRFLVESGASTRSECSAGRTPLQYTAEENHQASVSFLLRR 1048          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000048767.1 (serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B-like [Source:NCBI gene;Acc:103025232])

HSP 1 Score: 222.246 bits (565), Expect = 1.328e-63
Identity = 116/275 (42.18%), Postives = 166/275 (60.36%), Query Frame = 2
Query:  410 KIMNCSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLK-ATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            +++   ++ EW  +EQ L+   K +      D  +G +L+M+A +EN+L IV+RLLELG +   K KDG TALH +A +SK+++VKLL ++  DPN         PLH A  R    P ++  LLK + K  RL  D +G   L+ A+E G V   KELL    + Q+  +R  +GDTA H  CR++D++  K+L +  A +D QN  GQT LHI   E DE ++K+ +  KA+ NI D +DR+PLHI AE+G T +VE L +KFK NV AR KD
Sbjct:   14 RLLQLCLRGEWVALEQNLKSLEKGDPEICQTDEESGLSLMMIAVRENRLSIVERLLELGVSPAEKAKDGRTALHIAAAHSKDDLVKLL-ARKVDPNAPGGPKAQLPLHYAASRPAGSPAVVQTLLKLSNKEARLTADKDGCIPLLLAVEAGNVGIIKELLSGQTEPQLQTQRTGHGDTALHICCRKKDVEMAKVLVELGASMDFQNVEGQTPLHIAAWEGDEAMLKFFYQSKANPNISDKLDRSPLHITAERGHTNVVEILTEKFKSNVLARTKD 287          

HSP 2 Score: 69.707 bits (169), Expect = 2.382e-12
Identity = 74/270 (27.41%), Postives = 123/270 (45.56%), Query Frame = 2
Query:  449 VEQLLRQFSKENS-----LPNIKDSNTGETLLMLACK---------ENKLVIVDRLLELGANVNSKTKD-GLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYY-----PLHLACRRTIPPPGLISALLKATKNGRLQI-DSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDA-EAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
            VE +L   S E S     L   +++ +GET L LA +         E  +VI+  L+E  A++ + T+  G T LHY A+     +++ +L       +   I K+      PL LA  R      ++  LL+   + R+ + D EG+ +L  A E G    A  LL   A +  N K KL G T  H + +      ++LL +  +A +D  +   QT LH+       ++   L + +A     D   +TPLH+AAE   +++V+  +
Sbjct:  471 VEAILNSLSSERSREEAELCVRQENQSGETALHLAAELKNETVHRDEEDVVIIRTLMEYNADITAATRQMGETPLHYCARVGNAAVLQEMLDNVPSSRLQSAINKHSKNGRSPLLLAAERG--HTAVVRVLLE--NSARVDVFDEEGIAALHLAAEQGHDDIADILLSHKAFV--NAKTKL-GLTPLHLSAQSGSARLVRLLVETHQACVDALSLSKQTPLHLAAISGQLDVCSNLLNLRADITATDIHGQTPLHLAAENDHSEVVKLFL 733          

HSP 3 Score: 67.781 bits (164), Expect = 1.105e-11
Identity = 69/257 (26.85%), Postives = 109/257 (42.41%), Query Frame = 2
Query:  488 LPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLC----------DAEAPIDIQNSFGQTGLHICVE---------ENDENIVKYLHSYKASANIVD-NMDRTPLHIAAEKGFTKIVEFLID 1195
            +PN     +G   L  A K     +V  LL  GA+V++ TKDG TALH + +  K ++V++LL   A   +        PLH+A  R      +   LLK+     +  + E   + +H A   GA+   + L E+ AD+    K    G+T  H A        ++ +           +AE  +  +N  G+T LH+  E         E D  I++ L  Y A        M  TPLH  A  G   +++ ++D
Sbjct:  316 MPN----KSGAVCLHAAAKRGHTAVVKALLLKGAHVDATTKDGQTALHIAVQNCKPQVVQMLLGFGAQVQLRGGKDLETPLHVAA-RVKEGEKVAEMLLKS--GAEVNAEQENGETAMHVAARYGALQMMRALTEEGADLTWRSKV---GETPLHVAVHHCHAHMVEAILNSLSSERSREEAELCVRQENQSGETALHLAAELKNETVHRDEEDVVIIRTLMEYNADITAATRQMGETPLHYCARVGNAAVLQEMLD 562          

HSP 4 Score: 65.0846 bits (157), Expect = 8.565e-11
Identity = 66/276 (23.91%), Postives = 123/276 (44.57%), Query Frame = 2
Query:  452 EQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSK------NADPNIC---DNITKYYPLHLACR-------RTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEK--DADIQ--MNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFA 1219
            E LL+  ++ N+     +   GET + +A +   L ++  L E GA++  ++K G T LH +  +    +V+ +L+         +  +C   +N +    LHLA         R      +I  L++   +        G   L +   VG     +E+L+    + +Q  +NK  K NG +    A  R     +++L +  A +D+ +  G   LH+  E+  ++I   L S+KA  N    +  TPLH++A+ G  ++V  L++  +  V A
Sbjct:  406 EMLLKSGAEVNA-----EQENGETAMHVAARYGALQMMRALTEEGADLTWRSKVGETPLHVAVHHCHAHMVEAILNSLSSERSREEAELCVRQENQSGETALHLAAELKNETVHRDEEDVVIIRTLMEYNADITAATRQMGETPLHYCARVGNAAVLQEMLDNVPSSRLQSAINKHSK-NGRSPLLLAAERGHTAVVRVLLENSARVDVFDEEGIAALHLAAEQGHDDIADILLSHKAFVNAKTKLGLTPLHLSAQSGSARLVRLLVETHQACVDA 675          

HSP 5 Score: 52.7582 bits (125), Expect = 5.402e-7
Identity = 59/258 (22.87%), Postives = 112/258 (43.41%), Query Frame = 2
Query:  440 WNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDS---EGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAI-KLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKF 1201
            W   E +L+ F +  + PNI D      L + A + +  V+     +  +NV ++TKDG T LH +++    E     L K   P    N +    LH A +R        +A++KA       +D+   +G  +L  A++       + LL   A +Q+   + L  +T  H A R ++ + + ++L  + A ++ +   G+T +H+        +++ L    A       +  TPLH+A       +VE +++  
Sbjct:  230 WEGDEAMLKFFYQSKANPNISDKLDRSPLHITAERGHTNVVEILTEKFKSNVLARTKDGSTLLHIASQCGHPETALTFLKKGV-PLHMPNKSGAVCLHAAAKRG------HTAVVKALLLKGAHVDATTKDGQTALHIAVQNCKPQVVQMLLGFGAQVQLRGGKDL--ETPLHVAARVKEGEKVAEMLLKSGAEVNAEQENGETAMHVAARYGALQMMRALTEEGADLTWRSKVGETPLHVAVHHCHAHMVEAILNSL 478          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 97.8265 bits (242), Expect = 2.431e-21
Identity = 81/254 (31.89%), Postives = 116/254 (45.67%), Query Frame = 2
Query:  452 EQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLI-----SALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            E +++Q +   + PN  +   GET L +A +  +  +V  LL+ GA V+ K KD  TALH +++  K EIV+LLL K A  +     + Y PLHLA R        +     ++L  ATK        +G   L  A + G +  AK LL+K A      K    G T  H A    +     LL D  A        G T LHI  ++N   I   L  + A  N V     +PLH+AA++G   +V  L+ K
Sbjct:  448 ENIVKQLTHHGASPNTTNVR-GETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAA-TTSGYTPLHLAVREGHQETASLLLEHGASLSAATK--------KGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGK---TGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTK 688          

HSP 2 Score: 93.9745 bits (232), Expect = 3.823e-20
Identity = 77/259 (29.73%), Postives = 117/259 (45.17%), Query Frame = 2
Query:  506 SNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLI-----SALLKATKNG-----------RLQIDS--------------EGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
            + +G T L LA +E        LLE GA++++ TK G T LH +AKY + E  KLLL K A P+     T   PLH+A         L+     ++   A KNG           +L+I +              +G++ L  A + G+V     LL K+A++ M  K   NG T  H A +   +   ++L +  A +D     G T LH+     +  +V +L   +A  N       TPLH AA++G T I+  L+
Sbjct:  531 TTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGK-TGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNK---NGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLL 785          

HSP 3 Score: 90.5077 bits (223), Expect = 5.388e-19
Identity = 71/239 (29.71%), Postives = 117/239 (48.95%), Query Frame = 2
Query:  521 TLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQID---SEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI-DKFKCNVFARD 1225
            T L +A K     +V  LL+ GA +++KTKDGLT LH  A+   E++V++LL + A P +        PLH+A +      G     ++      + +D   ++ + +L  A   G    AK +++K A+      + LNG T  H AC++  +  ++LL    A +      G T +H+      ENIVK L  + AS N  +    T LH+AA  G   +V +L+ +  K ++ A+D
Sbjct:  272 TPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGA-PILSKTKNGLSPLHMATQ------GDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKAN---PNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKD 500          

HSP 4 Score: 88.1965 bits (217), Expect = 3.310e-18
Identity = 79/265 (29.81%), Postives = 119/265 (44.91%), Query Frame = 2
Query:  491 PNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACR-------RTIPPPGL---------ISALLKATKNGRLQI--------------DSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLID 1195
            PN K  N G T L +ACK+N++ +++ LL+ GA++ + T+ GLT +H +A    E IVK L    A PN   N+     LH+A R       R +   G           +AL  A++ G+ +I               + G   L  A+  G   TA  LLE  A +    K+   G T  H A +   ++A KLL    A  D     G T LH+    +++ +   L  + AS +       TPLHIAA+K   +I   L++
Sbjct:  395 PNAKALN-GFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTT-NVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKK---GFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLE 654          

HSP 5 Score: 84.7297 bits (208), Expect = 4.542e-17
Identity = 72/261 (27.59%), Postives = 117/261 (44.83%), Query Frame = 2
Query:  416 MNCSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLID 1195
            ++C  ++    V ++L     +   P +  +  G + L +A + + L  V  LL+    V+  T D LTALH +A     ++ K+++ K A+PN    +  + PLH+AC++      ++  LLK      LQ  +E   + IH A  +G     K+L    A       R   G+TA H A R    D ++ L    A +DI+    QT LHI        IV+ L    A A+       TPLH+A  +G  +    L++
Sbjct:  307 LHCGARSGHEQVVEMLL----DRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPN-AKALNGFTPLHIACKKNRVK--VMELLLK--HGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVR---GETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLE 555          

HSP 6 Score: 84.3445 bits (207), Expect = 6.109e-17
Identity = 72/246 (29.27%), Postives = 124/246 (50.41%), Query Frame = 2
Query:  494 NIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            NI + N G   L LA KE  + +V  LL+LGA+V++ TK G TALH ++   + ++V+ L++  A+ N   +   + PL++A +       ++  LL+   +  +  + +G   L  A++ G       LLE D       K +L    A H A R+ D  +  LL   +   D+++  G T LHI     + N+   L +  A+ + +   D TPLH+AA++G   +V+ L+D+    + A+ KD
Sbjct:   70 NICNQN-GLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVN-AQSQNGFTPLYMAAQENHLE--VVRFLLEHGASQSIATE-DGFTPLAVALQQGHDQVVSLLLENDT----KGKVRL---PALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDR-GAKIDAKTKD 302          

HSP 7 Score: 82.8037 bits (203), Expect = 1.595e-16
Identity = 66/225 (29.33%), Postives = 102/225 (45.33%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFL 1189
            G T L +A K+N+L I   LLE GA  N+ T+ G++ LH +A+    ++V LLL+KNA+ N+  N     PLHLA                       Q D  G+              A+ LL   A++  + K    G T  H AC   ++  +  L + +A I+ +   G T LH   ++   +I+  L  ++ASAN +     T L IA   G+  +V+ L
Sbjct:  633 GYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNM-GNKNGLTPLHLAA----------------------QEDRVGV--------------AEVLLNHGAEVDAHTK---TGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTL 817          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 97.0561 bits (240), Expect = 3.454e-21
Identity = 81/254 (31.89%), Postives = 116/254 (45.67%), Query Frame = 2
Query:  452 EQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLI-----SALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            E +++Q +   + PN  +   GET L +A +  +  +V  LL+ GA V+ K KD  TALH +++  K EIV+LLL K A  +     + Y PLHLA R        +     ++L  ATK        +G   L  A + G +  AK LL+K A      K    G T  H A    +     LL D  A        G T LHI  ++N   I   L  + A  N V     +PLH+AA++G   +V  L+ K
Sbjct:  420 ENIVKQLTHHGASPNTTNVR-GETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAA-TTSGYTPLHLAVREGHQETASLLLEHGASLSAATK--------KGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGK---TGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTK 660          

HSP 2 Score: 93.5893 bits (231), Expect = 4.566e-20
Identity = 77/259 (29.73%), Postives = 117/259 (45.17%), Query Frame = 2
Query:  506 SNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLI-----SALLKATKNG-----------RLQIDS--------------EGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
            + +G T L LA +E        LLE GA++++ TK G T LH +AKY + E  KLLL K A P+     T   PLH+A         L+     ++   A KNG           +L+I +              +G++ L  A + G+V     LL K+A++ M  K   NG T  H A +   +   ++L +  A +D     G T LH+     +  +V +L   +A  N       TPLH AA++G T I+  L+
Sbjct:  503 TTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGK-TGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNK---NGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLL 757          

HSP 3 Score: 90.5077 bits (223), Expect = 4.991e-19
Identity = 71/239 (29.71%), Postives = 117/239 (48.95%), Query Frame = 2
Query:  521 TLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQID---SEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI-DKFKCNVFARD 1225
            T L +A K     +V  LL+ GA +++KTKDGLT LH  A+   E++V++LL + A P +        PLH+A +      G     ++      + +D   ++ + +L  A   G    AK +++K A+      + LNG T  H AC++  +  ++LL    A +      G T +H+      ENIVK L  + AS N  +    T LH+AA  G   +V +L+ +  K ++ A+D
Sbjct:  244 TPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGA-PILSKTKNGLSPLHMATQ------GDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKAN---PNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKD 472          

HSP 4 Score: 87.8113 bits (216), Expect = 4.358e-18
Identity = 79/265 (29.81%), Postives = 119/265 (44.91%), Query Frame = 2
Query:  491 PNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACR-------RTIPPPGL---------ISALLKATKNGRLQI--------------DSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLID 1195
            PN K  N G T L +ACK+N++ +++ LL+ GA++ + T+ GLT +H +A    E IVK L    A PN   N+     LH+A R       R +   G           +AL  A++ G+ +I               + G   L  A+  G   TA  LLE  A +    K+   G T  H A +   ++A KLL    A  D     G T LH+    +++ +   L  + AS +       TPLHIAA+K   +I   L++
Sbjct:  367 PNAKALN-GFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTT-NVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKK---GFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLE 626          

HSP 5 Score: 84.3445 bits (207), Expect = 5.315e-17
Identity = 72/261 (27.59%), Postives = 117/261 (44.83%), Query Frame = 2
Query:  416 MNCSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLID 1195
            ++C  ++    V ++L     +   P +  +  G + L +A + + L  V  LL+    V+  T D LTALH +A     ++ K+++ K A+PN    +  + PLH+AC++      ++  LLK      LQ  +E   + IH A  +G     K+L    A       R   G+TA H A R    D ++ L    A +DI+    QT LHI        IV+ L    A A+       TPLH+A  +G  +    L++
Sbjct:  279 LHCGARSGHEQVVEMLL----DRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPN-AKALNGFTPLHIACKKNR--VKVMELLLK--HGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVR---GETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLE 527          

HSP 6 Score: 82.4185 bits (202), Expect = 2.005e-16
Identity = 66/225 (29.33%), Postives = 102/225 (45.33%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFL 1189
            G T L +A K+N+L I   LLE GA  N+ T+ G++ LH +A+    ++V LLL+KNA+ N+  N     PLHLA                       Q D  G+              A+ LL   A++  + K    G T  H AC   ++  +  L + +A I+ +   G T LH   ++   +I+  L  ++ASAN +     T L IA   G+  +V+ L
Sbjct:  605 GYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNM-GNKNGLTPLHLAA----------------------QEDRVGV--------------AEVLLNHGAEVDAHTK---TGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTL 789          

HSP 7 Score: 77.0258 bits (188), Expect = 1.125e-14
Identity = 72/254 (28.35%), Postives = 124/254 (48.82%), Query Frame = 2
Query:  494 NIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSF--------GQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            NI + N G   L LA KE  + +V  LL+LGA+V++ TK G TALH ++   + ++V+ L++  A+ N   +   + PL++A +       ++  LL+   +  +  + +G   L  A++ G       LLE D       K +L    A H A R+ D  +  LL   +   D+++          G T LHI     + N+   L +  A+ + +   D TPLH+AA++G   +V+ L+D+    + A+ KD
Sbjct:   34 NICNQN-GLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVN-AQSQNGFTPLYMAAQENHLE--VVRFLLEHGASQSIATE-DGFTPLAVALQQGHDQVVSLLLENDT----KGKVRL---PALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDR-GAKIDAKTKD 274          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ank3b (ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2])

HSP 1 Score: 96.6709 bits (239), Expect = 5.573e-21
Identity = 76/258 (29.46%), Postives = 125/258 (48.45%), Query Frame = 2
Query:  455 QLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDK 1228
            ++++Q  +  + P+   + +G T L LA +E    +   LL+ GA++   TK G T LH +AKY K E+  LLL K A P+     +   PLH+A         L+     A+ +   +    G   L  A +   +  A  LLE  AD     ++   G +  H A +  ++D + LL   +A I++ N  G T LH+  +E+  N+ + L ++ A+ +    M  TPLH+A   G  K+V FL+ K +  V A+ K
Sbjct:  460 EIIQQLLQHGACPD-STTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGK-SGLTPLHVAAHYDNQKVALLLLDQGASPHAAAK---NGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQ---GISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPETKMGYTPLHVACHYGNVKMVHFLL-KNQAKVNAKTK 708          

HSP 2 Score: 95.1301 bits (235), Expect = 1.502e-20
Identity = 74/240 (30.83%), Postives = 119/240 (49.58%), Query Frame = 2
Query:  521 TLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQID---SEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            T L +A K     +V  LLE GA +++KTKDGLT LH  A+   E++V++LL + A P +        PLH+A +      G     ++   +  + +D   ++ + +L  A   G    AK +++K A+      + LNG T  H AC++  +  ++LL    A I      G T +H+      ENIV  L ++ AS N  +    T LH+AA  G T++V++L+      V A+ KD
Sbjct:  217 TPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGA-PILSKTKNGLSPLHMATQ------GDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKAN---PNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQN-GAYVDAKSKD 445          

HSP 3 Score: 83.5741 bits (205), Expect = 9.242e-17
Identity = 74/269 (27.51%), Postives = 117/269 (43.49%), Query Frame = 2
Query:  491 PNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICD----------------NITKYY----------------PLHLACRRTIPPPGLISALLKATKNGRL--QIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLID 1195
            PN K  N G T L +ACK+N++ +++ LL+ GA++ + T+ GLT +H +A    E IV  L++  A PN  +                 + KY                 PLH++ R  +  P +I  LL   ++G       + G   L  A   G    A  LL++ A + +  K+   G T  H A +   ++   LL    AP D     G T LH+    +++ +   L    AS +       TPLHIAA+K   +I   L++
Sbjct:  340 PNAKALN-GFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSR--LGKPEIIQQLL---QHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKK---GFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLE 599          

HSP 4 Score: 82.8037 bits (203), Expect = 1.612e-16
Identity = 71/248 (28.63%), Postives = 121/248 (48.79%), Query Frame = 2
Query:  494 NIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQ--IDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            NI + N G   L LA KE  + +V +L+++GA V++ TK G TALH ++   + ++VK L++  A+ N   +   + PL++A +        +  +     NG  Q     +G   L  A++ G       LLE D       K +L    A H A R+ D  A  LL   +   D+++  G T LHI     + N+   L +  A+ +     D TPLH+A+++G + +V+ L+++    + A+ KD
Sbjct:   15 NICNQN-GLNALHLASKEGHVEVVTQLIKMGATVDAATKKGNTALHIASLAGQSDVVKELVTNGANVN-AQSQNGFTPLYMAAQEN-----HLDVVRYLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDT----KGKVRL---PALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLER-GARIDAKTKD 247          

HSP 5 Score: 81.2629 bits (199), Expect = 4.596e-16
Identity = 69/263 (26.24%), Postives = 118/263 (44.87%), Query Frame = 2
Query:  416 MNCSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNG-RLQIDSEGMNSLIH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            ++C  ++    V ++L     +   P +  +  G + L +A + + L  V  LL     V+  T D LTALH +A     ++ K+++ K A+PN    +  + PLH+AC++       I  +    K+G  +Q  +E   + IH A  +G      +L+   A       R   G+TA H A R    + +K L    A +D ++   QT LHI        I++ L  + A  +       TPLH+AA +G   +   L+D+
Sbjct:  252 LHCGARSGHEQVVEMLL----DRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPN-AKALNGFTPLHIACKKN-----RIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVR---GETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQ 501          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 96.2857 bits (238), Expect = 1.022e-21
Identity = 79/264 (29.92%), Postives = 119/264 (45.08%), Query Frame = 2
Query:  407 SKIMNCSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            + I   S     N V+ LL+  +  N+  N++    GET L +A +  +L +V  LL+ GA V  K ++  T LH +++  K EIV+LLL + +DPN     +   PL+ A R      G +++LL         +  +G   L  A + G +  A  LLEK A      K   NG T  H A          LL D  A        G T LHI  ++N   + K L    A  N++      PLH+AA++G   +V  L+ +
Sbjct:  412 TPIHVASFMGHLNVVQLLLQNGASSNA-TNVR----GETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPN-APTASGSTPLYFASREG---HGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGK---NGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGR 663          

HSP 2 Score: 92.8189 bits (229), Expect = 1.367e-20
Identity = 76/255 (29.80%), Postives = 118/255 (46.27%), Query Frame = 2
Query:  449 VEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSK--NADPNICDNITKYYPLHLACRRTIPPPGLI-----SALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
            + QLL Q   + + P    + +G T L  A +E    +   LLE GA+++  TK G T LH ++KY + E+  LLL K  +ADP   + +T   PLH+A         L+     ++     KNG   +      +    +EVG V     LLE  A+  M  ++   G    H A +    D + LL    A I +    G T +H+  +E+  N+ + L  +KA  N    +  TPLH+A+  G  K+V FL+
Sbjct:  491 IVQLLLQRGSDPNAP----TASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLT---PLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKN---QLEVGKV-----LLELGAETNMLTQQ---GVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLL 727          

HSP 3 Score: 88.1965 bits (217), Expect = 4.944e-19
Identity = 71/241 (29.46%), Postives = 119/241 (49.38%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSL--IH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK-FKCNVFARD 1225
            G T L +A K     +V  LL+ GA +++KT+DGLT LH +A+   E+++++LL ++A P +        PLH+A +      G   A ++     +  +D   ++ L  +H A   G    AK LL++  +      R LNG T  H AC++  +  ++LL    A I      G T +H+       N+V+ L    AS+N  +    TPLH+A+  G  ++V+ L+    +  V AR+
Sbjct:  245 GITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDA-PILAKTKNGLSPLHMATQ------GEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGE---PNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKARE 475          

HSP 4 Score: 83.5741 bits (205), Expect = 1.724e-17
Identity = 66/226 (29.20%), Postives = 104/226 (46.02%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
            G T L +A K  +L +   LLE  A+ + K K+GLT LH +  Y  +++  LLL K A P+       Y PLH+A ++     G +   L A  N    +  +G+  L  A + G       LL + A I +  K    G TA H A +   ++  ++L   +A ++       T LH+     +  +V +L   +A  N       TPLH AA++G T +V  L+
Sbjct:  542 GFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAK-NGYTPLHIAAKKNQLEVGKVLLELGAETN---MLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATK---GGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALL 760          

HSP 5 Score: 82.4185 bits (202), Expect = 3.235e-17
Identity = 70/279 (25.09%), Postives = 132/279 (47.31%), Query Frame = 2
Query:  422 CSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGA----VTTAKELLEKDADIQMNKKRKLN-----GDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
             S +   + V +LL++ ++ ++   +     G T L +A    +  IV  L+E GAN+N+++++G T L+ +A+ +  EIVK LL   A+ ++      + PL +A ++      ++  LL++   G++++          A+ + A       A  LL+ + +  +  K  LN     G T  H A    +++   LL +  A +D     G T LH+  +  + N+VK L    A  +       TPLH AA  G  K++E L+++    + A+ K+
Sbjct:   50 ASKEGHVDVVTELLKREAEIDTATKV-----GNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATE-DGFTPLAVALQQGHEQ--VVGLLLESDTKGKVRLP---------ALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLER-DAPILAKTKN 310          

HSP 6 Score: 76.6406 bits (187), Expect = 2.946e-15
Identity = 68/261 (26.05%), Postives = 114/261 (43.68%), Query Frame = 2
Query:  416 MNCSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLID 1195
            ++C+ ++    V ++L     E   P +  +  G + L +A +   L  V  LL   A V+  T D LT LH +A      + KLLL +  +PN    +  + PLH+AC++      ++  LLK      +   +E   + IH A  +G +   + LL+  A       R   G+T  H A R   L+ +K L  + A + ++    QT LHI        IV+ L    +  N       TPL+ A+ +G   +   L++
Sbjct:  282 LHCAARSGHEKVIEMLL----ERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPN-ARALNGFTPLHIACKKNRIK--VMELLLK--HGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVR---GETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLE 530          

HSP 7 Score: 74.3294 bits (181), Expect = 1.558e-14
Identity = 59/237 (24.89%), Postives = 104/237 (43.88%), Query Frame = 2
Query:  491 PNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKF 1201
            PN +  N G T L +ACK+N++ +++ LL+ GA++++ T+ GLT +H ++      +V+LLL   A  N   N+    PLH+A R                  G+L++                    K LL+  A + +  +      T  H A R    + ++LL    +  +   + G T L+    E   ++   L    A  + V     TPLHIA++ G  ++   L++K+
Sbjct:  370 PNARALN-GFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSN-ATNVRGETPLHMASRA-----------------GQLEV-------------------VKTLLQSGARVGVKARED---QTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKY 565          

HSP 8 Score: 70.0922 bits (170), Expect = 3.544e-13
Identity = 72/271 (26.57%), Postives = 110/271 (40.59%), Query Frame = 2
Query:  506 SNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRL-------QIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYL------------------HSYKASANI------------VDNMDR---TPLHIAAEKGFTKIVEFLIDK 1198
            S  G T L +A +EN L IV  LL+ GAN +  T+DG T L  + +   E++V LLL  +    +     +   LH+A R+        + LL+   N  +       Q    G   L  A   G +  A  LL   A +    +   NG T  H A +R + + +KLL D  A ID +   G T LH       E +++ L                  H      ++            VD++     TPLH+AA  G  ++ + L+D+
Sbjct:  106 SQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKV-----RLPALHIAARKD--DTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTAR---NGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDR 366          

HSP 9 Score: 62.7734 bits (151), Expect = 7.620e-11
Identity = 44/155 (28.39%), Postives = 78/155 (50.32%), Query Frame = 2
Query:  773 SALLKATKNGRLQ--------------IDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLID 1195
            ++ L+A +NG L+               +  G+N+L  A + G V    ELL+++A+I    K    G+TA H A      D +++L +  A I+ Q+  G T L++  +EN   IVK+L    A+ ++      TPL +A ++G  ++V  L++
Sbjct:   12 TSFLRAARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKV---GNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLE 163          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.5153 bits (236), Expect = 1.904e-21
Identity = 79/264 (29.92%), Postives = 119/264 (45.08%), Query Frame = 2
Query:  407 SKIMNCSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            + I   S     N V+ LL+  +  N+  N++    GET L +A +  +L +V  LL+ GA V  K ++  T LH +++  K EIV+LLL + +DPN     +   PL+ A R      G +++LL         +  +G   L  A + G +  A  LLEK A     K    NG T  H A          LL D  A        G T LHI  ++N   + K L    A  N++      PLH+AA++G   +V  L+ +
Sbjct:  405 TPIHVASFMGHLNVVQLLLQNGASSNA-TNVR----GETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPN-APTASGSTPLYFASREG---HGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASAD-PKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGR 658          

HSP 2 Score: 93.2041 bits (230), Expect = 1.092e-20
Identity = 75/255 (29.41%), Postives = 116/255 (45.49%), Query Frame = 2
Query:  449 VEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSK--NADPNICDNITKYYPLHLACRRTIPPPGLI-----SALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
            + QLL Q   + + P    + +G T L  A +E    +   LLE GA+++  TK G T LH ++KY + E+  LLL K  +ADP +        PLH+A         L+     ++     KNG   +      +    +EVG V     LLE  A+  M  ++   G    H A +    D + LL    A I +    G T +H+  +E+  N+ + L  +KA  N    +  TPLH+A+  G  K+V FL+
Sbjct:  484 IVQLLLQRGSDPNAP----TASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQ-NGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKN---QLEVGKV-----LLELGAETNMLTQQ---GVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLL 722          

HSP 3 Score: 88.5817 bits (218), Expect = 3.853e-19
Identity = 71/241 (29.46%), Postives = 119/241 (49.38%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSL--IH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK-FKCNVFARD 1225
            G T L +A K     +V  LL+ GA +++KT+DGLT LH +A+   E+++++LL ++A P +        PLH+A +      G   A ++     +  +D   ++ L  +H A   G    AK LL++  +      R LNG T  H AC++  +  ++LL    A I      G T +H+       N+V+ L    AS+N  +    TPLH+A+  G  ++V+ L+    +  V AR+
Sbjct:  238 GITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDA-PILAKTKNGLSPLHMATQ------GEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGE---PNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKARE 468          

HSP 4 Score: 81.6481 bits (200), Expect = 6.976e-17
Identity = 70/273 (25.64%), Postives = 131/273 (47.99%), Query Frame = 2
Query:  422 CSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELL---EKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
             S +   + V +LL++ ++ ++   +     G T L +A    +  IV  L+E GAN+N+++++G T L+ +A+ +  EIVK LL   A+ ++      + PL +A ++      ++  LL++   G++++ +      +H       T A  LL   E +AD+        +G T  H A    +++   LL +  A +D     G T LH+  +  + N+VK L    A  +       TPLH AA  G  K++E L+++    + A+ K+
Sbjct:   51 ASKEGHVDVVTELLKREAEIDTATKV-----GNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATE-DGFTPLAVALQQGHEQ--VVGLLLESDTKGKVRLPA------LHIAARKDDTNAAALLLQHEHNADVTSK-----SGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLER-DAPILAKTKN 303          

HSP 5 Score: 78.9518 bits (193), Expect = 4.189e-16
Identity = 70/238 (29.41%), Postives = 113/238 (47.48%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK-FKCNVFARD 1225
            G   L LA KE  + +V  LL+  A +++ TK G TALH +A   + +IV++L+   A+ N   +   + PL++A +       ++  LL    N  +  + +G   L  A++ G       LLE D       K +L    A H A R+ D +A  LL   E   D+ +  G T LHI     + N+   L +  A+ +       TPLH+AA++G   +V+ L+D+  K +   RD
Sbjct:   44 GLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANIN-AQSQNGFTPLYMAAQENHLE--IVKFLLDNGANQSVATE-DGFTPLAVALQQGHEQVVGLLLESDT----KGKVRL---PALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRD 270          

HSP 6 Score: 77.0258 bits (188), Expect = 2.039e-15
Identity = 68/261 (26.05%), Postives = 114/261 (43.68%), Query Frame = 2
Query:  416 MNCSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLID 1195
            ++C+ ++    V ++L     E   P +  +  G + L +A +   L  V  LL   A V+  T D LT LH +A      + KLLL +  +PN    +  + PLH+AC++      ++  LLK      +   +E   + IH A  +G +   + LL+  A       R   G+T  H A R   L+ +K L  + A + ++    QT LHI        IV+ L    +  N       TPL+ A+ +G   +   L++
Sbjct:  275 LHCAARSGHEKVIEMLL----ERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPN-ARALNGFTPLHIACKKNRIK--VMELLLK--HGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVR---GETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLE 523          

HSP 7 Score: 74.7146 bits (182), Expect = 1.192e-14
Identity = 59/237 (24.89%), Postives = 104/237 (43.88%), Query Frame = 2
Query:  491 PNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKF 1201
            PN +  N G T L +ACK+N++ +++ LL+ GA++++ T+ GLT +H ++      +V+LLL   A  N   N+    PLH+A R                  G+L++                    K LL+  A + +  +      T  H A R    + ++LL    +  +   + G T L+    E   ++   L    A  + V     TPLHIA++ G  ++   L++K+
Sbjct:  363 PNARALN-GFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSN-ATNVRGETPLHMASRA-----------------GQLEV-------------------VKTLLQSGARVGVKARED---QTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKY 558          

HSP 8 Score: 71.2478 bits (173), Expect = 1.500e-13
Identity = 72/264 (27.27%), Postives = 110/264 (41.67%), Query Frame = 2
Query:  506 SNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYL------------------HSYKASANI------------VDNMDR---TPLHIAAEKGFTKIVEFLIDK 1198
            S  G T L +A +EN L IV  LL+ GAN +  T+DG T L  + +   E++V LLL  +    +     +   LH+A R+        + LL+   N  +   S G   L  A   G +  A  LL   A +    +   NG T  H A +R + + +KLL D  A ID +   G T LH       E +++ L                  H      ++            VD++     TPLH+AA  G  ++ + L+D+
Sbjct:  107 SQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKV-----RLPALHIAARKD--DTNAAALLLQHEHNADVTSKS-GFTPLHIAAHYGNMNVATLLLNLGAAVDFTAR---NGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDR 359          

HSP 9 Score: 56.9954 bits (136), Expect = 5.136e-9
Identity = 39/130 (30.00%), Postives = 59/130 (45.38%), Query Frame = 2
Query:  806 LQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLID 1195
            L   S+   S + A   G +    + L+   DI    +  LN   A H A +   +D +  L   EA ID     G T LHI       +IV+ L  + A+ N       TPL++AA++   +IV+FL+D
Sbjct:    5 LSFQSDAATSFLRAARNGNLERLMDHLKGGMDINTCNQNGLN---ALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLD 131          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007449.1 (pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007449.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.8929 bits (224), Expect = 7.689e-20
Identity = 64/237 (27.00%), Postives = 101/237 (42.62%), Query Frame = 2
Query:  491 PNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKF 1201
            PN++  N G T L +ACK+N++ +++ LL+ GA++ + T+ GLT +H SA      IV +LL   A PN   N+     LH+A R                                     G     + LL   A +    + +    T  H A R   L+ ++LL    A  D   S G T LH+   E  E++   L  + AS  +      TPLH+A++ G  ++   L+ +F
Sbjct:    8 PNVRALN-GFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPN-ATNVRGETALHMAAR------------------------------------AGQTEVVRSLLRNGAQVDAKAREE---QTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRF 203          

HSP 2 Score: 87.4261 bits (215), Expect = 9.931e-19
Identity = 67/229 (29.26%), Postives = 101/229 (44.10%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKF 1201
            GET L +A +  +  +V  LL  GA V++K ++  T LH +A+  K EIV+LLL   A P+   +   Y PLH+A R        ++A+L            +G   L  A + G +  A  LL++ A      K   NG T  H A    +     LL D  A        G T LHI  +++   I   L  Y A  N +      PLH+ A++G   +   L+ ++
Sbjct:   81 GETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATS-NGYTPLHVAAREGHED---VTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGK---NGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARY 302          

HSP 3 Score: 73.1738 bits (178), Expect = 3.905e-14
Identity = 68/249 (27.31%), Postives = 106/249 (42.57%), Query Frame = 2
Query:  449 VEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLID 1195
            V+ LL+  +     P+   SN G T L +A +E    +   LLE GA++   TK G T LH ++KY K E+  LLL + A P+         PLH+A         L+     A+ +   +    G   L  A +   +  A  LLE  A+     ++   G    H   +    D   LL    A ++     G + LH+  +E+  N+ + L  + A  N    +  TPL +A   G  K+V FL+ 
Sbjct:  130 VQLLLQHMAS----PDAATSN-GYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGK-NGLTPLHVASHYDNQKVALLLLDQGASPHATAK---NGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQ---GVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQ 366          

HSP 4 Score: 60.077 bits (144), Expect = 5.841e-10
Identity = 59/181 (32.60%), Postives = 83/181 (45.86%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLL--CDAEAPIDIQNSFGQTGLHI 1051
            G T L +A K+++L I   LLE GA  N+ T+ G+  LH  A+    ++  LLL++ AD N     +   PLHLA +        I     A  N   ++   G   LI A   G +     LL+  AD+  N K K NG T  H A ++     + LL  C A  P D+  + G T L I
Sbjct:  246 GYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATK-SGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKL---GYTPLIVACHYGNIKMVNFLLQHGADV--NSKTK-NGYTPLHQAAQQGHTHIVNLLLKCGAR-PNDVTVN-GNTALAI 417          

HSP 5 Score: 53.1434 bits (126), Expect = 9.440e-8
Identity = 35/104 (33.65%), Postives = 52/104 (50.00%), Query Frame = 2
Query:  881 LLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
            LL+K A+  +   R LNG T  H AC++  +  ++LL    A I+     G T +H+     + NIV  L    AS N  +    T LH+AA  G T++V  L+
Sbjct:    1 LLDKGANPNV---RALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLL 101          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007446.1 (pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.5077 bits (223), Expect = 9.455e-20
Identity = 64/237 (27.00%), Postives = 101/237 (42.62%), Query Frame = 2
Query:  491 PNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKF 1201
            PN++  N G T L +ACK+N++ +++ LL+ GA++ + T+ GLT +H SA      IV +LL   A PN   N+     LH+A R                                     G     + LL   A +    + +    T  H A R   L+ ++LL    A  D   S G T LH+   E  E++   L  + AS  +      TPLH+A++ G  ++   L+ +F
Sbjct:   98 PNVRALN-GFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPN-ATNVRGETALHMAAR------------------------------------AGQTEVVRSLLRNGAQVDAKAREE---QTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRF 293          

HSP 2 Score: 87.4261 bits (215), Expect = 1.036e-18
Identity = 67/229 (29.26%), Postives = 101/229 (44.10%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKF 1201
            GET L +A +  +  +V  LL  GA V++K ++  T LH +A+  K EIV+LLL   A P+   +   Y PLH+A R        ++A+L            +G   L  A + G +  A  LL++ A      K   NG T  H A    +     LL D  A        G T LHI  +++   I   L  Y A  N +      PLH+ A++G   +   L+ ++
Sbjct:  171 GETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATS-NGYTPLHVAAREGHED---VTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGK---NGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARY 392          

HSP 3 Score: 77.0258 bits (188), Expect = 2.246e-15
Identity = 62/198 (31.31%), Postives = 96/198 (48.48%), Query Frame = 2
Query:  608 KDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSL--IH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
            +DGLT LH +A+   E++V++LL + A P +        PLH+A +      G     ++     R  +D   ++ L  +H A   G   TAK LL+K A+  +   R LNG T  H AC++  +  ++LL    A I+     G T +H+     + NIV  L    AS N  +    T LH+AA  G T++V  L+
Sbjct:    4 QDGLTPLHCAARSGHEQVVEILLEQGA-PILAKTKNGLSPLHMATQ------GDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNV---RALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLL 191          

HSP 4 Score: 72.7886 bits (177), Expect = 5.126e-14
Identity = 68/249 (27.31%), Postives = 106/249 (42.57%), Query Frame = 2
Query:  449 VEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLID 1195
            V+ LL+  +     P+   SN G T L +A +E    +   LLE GA++   TK G T LH ++KY K E+  LLL + A P+         PLH+A         L+     A+ +   +    G   L  A +   +  A  LLE  A+     ++   G    H   +    D   LL    A ++     G + LH+  +E+  N+ + L  + A  N    +  TPL +A   G  K+V FL+ 
Sbjct:  220 VQLLLQHMAS----PDAATSN-GYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGK-NGLTPLHVASHYDNQKVALLLLDQGASPHATAK---NGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQ---GVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQ 456          

HSP 5 Score: 59.6918 bits (143), Expect = 8.756e-10
Identity = 59/181 (32.60%), Postives = 83/181 (45.86%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLL--CDAEAPIDIQNSFGQTGLHI 1051
            G T L +A K+++L I   LLE GA  N+ T+ G+  LH  A+    ++  LLL++ AD N     +   PLHLA +        I     A  N   ++   G   LI A   G +     LL+  AD+  N K K NG T  H A ++     + LL  C A  P D+  + G T L I
Sbjct:  336 GYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATK-SGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKL---GYTPLIVACHYGNIKMVNFLLQHGADV--NSKTK-NGYTPLHQAAQQGHTHIVNLLLKCGAR-PNDVTVN-GNTALAI 507          

HSP 6 Score: 55.0694 bits (131), Expect = 2.240e-8
Identity = 34/97 (35.05%), Postives = 54/97 (55.67%), Query Frame = 2
Query:  407 SKIMNCSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPN 697
            S +   + +++ N  E L++  +  N+      +  G T L++AC    + +V+ LL+ GA+VNSKTK+G T LH +A+     IV LLL   A PN
Sbjct:  404 SPLHLAAQEDKVNVAEILVKHGAHVNA-----TTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPN 495          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009608.1 (pep scaffold:Pmarinus_7.0:GL477242:23155:61557:-1 gene:ENSPMAG00000008655.1 transcript:ENSPMAT00000009608.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.7962 bits (190), Expect = 1.149e-15
Identity = 81/283 (28.62%), Postives = 124/283 (43.82%), Query Frame = 2
Query:  449 VEQLLRQFSKENSLPNIKDSNTGETL------------LMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKE---------LLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQ--TGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDK 1228
            VE  L + +K   L  +K   T +T+            L  A   N++ +V+ LL+ GA+V++K K GL  LH +  Y   E+ +LL+ + A  N+ D + K+ PLH                 +A   G+ +I       L+  ++ GA  T K          + E D DIQ      L GD A   A ++  L  ++ LC  E  ++ ++S G+  T LH+    N+  + +YL  + A  N  D     PLH AA  G   I   LI K+   V A DK
Sbjct:  616 VEHQLLEAAKAGDLDTVKQLCTTQTVNCRDMEGRHSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKRGAVVNVAD-LWKFTPLH-----------------EAAAKGKYEI-----CKLL--LKHGADPTKKNRDGNTPLDLVKEGDTDIQ----DLLRGDAALLDAAKKGCLARVQKLCSGEN-VNCRDSQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLI-KYSACVNATDK 867          

HSP 2 Score: 62.3882 bits (150), Expect = 1.091e-10
Identity = 63/248 (25.40%), Postives = 104/248 (41.94%), Query Frame = 2
Query:  494 NIKDSNTGETLLMLACKE---NKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITK------YYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIH--AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQ--TGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            N K   T ET L  A       +  + + LL  GANVN KTKD LT LH ++  +  +++ +LL   A  N+ D++ +       +  HL   R +   G    L         Q+ +E +  ++H  ++ V       +LLE                     A +  DLD +K LC  +  ++ ++  G+  T LH     N  ++V+YL  + A  +  D     PLH A   G  ++ E L+ +
Sbjct:  480 NFKHPQTHETALHCAVASPYPKRKQVSELLLRKGANVNEKTKDLLTPLHVASDKAHNDVIDVLLKHGAKINVTDSLGQTSLHRAAHAGHLTTCRLLLSHGCDPNLPSLQGFTAAQLGNESVQQILHESSLPVRNSDVEHQLLE---------------------AAKAGDLDTVKQLCTTQT-VNCRDMEGRHSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKR 705          

HSP 3 Score: 62.003 bits (149), Expect = 1.575e-10
Identity = 70/258 (27.13%), Postives = 102/258 (39.53%), Query Frame = 2
Query:  494 NIKDSNTGE--TLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRT-----------IPPPG-----------LISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEK-DADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
            N +D+ TG   T L  A    +  +V+ LL+ GANV+++   GL  LH +  +   E+V LLL + ADPN  DN   Y PLH A  +               PG           L     KA   G  + D      L+ A   G       LL   + +   +  RK    T  H A     +  ++LL    A +  ++  G   LH         + + L  + AS N +D    TPLH AA K   ++   L+
Sbjct:  173 NARDT-TGRKSTPLHFAAGFGRKDVVEHLLQNGANVHARDDGGLIPLHNACSFGHAEVVNLLLRQGADPNARDNWN-YTPLHEAAIKGKIDVCIVLLQHGADPGIRNTDGKTALDLAEPTAKAVLTGEYKKD-----ELLEAARSGNEEKLMALLTPLNVNCHASDGRK---STPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLVKHGASVNAMDLWQFTPLHEAASKNRVEVCSLLL 420          

HSP 4 Score: 49.2914 bits (116), Expect = 1.558e-6
Identity = 56/224 (25.00%), Postives = 95/224 (42.41%), Query Frame = 2
Query:  536 ACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTAC-----RRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
            AC      + + L++ GA+VN+      T LH +A  ++ E+  LLLS  ADP + +  +K                 I     +    RL  +  G +SL+ A     VT  K+ L  D    +N K     +TA H A      +R+ +   +LL    A ++ +     T LH+  ++   +++  L  + A  N+ D++ +T LH AA  G       L+
Sbjct:  374 ACSYGHYEVTELLVKHGASVNAMDLWQFTPLHEAASKNRVEVCSLLLSYGADPTLLNCHSK---------------SAIDLAPTSELKERLVYEFRG-HSLLQAAREADVTRVKKHLGLDI---INFKHPQTHETALHCAVASPYPKRKQVS--ELLLRKGANVNEKTKDLLTPLHVASDKAHNDVIDVLLKHGAKINVTDSLGQTSLHRAAHAGHLTTCRLLL 576          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: NAS6 (Evolutionarily conserved 19S regulatory particle assembly-chaperone; proteasome-interacting protein involved in the assembly of the base subcomplex of the 19S proteasomal regulatory particle (RP); ortholog of human oncoprotein gankyrin, also known as p28, which interacts with the Rb tumor suppressor and CDK4/6 [Source:SGD;Acc:S000003464])

HSP 1 Score: 62.3882 bits (150), Expect = 9.765e-12
Identity = 51/171 (29.82%), Postives = 77/171 (45.03%), Query Frame = 2
Query:  722 YPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQ--NSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDK 1228
            YPLH AC         +  LL +  +  LQ D +G   L  ++   A      LL K  ++ ++     +G T FH AC   +L+ +K L D     D+    + G T LH+ V +    + ++L    AS  I D  ++ PLH AA  G  K++E L    K  V  +DK
Sbjct:    4 YPLHQACMEN--EFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDK 172          

HSP 2 Score: 59.3066 bits (142), Expect = 1.030e-10
Identity = 56/203 (27.59%), Postives = 96/203 (47.29%), Query Frame = 2
Query:  536 ACKENKLVIVDRLLELGANVN-SKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICD--NITKYYPLHLACRRTIPPPGLISALL-KATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCD-AEAPIDIQNSFGQTGL-HICVEENDENIVKYLHSYKASANIVDN 1126
            AC EN+   V  LL    ++   K +DG   LH+S  +   EI   LLSK  + N+ D  + + + P H+AC  ++    ++ +L  +  K    +I ++G+  L  A+       ++ L+E  A +++  K K N     H A     L  I+LLC   ++ ++ Q+  G T L H   E + +  V  +  Y A  ++VDN
Sbjct:    9 ACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIAC--SVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRI--KDKFN-QIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDN 206          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: AKR1 (Palmitoyl transferase involved in protein palmitoylation; acts as a negative regulator of pheromone response pathway; required for endocytosis of pheromone receptors; involved in cell shape control; contains ankyrin repeats; AKR1 has a paralog, AKR2, that arose from the whole genome duplication; any of several human homologs encoding DHHC-type zinc fingers (ZDHHC) can complement temperature sensitivity of yeast akr1 null mutant [Source:SGD;Acc:S000002672])

HSP 1 Score: 57.3806 bits (137), Expect = 2.150e-9
Identity = 57/195 (29.23%), Postives = 82/195 (42.05%), Query Frame = 2
Query:  494 NIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKD-GLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQI---DSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEEN 1066
            N  DS    T L  A   N+L +VD L+  GA+VN++      T LH++A+Y    IV  LL   ADP + D+   +  LHL+   +     ++  L      G L I   D +G  SL+ A   G   T  ELL+  A I++       G T  H    +     +K L    A    +   G+    I  E N
Sbjct:  102 NDGDSTEHITGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDD-QGFNLLHLSVNSS-NIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTE---GFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTGKDCFAIAQEMN 291          

HSP 2 Score: 48.9062 bits (115), Expect = 1.180e-6
Identity = 36/109 (33.03%), Postives = 53/109 (48.62%), Query Frame = 2
Query:  887 EKDADIQMNKKRKLNGD---TAFHTACRRRDLDAIKLLCDA---EAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANI-VDNMDRTPLHIAAEKGFTKIVEFLI 1192
            E+  + Q+N   +   D   T +HTAC+R DL  +K +      E   D  ++   TGLH     N  ++V +L S  A  N     +  TPLH AA  G+  IV+FL+
Sbjct:   55 EESGNEQVNHNDEAEEDPLLTRYHTACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLL 163          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: AKR2 (Ankyrin repeat-containing protein; member of a family of putative palmitoyltransferases containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain; possibly involved in constitutive endocytosis of Ste3p; AKR2 has a paralog, AKR1, that arose from the whole genome duplication [Source:SGD;Acc:S000005560])

HSP 1 Score: 48.1358 bits (113), Expect = 1.719e-6
Identity = 48/165 (29.09%), Postives = 70/165 (42.42%), Query Frame = 2
Query:  527 LMLACKENKLVIVDRLLELGANVN-SKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICD----NITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNS---LIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCD 997
            L  AC  N+  +   LL  GAN N +    G TALH++A+Y    IV LLL   ADP + D    NI     +H +   +     +         N  + IDS+  N+   L+ A   G   T + LL+  + +     R  N   A H A    D    +++CD
Sbjct:   88 LHWACINNRFSVAKFLLLRGANPNQAAGPGGATALHWAARYGNIYIVDLLLKHGADPTLKDEQGLNI-----MHFSVYSSNILLVVYVLYFVVNNNDNVDIDSKDNNNRTPLLWAAYQGDFLTVELLLKFGSTVAWTDNRGFN---ALHCALVGGDQ---RVICD 241          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO44711 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV24])

HSP 1 Score: 70.0922 bits (170), Expect = 4.772e-13
Identity = 63/209 (30.14%), Postives = 98/209 (46.89%), Query Frame = 2
Query:  593 VNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKY-YPLHLACRRTIPP---------PGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFL 1189
            +NS+ KD  TAL  + +++++E V++LL   AD N   ++  Y  P+H A +              P LISA  +  K G          S +H ++       + LLEK AD++    R   G+TA H   RRR +  I  L      +D   S G T LH+  E +D +IV+ L  + A+ N+ ++   TP HIA      + VE +
Sbjct:    1 MNSRNKDDQTALDVACRFTQDEGVRVLLEAGADVN---HVNGYALPIHTALKANGTRCASLLIDFHPELISA--RDLKYG---------GSPLHWVKTKEAV--EILLEKGADME---SRNNAGETALHVMARRRRVACIVALLAHGVAVDAACSEGCTALHVAAEVDDPDIVRALIVFGANINVTNHSHHTPRHIATAGRRQRWVEVV 190          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO38180 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDL0])

HSP 1 Score: 65.855 bits (159), Expect = 3.468e-12
Identity = 29/67 (43.28%), Postives = 46/67 (68.66%), Query Frame = 2
Query: 1031 GQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            GQT +HI   E D+ +V+ LH  +A A++ D  DRTPL +AA +G T +V++L+DK + ++ AR K+
Sbjct:  178 GQTPMHIAAYEGDDLMVRTLHGMRARADLKDIEDRTPLLLAAMRGHTTVVDYLLDKARADINARSKE 244          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO43690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXV8])

HSP 1 Score: 59.6918 bits (143), Expect = 4.796e-10
Identity = 37/109 (33.94%), Postives = 54/109 (49.54%), Query Frame = 2
Query:  836 LIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEK 1162
             + A+  G V   K+LL K ADI     + ++G TA H AC   + D +K+L D  A +D++++ G T LH         I KYL    A    V+N    PL +A E+
Sbjct:   53 FLSAVSSGDVDEVKKLLAKGADINY---QNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEE 158          

HSP 2 Score: 51.2174 bits (121), Expect = 2.690e-7
Identity = 35/94 (37.23%), Postives = 50/94 (53.19%), Query Frame = 2
Query:  917 KRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLH-ICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLID 1195
            K + N    F +A    D+D +K L    A I+ QN  G T LH  C++EN  ++VK L    AS ++ DN   T LH AA  G  +I ++LI+
Sbjct:   44 KIQFNSGIVFLSAVSSGDVDEVKKLLAKGADINYQNVDGLTALHQACIDEN-FDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIE 136          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO42616 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0X5])

HSP 1 Score: 60.8474 bits (146), Expect = 5.106e-10
Identity = 57/207 (27.54%), Postives = 94/207 (45.41%), Query Frame = 2
Query:  491 PNIKDSNTGETLLMLAC-KENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICD--NITK-YYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSY 1099
            PN ++  TGET L +A   +  + ++  L+  GA+++ +  DGLT++H +A   K   +K LL   A PN  D  N+T  YY +          P     LL       + +D +GM  + HA + G V   + LL   ADI +      +G+T  H A      D   +L    A  DI N   Q+  ++     + ++ +Y+ +Y
Sbjct:  118 PNFQEDKTGETPLTIAAMGDQGMDLIMSLVNGGAHLDYRAGDGLTSVHKAAIKGKVNSLKTLLDLGASPNYRDGKNLTALYYTVLYGAD-----PYCCEILLNDQAEMGV-MDHQGMQEIHHACKNGRVQHLEHLLYYGADINVTNA---SGNTPLHIAACNNQEDCAHVLLFRGARRDILNYANQSAYNMAAMGGNNDLAEYIRNY 315          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO34161 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ63])

HSP 1 Score: 55.0694 bits (131), Expect = 1.039e-9
Identity = 30/80 (37.50%), Postives = 49/80 (61.25%), Query Frame = 2
Query:  455 QLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADP 694
            ++++Q   + + P  KD N G T L  AC   KL +V  L++ GA+VN+ + DG+  LH +A+    E+++LLL+  ADP
Sbjct:    1 EVVKQCILQGADPTAKD-NAGWTPLHEACARGKLEVVKVLVQYGADVNAHSNDGIRPLHDAAEGGHVEVLRLLLTYGADP 79          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000006308.2 (pep primary_assembly:ASM223467v1:1:12516834:12530692:1 gene:ENSORLG00000005003.2 transcript:ENSORLT00000006308.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.8929 bits (224), Expect = 1.303e-19
Identity = 71/228 (31.14%), Postives = 114/228 (50.00%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            G   L LA KE    +V+ LL+ GA V+S TK G TALH ++   ++E+VKLL+S+ AD N   +   + PL++A +       ++   L+   N  +  + +G   L  A++ G  +    LLE D       K +L    A H A R+ D  +  LL   +   D+Q+  G T LHI     + N+   L +  A+ +       TPLH+A+++G T +V  L+D+
Sbjct:   20 GLNALHLAAKEGHKDLVEELLQRGAPVDSATKKGNTALHIASLAGQKEVVKLLVSRGADVN-AQSQNGFTPLYMAAQENHLE--VVRYFLENEGNQSIATE-DGFTPLAIALQQGHNSVVSLLLEHDT----KGKVRL---PALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVSTLLLNRGAAVDFTARNGITPLHVASKRGNTNMVALLLDR 236          

HSP 2 Score: 68.5514 bits (166), Expect = 3.234e-12
Identity = 66/221 (29.86%), Postives = 103/221 (46.61%), Query Frame = 2
Query:  572 LLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNA--DPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDS---EGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFA 1219
            LL+   N + ++K G T LH +A Y    +  LLL++ A  D    + IT   PLH+A +R      +++ LL        QID+   +G+  L  A   G     + LLE+ A I    K   NG +  H + +   ++ +KLL   +AP+D       T LH+        + K L   KA+ N       TPLHIA +K   K++E L+ K+  ++ A
Sbjct:  167 LLQNDHNADVQSKSGFTPLHIAAHYGNVNVSTLLLNRGAAVDFTARNGIT---PLHVASKRG--NTNMVALLLDRGA----QIDAKTRDGLTPLHCAARSGHDPAVELLLERGAPILARTK---NGLSPLHMSAQGDHIECVKLLLQHQAPVDDVTLDYLTALHVAAHCGHYRVTKVLLDKKANPNARALNGFTPLHIACKKNRVKVMELLV-KYGASIQA 374          

HSP 3 Score: 67.0106 bits (162), Expect = 8.303e-12
Identity = 65/210 (30.95%), Postives = 96/210 (45.71%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSL--IH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASA---NIVDN 1126
            G T L +A K     +V  LL+ GA +++KT+DGLT LH +A+   +  V+LLL + A P +        PLH++ +      G     +K     +  +D   ++ L  +H A   G     K LL+K A+      R LNG T  H AC++  +  ++LL    A I      G T +H+       NIV  L    AS    NIV N
Sbjct:  214 GITPLHVASKRGNTNMVALLLDRGAQIDAKTRDGLTPLHCAARSGHDPAVELLLERGA-PILARTKNGLSPLHMSAQ------GDHIECVKLLLQHQAPVDDVTLDYLTALHVAAHCGHYRVTKVLLDKKAN---PNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVRNIVSN 413          

HSP 4 Score: 67.0106 bits (162), Expect = 9.165e-12
Identity = 68/238 (28.57%), Postives = 105/238 (44.12%), Query Frame = 2
Query:  506 SNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNA--DPNICDNITKYYPLHLACRRTIPPPGLI-----SALLKATKNG--RLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
            S +G T L +A     + +   LL  GA V+   ++G+T LH ++K     +V LLL + A  D    D +T   PLH A R    P   +     + +L  TKNG   L + ++G +          +   K LL+  A +       L+  TA H A         K+L D +A  + +   G T LHI  ++N   +++ L  Y AS   +     TP+H+AA  G   IV  L+
Sbjct:  178 SKSGFTPLHIAAHYGNVNVSTLLLNRGAAVDFTARNGITPLHVASKRGNTNMVALLLDRGAQIDAKTRDGLT---PLHCAARSGHDPAVELLLERGAPILARTKNGLSPLHMSAQGDH----------IECVKLLLQHQAPVD---DVTLDYLTALHVAAHCGHYRVTKVLLDKKANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLL 399          

HSP 5 Score: 62.7734 bits (151), Expect = 2.159e-10
Identity = 72/272 (26.47%), Postives = 106/272 (38.97%), Query Frame = 2
Query:  506 SNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDE---------------------------------NIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFAR 1222
            S  G T L +A +EN L +V   LE   N +  T+DG T L  + +     +V LLL  +    +     +   LH+A R+       +  LL+   N  +Q  S G   L  A   G V  +  LL + A +    +   NG T  H A +R + + + LL D  A ID +   G T LH       +                                   VK L  ++A  + V     T LH+AA  G  ++ + L+DK K N  AR
Sbjct:   83 SQNGFTPLYMAAQENHLEVVRYFLENEGNQSIATEDGFTPLAIALQQGHNSVVSLLLEHDTKGKV-----RLPALHIAARKDDTKSAAL--LLQNDHNADVQSKS-GFTPLHIAAHYGNVNVSTLLLNRGAAVDFTAR---NGITPLHVASKRGNTNMVALLLDRGAQIDAKTRDGLTPLHCAARSGHDPAVELLLERGAPILARTKNGLSPLHMSAQGDHIECVKLLLQHQAPVDDVTLDYLTALHVAAHCGHYRVTKVLLDK-KANPNAR 342          

HSP 6 Score: 49.6766 bits (117), Expect = 3.389e-6
Identity = 26/78 (33.33%), Postives = 48/78 (61.54%), Query Frame = 2
Query:  491 PNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYY 724
            PN +  N G T L +ACK+N++ +++ L++ GA++ + T+ GLT +H +A      IV LLL   A P++ + ++  +
Sbjct:  339 PNARALN-GFTPLHIACKKNRVKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVRNIVSNSF 415          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ank1a (ankyrin-1 [Source:NCBI gene;Acc:101174837])

HSP 1 Score: 91.6633 bits (226), Expect = 2.094e-19
Identity = 73/260 (28.08%), Postives = 117/260 (45.00%), Query Frame = 2
Query:  452 EQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIH-AIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDK 1228
            ++L++   +  + PN   +  G + L +A +E  +  V  LL++ A     TK G T LH ++KY K ++ +LLL + A+PN         PLH+A         L    L  +K G     +    + +H A +   V  A  LL+  A         L G T  H A +    D + LL   +A +++ N  G T LH+  +E    I   L    AS      M  TPLH+A   G  K+V+FL+ + + NV ++ +
Sbjct:  421 KELVKLLLEHKANPN-STTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGK-NGLTPLHVAVHHN----NLDVVNLLVSKGGSPHSAARNGYTALHIAAKQNQVEVANSLLQHGASA---NAESLQGVTPLHLASQEGRPDIVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQ-QANVNSKTR 670          

HSP 2 Score: 91.6633 bits (226), Expect = 2.510e-19
Identity = 73/261 (27.97%), Postives = 123/261 (47.13%), Query Frame = 2
Query:  416 MNCSMKN-EWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLID 1195
            ++C+ +N  +  +E LL     +N  P    +  G + + +A + + +  V +LL+  A ++  T D LT LH +A      + K+LL K A PN    +  + PLH+AC++      ++  LLK + +     +S G+  L  A  +G +   K LL+K A    +  +    +T  H A R    +  + L    AP+D +    QT LH       + +VK L  +KA+ N       +PLHIAA +G  + V  L+D
Sbjct:  214 LHCAARNGHFRIIEILL-----DNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPN-SRALNGFTPLHIACKKNHL--RVMDLLLKHSASIEAVTES-GLTPLHVASFMGHLNIVKILLQKGASPSASNVKV---ETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLD 462          

HSP 3 Score: 81.2629 bits (199), Expect = 5.046e-16
Identity = 65/236 (27.54%), Postives = 102/236 (43.22%), Query Frame = 2
Query:  491 PNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            PN +  N G T L +ACK+N L ++D LL+  A++ + T+ GLT LH ++      IVK+LL K A P+   N+    PLH+A R                                     G    A+ LL+  A +    K   +  T  H A R    + +KLL + +A  +   + G + LHI   E     V+ L   +A    +     TPLH+A++ G   + E L+++
Sbjct:  302 PNSRALN-GFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPS-ASNVKVETPLHMASRS------------------------------------GHFEVAEFLLQNAAPVDAKAK---DDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLER 496          

HSP 4 Score: 81.2629 bits (199), Expect = 5.875e-16
Identity = 84/306 (27.45%), Postives = 127/306 (41.50%), Query Frame = 2
Query:  506 SNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNAD-----PNICD-----NITKYYPLHLACR-------RTIPPPGL---ISALLKATKNGRLQI--------------DSEGMNSLIHAIEVGAVTTAKELLEKDADI--------------------QMNK----------KRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            S  G T L +A +EN L +V  LLE GAN +  T+DG T L  + +   E +V LL+S         P + D     ++T + PLH+A         + +   G    ++ L  A +NG  +I                 G++ +  A +   +   K+LL+ +A+I                    +M K           R LNG T  H AC++  L  + LL    A I+     G T LH+       NIVK L    AS +  +    TPLH+A+  G  ++ EFL+      V A+ KD
Sbjct:  103 SQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNRGANDELTPLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQN-AAPVDAKAKD 407          

HSP 5 Score: 73.1738 bits (178), Expect = 2.390e-13
Identity = 60/238 (25.21%), Postives = 110/238 (46.22%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDS----------EGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            G T L +A    +  +V  L+  G NVN++++ G T L+ +A+ +  E+VK LL   A+ +I      + PL +A ++      +++ L+     G++++ +           G   L  A     +  A+ LL + A+ ++         T  H A R      I++L D  API  +   G + +H+  + +  + VK L  Y A  + +     TPLH+AA  G  ++ + L+DK
Sbjct:   73 GNTALHIAALAGQEQVVTELVNYGTNVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTE-DGFTPLAVALQQGH--ENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNRGANDEL---------TPLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDK 298          

HSP 6 Score: 66.2402 bits (160), Expect = 3.005e-11
Identity = 60/245 (24.49%), Postives = 107/245 (43.67%), Query Frame = 2
Query:  500 KDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMD---------------RTPLHIAAEKGFTKIVEFL 1189
            K +  G T L +A K  K+ + + LLE GAN N+  K+GLT LH +  ++  ++V LL+SK   P+       Y  LH+A ++      + ++LL+   +   +   +G+  L  A + G       L+ K A++ +  K   +G T  H   +   +    +L    A +      G T LH+     +  +VK+L   +A+ N    ++                TPLH     G+  +++ L
Sbjct:  469 KMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAAR-NGYTALHIAAKQNQVE--VANSLLQHGASANAE-SLQGVTPLHLASQEGRPDIVSLLISKQANVNLGNK---SGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNSKTRVEYIQCHYKDHYCEYKHTTPLHTHLWLGYISVIDVL 706          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: dapk1 (death associated protein kinase 1 [Source:NCBI gene;Acc:101162667])

HSP 1 Score: 91.2781 bits (225), Expect = 2.831e-19
Identity = 69/229 (30.13%), Postives = 110/229 (48.03%), Query Frame = 2
Query:  512 TGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDS---EGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFL 1189
            +G   +  A +   +  +  L E    +N + K G TALH +A+Y   ++V  L +  ADPN+ D   +  PLH A           SA+ +A       +++   EG + L+ A   G V   + L+E  AD+Q   K   +G TA H A RR  +D ++ L       D Q+  G T LHI  ++ +  IV  +   KA+ ++ +   RTPLH+AA+ G  ++V  L
Sbjct:  411 SGANAVYYAARHGHVETLRFLHEKKCPLNVQDKSGETALHVAARYGNVDVVSYLCTIQADPNLADR-EQEIPLHCAAWHGY------SAVARALCQAGCDVNATNREGESPLLTASARGFVDIVECLVEHRADLQATDK---DGHTALHLAVRRCQVDVVRCLLKHNCQQDQQDRHGNTALHIACKDGNLPIVIAICGAKANLDLPNKHGRTPLHLAAKNGSLEVVRHL 629          

HSP 2 Score: 69.707 bits (169), Expect = 2.422e-12
Identity = 39/141 (27.66%), Postives = 73/141 (51.77%), Query Frame = 2
Query:  809 QIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            Q +  G   L+ A   G +   + L+ K A+IQ N K   +G  A + A R   ++ ++ L + + P+++Q+  G+T LH+     + ++V YL + +A  N+ D     PLH AA  G++ +   L  +  C+V A +++
Sbjct:  374 QPNKHGTPPLLIAAGCGNIQIIEVLMRKGAEIQANDK---SGANAVYYAARHGHVETLRFLHEKKCPLNVQDKSGETALHVAARYGNVDVVSYLCTIQADPNLADREQEIPLHCAAWHGYSAVARALC-QAGCDVNATNRE 510          

HSP 3 Score: 57.7658 bits (138), Expect = 1.491e-8
Identity = 38/139 (27.34%), Postives = 65/139 (46.76%), Query Frame = 2
Query:  815 DSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            D  G N++ +A   G V T + L EK   + +  K   +G+TA H A R  ++D +  LC  +A  ++ +   +  LH         + + L       N  +    +PL  A+ +GF  IVE L++  + ++ A DKD
Sbjct:  409 DKSGANAVYYAARHGHVETLRFLHEKKCPLNVQDK---SGETALHVAARYGNVDVVSYLCTIQADPNLADREQEIPLHCAAWHGYSAVARALCQAGCDVNATNREGESPLLTASARGFVDIVECLVEH-RADLQATDKD 543          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: dapk1 (death associated protein kinase 1 [Source:NCBI gene;Acc:101162667])

HSP 1 Score: 91.2781 bits (225), Expect = 2.844e-19
Identity = 69/229 (30.13%), Postives = 110/229 (48.03%), Query Frame = 2
Query:  512 TGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDS---EGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFL 1189
            +G   +  A +   +  +  L E    +N + K G TALH +A+Y   ++V  L +  ADPN+ D   +  PLH A           SA+ +A       +++   EG + L+ A   G V   + L+E  AD+Q   K   +G TA H A RR  +D ++ L       D Q+  G T LHI  ++ +  IV  +   KA+ ++ +   RTPLH+AA+ G  ++V  L
Sbjct:  337 SGANAVYYAARHGHVETLRFLHEKKCPLNVQDKSGETALHVAARYGNVDVVSYLCTIQADPNLADR-EQEIPLHCAAWHGY------SAVARALCQAGCDVNATNREGESPLLTASARGFVDIVECLVEHRADLQATDK---DGHTALHLAVRRCQVDVVRCLLKHNCQQDQQDRHGNTALHIACKDGNLPIVIAICGAKANLDLPNKHGRTPLHLAAKNGSLEVVRHL 555          

HSP 2 Score: 69.707 bits (169), Expect = 2.354e-12
Identity = 39/141 (27.66%), Postives = 73/141 (51.77%), Query Frame = 2
Query:  809 QIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            Q +  G   L+ A   G +   + L+ K A+IQ N K   +G  A + A R   ++ ++ L + + P+++Q+  G+T LH+     + ++V YL + +A  N+ D     PLH AA  G++ +   L  +  C+V A +++
Sbjct:  300 QPNKHGTPPLLIAAGCGNIQIIEVLMRKGAEIQANDK---SGANAVYYAARHGHVETLRFLHEKKCPLNVQDKSGETALHVAARYGNVDVVSYLCTIQADPNLADREQEIPLHCAAWHGYSAVARALC-QAGCDVNATNRE 436          

HSP 3 Score: 57.7658 bits (138), Expect = 1.366e-8
Identity = 38/139 (27.34%), Postives = 65/139 (46.76%), Query Frame = 2
Query:  815 DSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            D  G N++ +A   G V T + L EK   + +  K   +G+TA H A R  ++D +  LC  +A  ++ +   +  LH         + + L       N  +    +PL  A+ +GF  IVE L++  + ++ A DKD
Sbjct:  335 DKSGANAVYYAARHGHVETLRFLHEKKCPLNVQDK---SGETALHVAARYGNVDVVSYLCTIQADPNLADREQEIPLHCAAWHGYSAVARALCQAGCDVNATNREGESPLLTASARGFVDIVECLVEH-RADLQATDKD 469          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: dapk1 (death associated protein kinase 1 [Source:NCBI gene;Acc:101162667])

HSP 1 Score: 91.2781 bits (225), Expect = 2.959e-19
Identity = 69/229 (30.13%), Postives = 110/229 (48.03%), Query Frame = 2
Query:  512 TGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDS---EGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFL 1189
            +G   +  A +   +  +  L E    +N + K G TALH +A+Y   ++V  L +  ADPN+ D   +  PLH A           SA+ +A       +++   EG + L+ A   G V   + L+E  AD+Q   K   +G TA H A RR  +D ++ L       D Q+  G T LHI  ++ +  IV  +   KA+ ++ +   RTPLH+AA+ G  ++V  L
Sbjct:  405 SGANAVYYAARHGHVETLRFLHEKKCPLNVQDKSGETALHVAARYGNVDVVSYLCTIQADPNLADR-EQEIPLHCAAWHGY------SAVARALCQAGCDVNATNREGESPLLTASARGFVDIVECLVEHRADLQATDK---DGHTALHLAVRRCQVDVVRCLLKHNCQQDQQDRHGNTALHIACKDGNLPIVIAICGAKANLDLPNKHGRTPLHLAAKNGSLEVVRHL 623          

HSP 2 Score: 69.707 bits (169), Expect = 2.420e-12
Identity = 39/141 (27.66%), Postives = 73/141 (51.77%), Query Frame = 2
Query:  809 QIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            Q +  G   L+ A   G +   + L+ K A+IQ N K   +G  A + A R   ++ ++ L + + P+++Q+  G+T LH+     + ++V YL + +A  N+ D     PLH AA  G++ +   L  +  C+V A +++
Sbjct:  368 QPNKHGTPPLLIAAGCGNIQIIEVLMRKGAEIQANDK---SGANAVYYAARHGHVETLRFLHEKKCPLNVQDKSGETALHVAARYGNVDVVSYLCTIQADPNLADREQEIPLHCAAWHGYSAVARALC-QAGCDVNATNRE 504          

HSP 3 Score: 57.7658 bits (138), Expect = 1.517e-8
Identity = 38/139 (27.34%), Postives = 65/139 (46.76%), Query Frame = 2
Query:  815 DSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            D  G N++ +A   G V T + L EK   + +  K   +G+TA H A R  ++D +  LC  +A  ++ +   +  LH         + + L       N  +    +PL  A+ +GF  IVE L++  + ++ A DKD
Sbjct:  403 DKSGANAVYYAARHGHVETLRFLHEKKCPLNVQDK---SGETALHVAARYGNVDVVSYLCTIQADPNLADREQEIPLHCAAWHGYSAVARALCQAGCDVNATNREGESPLLTASARGFVDIVECLVEH-RADLQATDKD 537          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000020707.1 (SMESG000020707.1)

HSP 1 Score: 576.63 bits (1485), Expect = 0.000e+0
Identity = 299/299 (100.00%), Postives = 299/299 (100.00%), Query Frame = 2
Query:  335 HLNFIGRXXXXXXXXXXXXXXXXXSKIMNCSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            HLNFIGRLTTEEKDELKLDEETLESKIMNCSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD
Sbjct:  112 HLNFIGRLTTEEKDELKLDEETLESKIMNCSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 410          

HSP 2 Score: 178.333 bits (451), Expect = 0.000e+0
Identity = 87/87 (100.00%), Postives = 87/87 (100.00%), Query Frame = 1
Query:    1 MKSSDNIIKKASMNVGEIFQMMTTKNSESDSESDLMRPSTENDKLYDFQPLNLPKLDFSNYLNSPSFKSKEKQQNNEDMDPIIQMPL 261
            MKSSDNIIKKASMNVGEIFQMMTTKNSESDSESDLMRPSTENDKLYDFQPLNLPKLDFSNYLNSPSFKSKEKQQNNEDMDPIIQMPL
Sbjct:    1 MKSSDNIIKKASMNVGEIFQMMTTKNSESDSESDLMRPSTENDKLYDFQPLNLPKLDFSNYLNSPSFKSKEKQQNNEDMDPIIQMPL 87          

HSP 3 Score: 72.0182 bits (175), Expect = 3.068e-13
Identity = 61/221 (27.60%), Postives = 101/221 (45.70%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEV-GAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDN-MDRTPLHIAA--EKG 1165
            G+T    AC+   L  +  L +  A ++ +   G T LH   + + E IVK L S  A  NI DN+ +  PLH+A  +      ++  L+   K      D +G N+L+H   + G   T    L +   + M+ K   NG    H A ++  +  ++ L +  A ++ +     T LHI V+    N+++ L  + A  N     M+ +PLHIA   E+G
Sbjct:  311 GDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRT-PLHIAAEKGFTK--IVEFLIDKFKCNVFARDKDG-NTLVHVTSLFGFQETTLAFLRRGVPLHMSNK---NGSVCLHVAAQKGHIQVVRALLEKGANVNAKTKDLFTPLHIAVQYGHNNVMEALIGHGAEINNKGGIMEESPLHIAVKMERG 524          

HSP 4 Score: 62.003 bits (149), Expect = 4.023e-10
Identity = 49/160 (30.63%), Postives = 82/160 (51.25%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAI-EVGAVTTAKELLEKDAD--IQMNKKRKLNGDTAFHTACRRRDLDAIK 985
            G   L +A ++  + +V  LLE GANVN+KTKD  T LH + +Y    +++ L+   A+ N    I +  PLH+A +        I  LLK+  N   +I +    +++H +  +G +   K LL++ AD   Q N+     G++A H+A + R    +K
Sbjct:  444 GSVCLHVAAQKGHIQVVRALLEKGANVNAKTKDLFTPLHIAVQYGHNNVMEALIGHGAEINNKGGIMEESPLHIAVKME-RGESCIETLLKSGANVNDKIKTG--ETVLHILSRLGNLDILKLLLDEKADPFSQCNE-----GNSALHSAVKHRHFACVK 595          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000020705.1 (SMESG000020705.1)

HSP 1 Score: 348.977 bits (894), Expect = 5.243e-111
Identity = 162/275 (58.91%), Postives = 216/275 (78.55%), Query Frame = 2
Query:  407 SKIMNCSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            +K++    K EW +V+QLLR+++KEN LPN++D    ETLLM+ACK+N+LVI++RLLEL  NVN  ++DG  ALHY+AK+SKEE+VKLL+SK AD N+     K  PLHLAC R   PPG+++ LLKATKN R Q+D +G   L++AIE G+++T KELLE + + Q N K+K +GD A H ACR++D+D++++LC+ E PI+IQN+ GQT LHIC EENDE I+KYL++ KA+ANIVD MDR+ LH+AA+KG+TKIVEFLIDKFKCNV  RDKD
Sbjct:  236 TKLIEYCRKGEWASVDQLLREYNKENPLPNVRDIENDETLLMIACKDNRLVIIERLLELVNNVNDISQDGRNALHYAAKFSKEEVVKLLISKKADANVYGGNNKCLPLHLACSRNPAPPGIVTQLLKATKNARFQMDIDGAIPLMYAIEAGSLSTVKELLEHEGEAQANIKKKNSGDAAIHIACRKKDIDSLRMLCEVEGPINIQNASGQTALHICAEENDETILKYLYTNKANANIVDYMDRSALHMAADKGYTKIVEFLIDKFKCNVLTRDKD 510          

HSP 2 Score: 65.4698 bits (158), Expect = 4.038e-11
Identity = 67/235 (28.51%), Postives = 97/235 (41.28%), Query Frame = 2
Query:  488 LPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIK-LLCDAEAPIDIQNSFGQTGLHICVEENDE----NIVKYLHSYKAS------ANIVDNMDRTPLHIAAE 1159
            +PN      G   L  A +   + +V  LLE GANVN ++KD  T LH + KY    +V+ LL   A+ N+    +   PLH+A                  KNG L                     A+ LL+  A++    K+   G+TA H A R  +L+ +K LL +   P  + N  G + LHI V          I+ +L+  K         N+ +N   T LH AAE
Sbjct:  539 MPN----KAGSVCLHAAAQRGHVSVVRALLEKGANVNVRSKDLYTPLHIAVKYGNPGVVETLLGFGAEVNVKGGTSDETPLHIAA---------------TVKNGEL--------------------CAEMLLKSGANVNDTMKK---GETALHIAGRTGNLEMLKSLLLEKADPTLVSNE-GNSSLHIGVRYCHYPIVLEIINFLNRTKTKMDSTLLVNLPNNEGETALHFAAE 730          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000020709.1 (SMESG000020709.1)

HSP 1 Score: 330.487 bits (846), Expect = 2.755e-101
Identity = 165/273 (60.44%), Postives = 203/273 (74.36%), Query Frame = 2
Query:  413 IMNCSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
             M   MKN+W T EQLLR F KE+ L N K+  TGET LM AC+EN+LVIV+RLL++  NVN+K+ DG  ALHY+AKYS  EIVKLLLSK AD NI +N  KY PLHLAC RT+ P GLIS LLK T+NGRLQ D  G   L+ A+E G + T KELLEKD D Q+N KRK +GD A H ACR+ DL++ +LLC+A A I+ QN+ GQT LHIC EEN E ++KYL++ KA+ANI+DN DR  +++AA KG TK+VEFLIDK+K N+  RDKD
Sbjct:  202 FMELCMKNQWVTCEQLLRTFKKESCLTNYKNHETGETPLMFACRENRLVIVERLLDIEVNVNAKSMDGRNALHYAAKYSNYEIVKLLLSKKADANIFENTNKYLPLHLACNRTVVPSGLISNLLKVTRNGRLQKDKNGSIPLMFAVENGLIMTIKELLEKDVDAQINMKRKESGDNALHIACRKNDLESARLLCEAGAAINAQNNLGQTPLHICAEENSELVLKYLYNNKANANILDNKDRGAIYMAAVKGNTKLVEFLIDKYKSNILTRDKD 474          

HSP 2 Score: 77.411 bits (189), Expect = 6.679e-15
Identity = 76/285 (26.67%), Postives = 124/285 (43.51%), Query Frame = 2
Query:  416 MNC----SMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRR---------TIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAP-IDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK-FKCNVFARD 1225
            MNC    + K   + V++ +R F+K   +  +++ ++G T L LA +   L +V  LL+ GAN   +  +G+T LH +AKY    +++ L SK  +       T    LH+A             +  P  I + L  +KN   Q    G+ +L  A + G     + LL     ++++     NG    H A     +    LL    A  +  ++  G+T LH+        I   L    A  N  DN+  TPLH AA+ G+ K+ + L++   KCN    D
Sbjct:  937 MNCVHLAASKGSLSVVKEFMR-FNKF-IIHEVRNKSSGSTPLHLAIEGGHLKVVKTLLDAGANPCDENNEGMTGLHIAAKYGHILLLEYLKSK-VNLMFESKKTGMTALHIASHYGQIDFVRELLVEVPAHIKSKLPKSKNNESQFTDSGLTALHLASQSGHENLVRLLLNYSG-VEVDSATDSNGTIPLHLAVLNGHISVTSLLLSKSATQLTKKDRKGRTALHLVSSHGHLEITVLLIGQGADINDKDNLGFTPLHYAAKSGYLKVCKLLVESGAKCNAQTND 1217          

HSP 3 Score: 70.8626 bits (172), Expect = 7.821e-13
Identity = 71/254 (27.95%), Postives = 114/254 (44.88%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPG--LISALLKATKNGRLQIDSEGMNSLIHAI-EVGAVTTAKELLEKDA--DIQMNKKRKLNGDTAFHTACRRRDLDAIKLLC----------DAEAPIDIQNSFGQTGLHICV---------EENDENIVKYLHSYKASANI--VDNMDRTPLHIAAEKG----FTKIVEF 1186
            G   L  A ++  + +V  LLE GANVN++TKD  T LH + KY    +V++L+   A+ N    +   +PLH+A    +   G      LLK+  N    + +    +++H + ++G +   K L  + A   IQ N+     G+++FH A +      +K             D +  I+  N  G+T +H  V         E  D +I+K L        I  +DN D +PLH  A  G     T+IV+F
Sbjct:  508 GSVCLHTAAQQGHINVVRALLEKGANVNARTKDLYTPLHIAVKYGHPGVVEILIGYGAEANCKGGLFDEFPLHIA---AVSKSGDNCFEMLLKSGANVNAVMKTG--ETVLHVVSKMGNLEMVKSLFNEGACPIIQCNE-----GNSSFHVAVKNCHFHVVKEFVKFINKNMNRYDLKNIINQLNKNGETSMHFAVKLGKDLLHSESEDVDIIKLLLENGGDIKITNMDN-DESPLHYCAAAGNSDILTEIVQF 750          

HSP 4 Score: 67.781 bits (164), Expect = 7.951e-12
Identity = 71/238 (29.83%), Postives = 115/238 (48.32%), Query Frame = 2
Query:  506 SNTGETLLMLACKENKLVIVDRLL-ELGANVNSKTKDGLTALHYSAKYSKEEIVK-LLLSKNADPNICDNITK-YYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEA-PIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDR---TPLHIAAEKGFTKIV-EFLID 1195
            S  G T L +A +     +V+ L+ +  A V+ KT +G T LH +A+  + ++ K LL  K   P+   + TK   P+HLA +     P ++   L+      +  + EGMN +  A   G+++  KE +  +  I    + K +G T  H A     L  +K L DA A P D +N+ G TGLHI  +     +++YL   K+  N++    +   T LHIA+  G    V E L++
Sbjct:  829 SKHGLTPLHMAAQNGHKNLVELLIRKYNAAVDLKTLNGKTPLHMAAEQGQIDVCKSLLFDKYCCPDPSASDTKGQTPMHLAAKND--HPEVVKLFLRYKPELLMVNNLEGMNCVHLAASKGSLSVVKEFMRFNKFIIHEVRNKSSGSTPLHLAIEGGHLKVVKTLLDAGANPCD-ENNEGMTGLHIAAKYGHILLLEYL---KSKVNLMFESKKTGMTALHIASHYGQIDFVRELLVE 1060          

HSP 5 Score: 60.077 bits (144), Expect = 2.094e-9
Identity = 62/234 (26.50%), Postives = 96/234 (41.03%), Query Frame = 2
Query:  494 NIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEV-GAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
            N+K   +G+  L +AC++N L     L E GA +N++   G T LH  A+ + E ++K L +  A+ NI DN  +      A +       L+  L+   K+  L  D +G N+L+H   + G   T    L                         RR +           P+ + N  G   LH   ++   N+V+ L    A+ N       TPLHIA + G   +VE LI
Sbjct:  368 NMKRKESGDNALHIACRKNDLESARLLCEAGAAINAQNNLGQTPLHICAEENSELVLKYLYNNKANANILDNKDRGAIYMAAVKGNT---KLVEFLIDKYKSNILTRDKDG-NTLMHITSMCGFEETTMSFL-------------------------RRGV-----------PLHMPNKNGSVCLHTAAQQGHINVVRALLEKGANVNARTKDLYTPLHIAVKYGHPGVVEILI 561          

HSP 6 Score: 58.5362 bits (140), Expect = 6.507e-9
Identity = 67/272 (24.63%), Postives = 111/272 (40.81%), Query Frame = 2
Query:  566 DRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNI-CDNITKYYPLHLACRRTIPPPGLISALLKAT---------KNGRLQIDSEGMNSLIHAIEVGA---------VTTAKELLEKDADIQM-------------------------------------NKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNV 1213
            + LL+ GANVN+  K G T LH  +K    E+VK L ++ A P I C+     +  H+A +       ++   +K           KN   Q++  G  S+  A+++G          V   K LLE   DI++                                     NK+ K NG +    A       ++++L   ++ +D+ + +G T LH+  E+    + + L + K+  N       TPLH+AA+ G   +VE LI K+   V
Sbjct:  593 EMLLKSGANVNAVMKTGETVLHVVSKMGNLEMVKSLFNEGACPIIQCNEGNSSF--HVAVKNC--HFHVVKEFVKFINKNMNRYDLKNIINQLNKNGETSMHFAVKLGKDLLHSESEDVDIIKLLLENGGDIKITNMDNDESPLHYCAAAGNSDILTEIVQFYGNEMHNFVNKQTK-NGWSPLLFASDNGHHKSVEILLQNDSRVDLFDEYGMTALHLAAEKGHSEVAEILLTNKSFVNAKSKHGLTPLHMAAQNGHKNLVELLIRKYNAAV 859          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000020709.1 (SMESG000020709.1)

HSP 1 Score: 330.102 bits (845), Expect = 3.229e-101
Identity = 165/273 (60.44%), Postives = 203/273 (74.36%), Query Frame = 2
Query:  413 IMNCSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
             M   MKN+W T EQLLR F KE+ L N K+  TGET LM AC+EN+LVIV+RLL++  NVN+K+ DG  ALHY+AKYS  EIVKLLLSK AD NI +N  KY PLHLAC RT+ P GLIS LLK T+NGRLQ D  G   L+ A+E G + T KELLEKD D Q+N KRK +GD A H ACR+ DL++ +LLC+A A I+ QN+ GQT LHIC EEN E ++KYL++ KA+ANI+DN DR  +++AA KG TK+VEFLIDK+K N+  RDKD
Sbjct:  229 FMELCMKNQWVTCEQLLRTFKKESCLTNYKNHETGETPLMFACRENRLVIVERLLDIEVNVNAKSMDGRNALHYAAKYSNYEIVKLLLSKKADANIFENTNKYLPLHLACNRTVVPSGLISNLLKVTRNGRLQKDKNGSIPLMFAVENGLIMTIKELLEKDVDAQINMKRKESGDNALHIACRKNDLESARLLCEAGAAINAQNNLGQTPLHICAEENSELVLKYLYNNKANANILDNKDRGAIYMAAVKGNTKLVEFLIDKYKSNILTRDKD 501          

HSP 2 Score: 77.411 bits (189), Expect = 7.001e-15
Identity = 76/285 (26.67%), Postives = 124/285 (43.51%), Query Frame = 2
Query:  416 MNC----SMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRR---------TIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAP-IDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK-FKCNVFARD 1225
            MNC    + K   + V++ +R F+K   +  +++ ++G T L LA +   L +V  LL+ GAN   +  +G+T LH +AKY    +++ L SK  +       T    LH+A             +  P  I + L  +KN   Q    G+ +L  A + G     + LL     ++++     NG    H A     +    LL    A  +  ++  G+T LH+        I   L    A  N  DN+  TPLH AA+ G+ K+ + L++   KCN    D
Sbjct:  964 MNCVHLAASKGSLSVVKEFMR-FNKF-IIHEVRNKSSGSTPLHLAIEGGHLKVVKTLLDAGANPCDENNEGMTGLHIAAKYGHILLLEYLKSK-VNLMFESKKTGMTALHIASHYGQIDFVRELLVEVPAHIKSKLPKSKNNESQFTDSGLTALHLASQSGHENLVRLLLNYSG-VEVDSATDSNGTIPLHLAVLNGHISVTSLLLSKSATQLTKKDRKGRTALHLVSSHGHLEITVLLIGQGADINDKDNLGFTPLHYAAKSGYLKVCKLLVESGAKCNAQTND 1244          

HSP 3 Score: 70.8626 bits (172), Expect = 7.635e-13
Identity = 71/254 (27.95%), Postives = 114/254 (44.88%), Query Frame = 2
Query:  515 GETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPG--LISALLKATKNGRLQIDSEGMNSLIHAI-EVGAVTTAKELLEKDA--DIQMNKKRKLNGDTAFHTACRRRDLDAIKLLC----------DAEAPIDIQNSFGQTGLHICV---------EENDENIVKYLHSYKASANI--VDNMDRTPLHIAAEKG----FTKIVEF 1186
            G   L  A ++  + +V  LLE GANVN++TKD  T LH + KY    +V++L+   A+ N    +   +PLH+A    +   G      LLK+  N    + +    +++H + ++G +   K L  + A   IQ N+     G+++FH A +      +K             D +  I+  N  G+T +H  V         E  D +I+K L        I  +DN D +PLH  A  G     T+IV+F
Sbjct:  535 GSVCLHTAAQQGHINVVRALLEKGANVNARTKDLYTPLHIAVKYGHPGVVEILIGYGAEANCKGGLFDEFPLHIAA---VSKSGDNCFEMLLKSGANVNAVMKTG--ETVLHVVSKMGNLEMVKSLFNEGACPIIQCNE-----GNSSFHVAVKNCHFHVVKEFVKFINKNMNRYDLKNIINQLNKNGETSMHFAVKLGKDLLHSESEDVDIIKLLLENGGDIKITNMDN-DESPLHYCAAAGNSDILTEIVQF 777          

HSP 4 Score: 67.781 bits (164), Expect = 8.476e-12
Identity = 71/238 (29.83%), Postives = 115/238 (48.32%), Query Frame = 2
Query:  506 SNTGETLLMLACKENKLVIVDRLL-ELGANVNSKTKDGLTALHYSAKYSKEEIVK-LLLSKNADPNICDNITK-YYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEA-PIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDR---TPLHIAAEKGFTKIV-EFLID 1195
            S  G T L +A +     +V+ L+ +  A V+ KT +G T LH +A+  + ++ K LL  K   P+   + TK   P+HLA +     P ++   L+      +  + EGMN +  A   G+++  KE +  +  I    + K +G T  H A     L  +K L DA A P D +N+ G TGLHI  +     +++YL   K+  N++    +   T LHIA+  G    V E L++
Sbjct:  856 SKHGLTPLHMAAQNGHKNLVELLIRKYNAAVDLKTLNGKTPLHMAAEQGQIDVCKSLLFDKYCCPDPSASDTKGQTPMHLAAKND--HPEVVKLFLRYKPELLMVNNLEGMNCVHLAASKGSLSVVKEFMRFNKFIIHEVRNKSSGSTPLHLAIEGGHLKVVKTLLDAGANPCD-ENNEGMTGLHIAAKYGHILLLEYL---KSKVNLMFESKKTGMTALHIASHYGQIDFVRELLVE 1087          

HSP 5 Score: 60.077 bits (144), Expect = 2.310e-9
Identity = 62/234 (26.50%), Postives = 96/234 (41.03%), Query Frame = 2
Query:  494 NIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEV-GAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
            N+K   +G+  L +AC++N L     L E GA +N++   G T LH  A+ + E ++K L +  A+ NI DN  +      A +       L+  L+   K+  L  D +G N+L+H   + G   T    L                         RR +           P+ + N  G   LH   ++   N+V+ L    A+ N       TPLHIA + G   +VE LI
Sbjct:  395 NMKRKESGDNALHIACRKNDLESARLLCEAGAAINAQNNLGQTPLHICAEENSELVLKYLYNNKANANILDNKDRGAIYMAAVKGNT---KLVEFLIDKYKSNILTRDKDG-NTLMHITSMCGFEETTMSFL-------------------------RRGV-----------PLHMPNKNGSVCLHTAAQQGHINVVRALLEKGANVNARTKDLYTPLHIAVKYGHPGVVEILI 588          

HSP 6 Score: 58.5362 bits (140), Expect = 6.578e-9
Identity = 67/272 (24.63%), Postives = 111/272 (40.81%), Query Frame = 2
Query:  566 DRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNI-CDNITKYYPLHLACRRTIPPPGLISALLKAT---------KNGRLQIDSEGMNSLIHAIEVGA---------VTTAKELLEKDADIQM-------------------------------------NKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNV 1213
            + LL+ GANVN+  K G T LH  +K    E+VK L ++ A P I C+     +  H+A +       ++   +K           KN   Q++  G  S+  A+++G          V   K LLE   DI++                                     NK+ K NG +    A       ++++L   ++ +D+ + +G T LH+  E+    + + L + K+  N       TPLH+AA+ G   +VE LI K+   V
Sbjct:  620 EMLLKSGANVNAVMKTGETVLHVVSKMGNLEMVKSLFNEGACPIIQCNEGNSSF--HVAVKNC--HFHVVKEFVKFINKNMNRYDLKNIINQLNKNGETSMHFAVKLGKDLLHSESEDVDIIKLLLENGGDIKITNMDNDESPLHYCAAAGNSDILTEIVQFYGNEMHNFVNKQTK-NGWSPLLFASDNGHHKSVEILLQNDSRVDLFDEYGMTALHLAAEKGHSEVAEILLTNKSFVNAKSKHGLTPLHMAAQNGHKNLVELLIRKYNAAV 886          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000020706.1 (SMESG000020706.1)

HSP 1 Score: 321.627 bits (823), Expect = 1.596e-98
Identity = 155/275 (56.36%), Postives = 202/275 (73.45%), Query Frame = 2
Query:  407 SKIMNCSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFARDKD 1231
            +K M+   K EW  VE LLR +SKE  LP  +D  T ET LMLACK+N+L+ VDRLLE+G N N   KDG TALHY+AK++ E++VKLLL+K ADPN+    TK  P+HLAC RT    G + +LLKATK+ RLQ+D EG  SL++AIE G+++T KELL+ + + Q N K+K +GD A H ACR++D++A++LLCDA A I+++N  GQT LHI  E NDE I+KY+ S  A  N++D+MDR+ LH+AAEKG TKIVE LIDKFKCNV  RDK+
Sbjct:  257 AKFMDLCFKGEWGNVEALLRSYSKEKPLPKYRDPETDETPLMLACKDNRLLAVDRLLEMGVNPNDVAKDGRTALHYAAKFATEDVVKLLLAKKADPNLFGGSTKCLPIHLACSRTGTSSGTVISLLKATKSARLQMDKEGAISLMYAIEAGSISTIKELLKAECEQQTNIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYIQSTIADVNVLDDMDRSALHMAAEKGHTKIVELLIDKFKCNVLTRDKE 531          

HSP 2 Score: 80.1073 bits (196), Expect = 9.564e-16
Identity = 70/274 (25.55%), Postives = 116/274 (42.34%), Query Frame = 2
Query:  416 MNCSMKNEWNTVEQLLRQFSKENS--LPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRR----------TIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSF-GQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDK 1198
            M C      N    ++++F + N   +  +K+ +TG T L LA +     +V  LL+ GAN   +  DG+T LH +AKY    ++++L  K     +  N +   PLH+A             T  P  + S   K  +  +  +   G+  L  A + G     + LL  D  +++N     NG T  H A +    +   +L    +    +  F G+T LH         +        A  N  DNM  TPLH AA+ G+ K+ + L+++
Sbjct:  994 MTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKPK-ISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANIKSERPKTGEQMKDVLTESGLTPLHLASQSGHENLVRLLLNCDG-VEVNSATNNNGTTPLHFASQNGHTNVTSILLGKSSNQITRRDFKGRTALHFASSHGHIEMAALFIGQGADINASDNMGFTPLHYAAKSGYLKVCKLLVER 1265          

HSP 3 Score: 69.3218 bits (168), Expect = 2.388e-12
Identity = 79/287 (27.53%), Postives = 118/287 (41.11%), Query Frame = 2
Query:  425 SMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLC----------DAEAPIDIQNSFGQTGLHICVE---------ENDENIVKYLHSYKASANI-VDNMDRTPLHIAAEKG----FTKIVEFLIDKFKCNV 1213
            S+     T   LLR+      +P    + TG   L  A +   + +V  LL+ GANVN++TKD  T LH + KY    +V+ L+   A  N    I    PLH+A   T         LLK+  N   +    G ++L  A   G +   K LL++ AD  +  K   +G++  H   R      ++ L           DA   +++ N+ G+T +H   E           D +I+K L  Y     I     + TPLH  A  G      +IV FL  K +  V
Sbjct:  540 SISGHPETTMSLLRR-----GVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFKGGILDESPLHVAA-TTKNGEKCAEMLLKSGANVN-ETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICK---DGNSPLHIGVRYCHYLIVQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVV 816          

HSP 4 Score: 67.0106 bits (162), Expect = 1.320e-11
Identity = 67/241 (27.80%), Postives = 109/241 (45.23%), Query Frame = 2
Query:  506 SNTGETLLMLACKENKLVIVDRLL-ELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKN---ADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMD-RTPLHIAAEKGFTKIVEFLIDKFKCNV 1213
            S  G T L LA +     +V++L+ E  A V++ T +  T LH +A+Y ++E+ + LL      ADP   D+  +  PLHLA +       ++   L+      +    +GM     A   G++   KE +  +  +    K K  G TA H A        +K+L DA A    +N+ G T LH+  +    ++++ L   K S  +V N    TPLH+AA  G    V  ++     N+
Sbjct:  886 SKGGLTPLHLAAQNGYKDLVEKLINENKATVDALTLNRKTPLHLAAQYGRKEVCRSLLYHKIYPADPKAADSRGQT-PLHLAAKND--HSDVVRLFLRFKPELLINASHDGMTCGHIAAANGSLAVIKEFMRFNKSVIHGLKNKSTGSTALHLAAEGGHHKLVKVLLDAGANPAEENNDGMTCLHLAAKYGHFHLLEVLKP-KISFRVVSNKSGMTPLHVAAHYGQIDFVGEMLTDVPANI 1122          

HSP 5 Score: 67.0106 bits (162), Expect = 1.479e-11
Identity = 72/277 (25.99%), Postives = 115/277 (41.52%), Query Frame = 2
Query:  566 DRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNI-CDNITKYYPLHLA---CRRTIPPPGLISALLKATKNGRLQIDS---------EGMNSLIHAIEVGA---------VTTAKELLEKDADIQM-------------------------------------NKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLIDKFKCNVFA 1219
            + LL+ GANVN   K+G +ALH +++    E++K LL + ADP+I C +     PLH+    C   I     +  L+      + +ID+         EG  ++  A E+               K LLE D D+++                                     NK+ K NG +    A      + + +L    A +D+ +  G T LH+  E+  +N+   L  +KA  N       TPLH+AA+ G+  +VE LI++ K  V A
Sbjct:  650 EMLLKSGANVNETMKNGESALHIASRSGNLEMLKSLLQEGADPSIICKDGNS--PLHIGVRYCHYLI-----VQELVSFYNKTKSRIDAMMLVNLPNNEGETAVHFAAELVQKRKHSDFEDTDIIKMLLEYDGDVKIQTKYTEETPLHYCATAGNSDVLLEIVNFLEHKIQLVVNKQAK-NGWSPLLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHKNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYKDLVEKLINENKATVDA 918          

HSP 6 Score: 63.1586 bits (152), Expect = 2.309e-10
Identity = 66/251 (26.29%), Postives = 109/251 (43.43%), Query Frame = 2
Query:  443 NTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIVDRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNITKYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEV-GAVTTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPIDIQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKGFTKIVEFLI 1192
            +T+++LL+   ++ +  NIK   +G+  + +AC++  +  +  L +  A +N K   G T LH +A+ + E I+K + S  AD N+ D++ +   LH+A  +      ++  L+   K   L  D EG N+L+H   + G   T   LL                         RR +           P+ + N  G   LH   +    N+VK L    A+ N       TPLHIA + G   +VE LI
Sbjct:  410 STIKELLKAECEQQT--NIKKKYSGDAAIHIACRKKDVEALRLLCDANAQINMKNGMGQTVLHIAAEGNDETILKYIQSTIADVNVLDDMDRS-ALHMAAEKG--HTKIVELLIDKFKCNVLTRDKEG-NTLMHVTSISGHPETTMSLL-------------------------RRGV-----------PLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLI 618          
The following BLAST results are available for this feature:
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANK25.942e-2331.03ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK22.605e-2231.20ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK22.605e-2231.20ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK22.655e-2231.20ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK22.955e-2231.20ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trp-48.595e-3533.92TRP (Transient receptor potential) channel family ... [more]
unc-441.441e-1828.88AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.441e-1828.88AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.490e-1828.88AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.490e-1828.88AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nompC1.322e-6041.46gene:FBgn0016920 transcript:FBtr0300012[more]
nompC1.349e-6041.46gene:FBgn0016920 transcript:FBtr0304843[more]
nompC1.375e-6041.46gene:FBgn0016920 transcript:FBtr0343224[more]
nompC1.670e-6041.46gene:FBgn0016920 transcript:FBtr0347409[more]
nompC1.751e-6041.46gene:FBgn0016920 transcript:FBtr0347408[more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank3a9.053e-2332.53ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank3a9.053e-2332.53ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
BX469921.11.118e-2232.53ankyrin 3a [Source:NCBI gene;Acc:103909035][more]
BX469921.13.979e-2232.68ankyrin 3a [Source:NCBI gene;Acc:103909035][more]
ank3a4.441e-2232.68ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snx141.376e-6048.33sorting nexin 14 [Source:Xenbase;Acc:XB-GENE-98418... [more]
snx141.096e-3349.64sorting nexin 14 [Source:Xenbase;Acc:XB-GENE-98418... [more]
ANK18.199e-2332.91ankyrin 1 [Source:NCBI gene;Acc:613080][more]
ANK19.252e-2332.91ankyrin 1 [Source:NCBI gene;Acc:613080][more]
ANK11.055e-2232.91ankyrin 1 [Source:NCBI gene;Acc:613080][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank22.899e-2131.98ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025][more]
Ank23.304e-2131.98ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025][more]
Ank35.907e-2130.24ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank36.710e-2130.24ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank37.048e-2130.24ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|G5E8K5|ANK3_MOUSE5.821e-2030.24Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV... [more]
sp|Q01484|ANK2_HUMAN8.174e-2032.39Ankyrin-2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=... [more]
sp|O70511|ANK3_RAT2.017e-1927.50Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE... [more]
sp|Q8C8R3|ANK2_MOUSE2.299e-1931.98Ankyrin-2 OS=Mus musculus OX=10090 GN=Ank2 PE=1 SV... [more]
sp|Q12955|ANK3_HUMAN1.197e-1828.42Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DZS71.684e-7647.81ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A267GWH22.637e-7647.45ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A267FPR42.721e-7647.45ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A267F7B09.492e-7648.00ANK_REP_REGION domain-containing protein (Fragment... [more]
A0A267DZ633.734e-7447.64ANK_REP_REGION domain-containing protein (Fragment... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000016978.29.154e-6442.18serine/threonine-protein phosphatase 6 regulatory ... [more]
ENSAMXT00000048767.11.328e-6342.18serine/threonine-protein phosphatase 6 regulatory ... [more]
ank3a2.431e-2131.89ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank3a3.454e-2131.89ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank3b5.573e-2129.46ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000093.11.022e-2129.92pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
ENSPMAT00000000095.11.904e-2129.92pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
ENSPMAT00000007449.17.689e-2027.00pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1... [more]
ENSPMAT00000007446.19.455e-2027.00pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1... [more]
ENSPMAT00000009608.11.149e-1528.62pep scaffold:Pmarinus_7.0:GL477242:23155:61557:-1 ... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
NAS69.765e-1229.82Evolutionarily conserved 19S regulatory particle a... [more]
AKR12.150e-929.23Palmitoyl transferase involved in protein palmitoy... [more]
AKR21.719e-629.09Ankyrin repeat-containing protein; member of a fam... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO447114.772e-1330.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO381803.468e-1243.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436904.796e-1033.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426165.106e-1027.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO341611.039e-937.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000006308.21.303e-1931.14pep primary_assembly:ASM223467v1:1:12516834:125306... [more]
ank1a2.094e-1928.08ankyrin-1 [Source:NCBI gene;Acc:101174837][more]
dapk12.831e-1930.13death associated protein kinase 1 [Source:NCBI gen... [more]
dapk12.844e-1930.13death associated protein kinase 1 [Source:NCBI gen... [more]
dapk12.959e-1930.13death associated protein kinase 1 [Source:NCBI gen... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020707.13.068e-13100.00SMESG000020707.1[more]
SMESG000020705.15.243e-11158.91SMESG000020705.1[more]
SMESG000020709.12.755e-10160.44SMESG000020709.1[more]
SMESG000020709.13.229e-10160.44SMESG000020709.1[more]
SMESG000020706.11.596e-9856.36SMESG000020706.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016480 ID=SMED30016480|Name=ANK_REP_REGION domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1232bp
ATGAAATCTTCAGATAATATCATCAAAAAAGCTTCAATGAATGTCGGAGA
GATTTTCCAAATGATGACAACCAAAAATAGTGAATCCGATTCCGAGTCTG
ACTTGATGAGACCTTCGACAGAAAATGATAAACTTTATGACTTCCAACCT
CTTAATTTACCGAAATTAGATTTTTCAAATTATTTAAACAGCCCATCTTT
TAAGTCAAAAGAGAAACAACAAAACAACGAAGACATGGATCCGATCATTC
AAATGCCGCTGACCACTTCTACCAAATCCAACGAAACAAAAATAAAATCA
AAAAAGCAAAAAAAATCAAAATGATCCTAAAAAACATTTGAATTTCATAG
GAAGGTTAACAACAGAAGAAAAAGACGAATTAAAATTAGACGAAGAGACA
TTGGAATCTAAAATAATGAATTGTTCCATGAAAAACGAATGGAATACTGT
TGAACAATTACTTCGACAATTTAGCAAAGAAAATTCTCTTCCTAATATAA
AAGATTCAAATACCGGAGAAACGCTTCTGATGTTGGCTTGTAAAGAGAAT
AAATTGGTAATTGTAGATCGTTTGTTGGAATTGGGCGCCAATGTCAATTC
AAAGACAAAAGATGGCCTAACAGCTTTACATTATTCTGCTAAATATTCAA
AAGAAGAAATTGTTAAGTTGCTTTTATCAAAAAATGCTGATCCCAATATA
TGTGATAATATCACAAAATATTATCCGTTACATTTGGCATGTAGACGTAC
AATACCTCCACCAGGTCTGATTTCAGCTTTGCTAAAGGCTACTAAAAATG
GACGACTTCAAATTGATAGCGAAGGCATGAATTCTCTGATTCACGCCATT
GAAGTTGGGGCAGTAACAACCGCAAAGGAATTACTAGAGAAAGATGCAGA
CATTCAGATGAATAAAAAAAGAAAGTTGAACGGAGACACGGCCTTTCATA
CGGCATGCCGTAGGAGAGATCTCGATGCAATAAAATTACTCTGTGACGCC
GAAGCGCCAATTGACATTCAAAATAGCTTCGGTCAAACAGGTTTGCACAT
CTGTGTGGAGGAAAATGATGAGAATATTGTGAAATATTTGCACTCGTATA
AGGCATCAGCAAATATAGTTGATAATATGGATCGAACACCTCTCCATATT
GCTGCAGAAAAAGGCTTTACAAAGATTGTGGAATTTCTGATTGACAAATT
CAAGTGCAATGTTTTTGCGAGAGATAAAGACG
back to top

protein sequence of SMED30016480-orf-1

>SMED30016480-orf-1 ID=SMED30016480-orf-1|Name=SMED30016480-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=108bp
MKSSDNIIKKASMNVGEIFQMMTTKNSESDSESDLMRPSTENDKLYDFQP
LNLPKLDFSNYLNSPSFKSKEKQQNNEDMDPIIQMPLTTSTKSNETKIKS
KKQKKSK*
back to top

protein sequence of SMED30016480-orf-2

>SMED30016480-orf-2 ID=SMED30016480-orf-2|Name=SMED30016480-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=272bp
MNCSMKNEWNTVEQLLRQFSKENSLPNIKDSNTGETLLMLACKENKLVIV
DRLLELGANVNSKTKDGLTALHYSAKYSKEEIVKLLLSKNADPNICDNIT
KYYPLHLACRRTIPPPGLISALLKATKNGRLQIDSEGMNSLIHAIEVGAV
TTAKELLEKDADIQMNKKRKLNGDTAFHTACRRRDLDAIKLLCDAEAPID
IQNSFGQTGLHICVEENDENIVKYLHSYKASANIVDNMDRTPLHIAAEKG
FTKIVEFLIDKFKCNVFARDKD
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005216ion channel activity
GO:0005515protein binding
GO:0005262calcium channel activity
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0055085transmembrane transport
GO:0070588calcium ion transmembrane transport
Vocabulary: INTERPRO
TermDefinition
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 64..107
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 78..94