Serine/threonine-protein kinase

Overview
NameSerine/threonine-protein kinase
Smed IDSMED30016474
Length (bp)1902
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/threonine-protein kinase (SMED30016474) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/threonine-protein kinase (SMED30016474) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine/threonine-protein kinase (SMED30016474) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine/threonine-protein kinase (SMED30016474) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016474

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30016474h1SMcG0011413 SmedASXL_010457SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30016474h1SMcG0011413 dd_Smed_v4_22156_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30016474h1SMcG0011413 dd_Smed_v6_22156_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine-protein kinase vs. Ensembl Human
Match: DCLK1 (doublecortin like kinase 1 [Source:HGNC Symbol;Acc:HGNC:2700])

HSP 1 Score: 117.472 bits (293), Expect = 5.802e-28
Identity = 66/220 (30.00%), Postives = 121/220 (55.00%), Query Frame = 2
Query:  284 HRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKG-KQIYSTDELEDCEAYVIAGPEPFKALVYSQKPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDNDLQRNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVGI 940
            +R  T   L+  ++ K + FY NGD ++KGI  +I+P+R+ +F+ LL DL + +  N++LP G+R I+T  G K+I S D+L + E+YV    EPFK L Y++  + N      +   +     +       S+    ++  +PK++T+I+       A+R++LNK +  S  Q++  + ++ +    DS  + +L+T+ GK V  ++D    DD+F+  
Sbjct:   42 YRTRTLQTLSSEKKAKKVRFYRNGDRYFKGIVYAISPDRFRSFEALLADLTRTLSDNVNLPQGVRTIYTIDGLKKISSLDQLVEGESYVCGSIEPFKKLEYTKNVNPNWSVNVKTTSASRAVSSLATAKGSPSEVRENKDFIRPKLVTIIRSGVKPRKAVRILLNKKTAHSFEQVLTDITDAIK---LDSGVVKRLYTLDGKQVMCLQDFFGDDDIFIAC 258          
BLAST of Serine/threonine-protein kinase vs. Ensembl Human
Match: DCLK1 (doublecortin like kinase 1 [Source:HGNC Symbol;Acc:HGNC:2700])

HSP 1 Score: 116.701 bits (291), Expect = 1.601e-26
Identity = 66/219 (30.14%), Postives = 121/219 (55.25%), Query Frame = 2
Query:  284 HRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKG-KQIYSTDELEDCEAYVIAGPEPFKALVYSQKPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDNDLQRNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVG 937
            +R  T   L+  ++ K + FY NGD ++KGI  +I+P+R+ +F+ LL DL + +  N++LP G+R I+T  G K+I S D+L + E+YV    EPFK L Y++  + N      +   +     +       S+    ++  +PK++T+I+       A+R++LNK +  S  Q++  + ++ +    DS  + +L+T+ GK V  ++D    DD+F+ 
Sbjct:   42 YRTRTLQTLSSEKKAKKVRFYRNGDRYFKGIVYAISPDRFRSFEALLADLTRTLSDNVNLPQGVRTIYTIDGLKKISSLDQLVEGESYVCGSIEPFKKLEYTKNVNPNWSVNVKTTSASRAVSSLATAKGSPSEVRENKDFIRPKLVTIIRSGVKPRKAVRILLNKKTAHSFEQVLTDITDAIK---LDSGVVKRLYTLDGKQVMCLQDFFGDDDIFIA 257          
BLAST of Serine/threonine-protein kinase vs. Ensembl Human
Match: DCLK1 (doublecortin like kinase 1 [Source:HGNC Symbol;Acc:HGNC:2700])

HSP 1 Score: 116.316 bits (290), Expect = 2.270e-26
Identity = 66/219 (30.14%), Postives = 121/219 (55.25%), Query Frame = 2
Query:  284 HRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKG-KQIYSTDELEDCEAYVIAGPEPFKALVYSQKPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDNDLQRNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVG 937
            +R  T   L+  ++ K + FY NGD ++KGI  +I+P+R+ +F+ LL DL + +  N++LP G+R I+T  G K+I S D+L + E+YV    EPFK L Y++  + N      +   +     +       S+    ++  +PK++T+I+       A+R++LNK +  S  Q++  + ++ +    DS  + +L+T+ GK V  ++D    DD+F+ 
Sbjct:   42 YRTRTLQTLSSEKKAKKVRFYRNGDRYFKGIVYAISPDRFRSFEALLADLTRTLSDNVNLPQGVRTIYTIDGLKKISSLDQLVEGESYVCGSIEPFKKLEYTKNVNPNWSVNVKTTSASRAVSSLATAKGSPSEVRENKDFIRPKLVTIIRSGVKPRKAVRILLNKKTAHSFEQVLTDITDAIK---LDSGVVKRLYTLDGKQVMCLQDFFGDDDIFIA 257          
BLAST of Serine/threonine-protein kinase vs. Ensembl Human
Match: DCX (doublecortin [Source:HGNC Symbol;Acc:HGNC:2714])

HSP 1 Score: 105.916 bits (263), Expect = 4.553e-24
Identity = 64/220 (29.09%), Postives = 119/220 (54.09%), Query Frame = 2
Query:  284 HRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKG-KQIYSTDELEDCEAYVIAGPEPFKALVYSQKPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDNDLQRNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVGI 940
            +R  T   L++ ++ K + FY NGD ++KGI  +++ +R+ +F  LL DL + +  NI+LP G+R I+T  G ++I S DELE+ E+YV +    FK + Y++  + N      +       Q +    +  +  +  ++  +PK++T+I+       A+RV+LNK +  S  Q++  +  + + +   +  + KL+T+ GK V  + D    DDVF+  
Sbjct:   38 YRTRTLQALSNEKKAKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFKKVEYTKNVNPNWSVNVKTSANMKAPQSLASSNSAQAREN--KDFVRPKLVTIIRSGVKPRKAVRVLLNKKTAHSFEQVLTDITEAIKLE---TGVVKKLYTLDGKQVTCLHDFFGDDDVFIAC 252          
BLAST of Serine/threonine-protein kinase vs. Ensembl Human
Match: DCX (doublecortin [Source:HGNC Symbol;Acc:HGNC:2714])

HSP 1 Score: 105.916 bits (263), Expect = 4.553e-24
Identity = 64/220 (29.09%), Postives = 119/220 (54.09%), Query Frame = 2
Query:  284 HRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKG-KQIYSTDELEDCEAYVIAGPEPFKALVYSQKPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDNDLQRNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVGI 940
            +R  T   L++ ++ K + FY NGD ++KGI  +++ +R+ +F  LL DL + +  NI+LP G+R I+T  G ++I S DELE+ E+YV +    FK + Y++  + N      +       Q +    +  +  +  ++  +PK++T+I+       A+RV+LNK +  S  Q++  +  + + +   +  + KL+T+ GK V  + D    DDVF+  
Sbjct:   38 YRTRTLQALSNEKKAKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFKKVEYTKNVNPNWSVNVKTSANMKAPQSLASSNSAQAREN--KDFVRPKLVTIIRSGVKPRKAVRVLLNKKTAHSFEQVLTDITEAIKLE---TGVVKKLYTLDGKQVTCLHDFFGDDDVFIAC 252          
BLAST of Serine/threonine-protein kinase vs. Ensembl Celegans
Match: zyg-8 (Serine/threonine-protein kinase zyg-8 [Source:UniProtKB/Swiss-Prot;Acc:Q95QC4])

HSP 1 Score: 88.9669 bits (219), Expect = 3.550e-18
Identity = 70/220 (31.82%), Postives = 106/220 (48.18%), Query Frame = 2
Query:  317 MRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKV-KPNISLPMGIRKIFTRKGKQ-IYSTDELEDCEAYVIAGPEPFKALVYSQKPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDND---------LQRNT--YKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVG 937
            + + K + FY NGD ++KGI  ++  +R  + Q L+ DL K V   + +LP GIR IFT  G Q I S D+ ED   YV +  + FK + YS+    + +              + + Y  H +              NT    P++I VI+         R +LNK +  S  Q++  L  +F  ++ DS  I KLFT+ G+ V S++D  R DDVFV 
Sbjct:  207 LLKAKRLRFYRNGDQYFKGIQYALQSDRVKSMQPLMEDLMKTVICDSTALPHGIRHIFTIDGAQRITSVDQFEDGGGYVCSSTDAFKPVDYSRAAEPSWRLT------------LANRYNRHLETKKLALSVVEPCHENTDFVFPRIIKVIRNGVKPRRISRHLLNKKTARSFDQVLRDL--TFVVKL-DSGAIRKLFTLSGRPVLSLQDFFRDDDVFVA 411          
BLAST of Serine/threonine-protein kinase vs. Ensembl Celegans
Match: zyg-8 (Serine/threonine-protein kinase zyg-8 [Source:UniProtKB/Swiss-Prot;Acc:Q95QC4])

HSP 1 Score: 88.9669 bits (219), Expect = 3.559e-18
Identity = 70/220 (31.82%), Postives = 106/220 (48.18%), Query Frame = 2
Query:  317 MRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKV-KPNISLPMGIRKIFTRKGKQ-IYSTDELEDCEAYVIAGPEPFKALVYSQKPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDND---------LQRNT--YKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVG 937
            + + K + FY NGD ++KGI  ++  +R  + Q L+ DL K V   + +LP GIR IFT  G Q I S D+ ED   YV +  + FK + YS+    + +              + + Y  H +              NT    P++I VI+         R +LNK +  S  Q++  L  +F  ++ DS  I KLFT+ G+ V S++D  R DDVFV 
Sbjct:   54 LLKAKRLRFYRNGDQYFKGIQYALQSDRVKSMQPLMEDLMKTVICDSTALPHGIRHIFTIDGAQRITSVDQFEDGGGYVCSSTDAFKPVDYSRAAEPSWRLT------------LANRYNRHLETKKLALSVVEPCHENTDFVFPRIIKVIRNGVKPRRISRHLLNKKTARSFDQVLRDL--TFVVKL-DSGAIRKLFTLSGRPVLSLQDFFRDDDVFVA 258          
BLAST of Serine/threonine-protein kinase vs. Ensembl Fly
Match: CG17528 (gene:FBgn0261387 transcript:FBtr0111274)

HSP 1 Score: 80.1073 bits (196), Expect = 2.860e-15
Identity = 70/289 (24.22%), Postives = 120/289 (41.52%), Query Frame = 2
Query:  320 RRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKGKQIYSTDELEDCEAYVIA-------------GPEPFKALVYS---------QKPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDNDLQR-----NTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVGIDKDGVTWKEINNIICDLFKDDYEKINIYLQRWEINQEIRSSNLSTKSEHPKKAIQ 1105
            R+   I FY NGD FY GI + ++  RY +F+ L  DL + ++ N+ +P  +R I+   GK+I S DELED ++YV +             G +P   L  S          K   +   K      +      G    + S     R         P+++T+I+        +R++LNK +  S   ++ ++         D+  + K+FT+ G  V  + D    DDVF     + +   E       L  ++   IN+      I + +R++  + K   PK  I+
Sbjct:  155 RKALRIKFYRNGDRFYPGITIPVSNERYRSFERLFEDLTRLLEENVKIPGAVRTIYNLCGKKITSLDELEDGQSYVCSCNNENFKKVEYNTGSQPLSNLPLSNSRSNSHRLAKCRPSSPLKNGLLAGSSPFPACGGGTGNGSPLIASRLSDRVTVVHPRIVTLIRSGTKPRRIMRLLLNKRNSPSFDHVLTAITQVVR---LDTGYVRKVFTLSGIPVVRLSDFFGSDDVFFAYGTERINTAE----DFKLEAEEQRAINV------IRKTMRTTGTTCKGPKPKMPIK 430          
BLAST of Serine/threonine-protein kinase vs. Ensembl Fly
Match: CG17528 (gene:FBgn0261387 transcript:FBtr0111277)

HSP 1 Score: 80.1073 bits (196), Expect = 2.860e-15
Identity = 70/289 (24.22%), Postives = 120/289 (41.52%), Query Frame = 2
Query:  320 RRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKGKQIYSTDELEDCEAYVIA-------------GPEPFKALVYS---------QKPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDNDLQR-----NTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVGIDKDGVTWKEINNIICDLFKDDYEKINIYLQRWEINQEIRSSNLSTKSEHPKKAIQ 1105
            R+   I FY NGD FY GI + ++  RY +F+ L  DL + ++ N+ +P  +R I+   GK+I S DELED ++YV +             G +P   L  S          K   +   K      +      G    + S     R         P+++T+I+        +R++LNK +  S   ++ ++         D+  + K+FT+ G  V  + D    DDVF     + +   E       L  ++   IN+      I + +R++  + K   PK  I+
Sbjct:  155 RKALRIKFYRNGDRFYPGITIPVSNERYRSFERLFEDLTRLLEENVKIPGAVRTIYNLCGKKITSLDELEDGQSYVCSCNNENFKKVEYNTGSQPLSNLPLSNSRSNSHRLAKCRPSSPLKNGLLAGSSPFPACGGGTGNGSPLIASRLSDRVTVVHPRIVTLIRSGTKPRRIMRLLLNKRNSPSFDHVLTAITQVVR---LDTGYVRKVFTLSGIPVVRLSDFFGSDDVFFAYGTERINTAE----DFKLEAEEQRAINV------IRKTMRTTGTTCKGPKPKMPIK 430          
BLAST of Serine/threonine-protein kinase vs. Ensembl Fly
Match: DCX-EMAP (gene:FBgn0259099 transcript:FBtr0331181)

HSP 1 Score: 62.7734 bits (151), Expect = 7.536e-10
Identity = 32/90 (35.56%), Postives = 50/90 (55.56%), Query Frame = 2
Query:  323 RPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKGKQIYSTDELEDCEAYVIAGPEPFKALVYSQK 592
            + + + FY NGD F+ G++L   P R +     L++L  K+ P + LP G R +F+  G + Y  DELED   YV++  + FK   Y +K
Sbjct:  169 KARRVVFYRNGDPFFPGVELRYRPGRDVTS---LDNLLDKISPKMDLPRGARYVFSMDGDRKYHLDELEDGAFYVVSSFKAFKPASYGKK 255          
BLAST of Serine/threonine-protein kinase vs. Ensembl Fly
Match: DCX-EMAP (gene:FBgn0259099 transcript:FBtr0299509)

HSP 1 Score: 62.7734 bits (151), Expect = 8.331e-10
Identity = 32/90 (35.56%), Postives = 50/90 (55.56%), Query Frame = 2
Query:  323 RPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKGKQIYSTDELEDCEAYVIAGPEPFKALVYSQK 592
            + + + FY NGD F+ G++L   P R +     L++L  K+ P + LP G R +F+  G + Y  DELED   YV++  + FK   Y +K
Sbjct:  169 KARRVVFYRNGDPFFPGVELRYRPGRDVTS---LDNLLDKISPKMDLPRGARYVFSMDGDRKYHLDELEDGAFYVVSSFKAFKPASYGKK 255          
BLAST of Serine/threonine-protein kinase vs. Ensembl Zebrafish
Match: dclk1b (doublecortin-like kinase 1b [Source:ZFIN;Acc:ZDB-GENE-080516-7])

HSP 1 Score: 108.612 bits (270), Expect = 3.772e-24
Identity = 59/218 (27.06%), Postives = 114/218 (52.29%), Query Frame = 2
Query:  284 HRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKGKQIYSTDELEDCEAYVIAGPEPFKALVYSQKPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDNDLQRNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVG 937
            +R  T   L+  ++ K + FY NGD ++KGI  +I+ +R+ +F  LL DL + +  N++LP G+R I+   G +I S ++L + E+YV    EP+K   Y++  + N      +         +        +    R+  +PK++T+I+       A+R++LNK +  S  Q++  + ++ +    D+  + +L+T+ GK V  ++D    DD+F+ 
Sbjct:   37 YRTRTLQALSSEKKAKKVRFYRNGDRYFKGIVYAISNDRFRSFDALLADLTRSLSDNVNLPQGVRTIYAIDGSRITSMEQLVEGESYVCGSIEPYKMQEYTKNVNPNWSVNMRTTAGAKPPTSLASAKGGSIETKDNRDFIRPKLVTIIRSGVKPRKAIRILLNKKTAHSFEQVLTDITDAIK---LDTGAVKRLYTVDGKMVTCLQDFFGEDDIFIA 251          
BLAST of Serine/threonine-protein kinase vs. Ensembl Zebrafish
Match: dclk2a (doublecortin-like kinase 2a [Source:ZFIN;Acc:ZDB-GENE-050420-170])

HSP 1 Score: 106.686 bits (265), Expect = 1.797e-23
Identity = 67/250 (26.80%), Postives = 130/250 (52.00%), Query Frame = 2
Query:  284 HRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTR-KGKQIYSTDELEDCEAYVIAGPEPFKALVYSQKPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDNDLQ----RNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVGIDKDGVTWKEINNII----CDLFKDDY 1006
            +R  T   L   ++ K + FY NGD ++KG+  +++ +R+ +F  LL +L + +  N++LP G+R I+T   GK+I S D+L + E+YV A  EPF+ + Y++  + N      +                 + N+L+    ++  KPK++TVI+       A+R++LNK +  S  Q++  + ++ +    DS  + +L+T+ GK +  ++D    DDVF+    +   + + + ++    C + K  Y
Sbjct:   49 YRTRTLQSLTSEKKAKKVRFYRNGDKYFKGLVYAVSGDRFRSFDALLMELTRSLSDNVNLPQGVRSIYTADGGKKITSLDDLVEGESYVCASNEPFRKVDYTKNVNPNWSVNVKTGASRSMPSLTA------TKNELRERESKDYIKPKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITDAIK---LDSGAVKRLYTLEGKQIICLQDFFGDDDVFIACGPEKYRYAQDDFVLDHSECQVIKSSY 289          
BLAST of Serine/threonine-protein kinase vs. Ensembl Zebrafish
Match: dclk2a (doublecortin-like kinase 2a [Source:ZFIN;Acc:ZDB-GENE-050420-170])

HSP 1 Score: 105.531 bits (262), Expect = 3.130e-23
Identity = 67/250 (26.80%), Postives = 130/250 (52.00%), Query Frame = 2
Query:  284 HRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTR-KGKQIYSTDELEDCEAYVIAGPEPFKALVYSQKPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDNDLQ----RNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVGIDKDGVTWKEINNII----CDLFKDDY 1006
            +R  T   L   ++ K + FY NGD ++KG+  +++ +R+ +F  LL +L + +  N++LP G+R I+T   GK+I S D+L + E+YV A  EPF+ + Y++  + N      +                 + N+L+    ++  KPK++TVI+       A+R++LNK +  S  Q++  + ++ +    DS  + +L+T+ GK +  ++D    DDVF+    +   + + + ++    C + K  Y
Sbjct:   49 YRTRTLQSLTSEKKAKKVRFYRNGDKYFKGLVYAVSGDRFRSFDALLMELTRSLSDNVNLPQGVRSIYTADGGKKITSLDDLVEGESYVCASNEPFRKVDYTKNVNPNWSVNVKTGASRSMPSLTA------TKNELRERESKDYIKPKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITDAIK---LDSGAVKRLYTLEGKQIICLQDFFGDDDVFIACGPEKYRYAQDDFVLDHSECQVIKSSY 289          
BLAST of Serine/threonine-protein kinase vs. Ensembl Zebrafish
Match: dclk2a (doublecortin-like kinase 2a [Source:ZFIN;Acc:ZDB-GENE-050420-170])

HSP 1 Score: 104.76 bits (260), Expect = 6.791e-23
Identity = 64/224 (28.57%), Postives = 120/224 (53.57%), Query Frame = 2
Query:  284 HRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTR-KGKQIYSTDELEDCEAYVIAGPEPFKALVYSQKPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDNDLQ----RNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVGI 940
            +R  T   L   ++ K + FY NGD ++KG+  +++ +R+ +F  LL +L + +  N++LP G+R I+T   GK+I S D+L + E+YV A  EPF+ + Y++  + N      +                 + N+L+    ++  KPK++TVI+       A+R++LNK +  S  Q++  + ++ +    DS  + +L+T+ GK +  ++D    DDVF+  
Sbjct:   49 YRTRTLQSLTSEKKAKKVRFYRNGDKYFKGLVYAVSGDRFRSFDALLMELTRSLSDNVNLPQGVRSIYTADGGKKITSLDDLVEGESYVCASNEPFRKVDYTKNVNPNWSVNVKTGASRSMPSLTA------TKNELRERESKDYIKPKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITDAIK---LDSGAVKRLYTLEGKQIICLQDFFGDDDVFIAC 263          
BLAST of Serine/threonine-protein kinase vs. Ensembl Zebrafish
Match: dclk2a (doublecortin-like kinase 2a [Source:ZFIN;Acc:ZDB-GENE-050420-170])

HSP 1 Score: 104.76 bits (260), Expect = 6.791e-23
Identity = 64/224 (28.57%), Postives = 120/224 (53.57%), Query Frame = 2
Query:  284 HRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTR-KGKQIYSTDELEDCEAYVIAGPEPFKALVYSQKPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDNDLQ----RNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVGI 940
            +R  T   L   ++ K + FY NGD ++KG+  +++ +R+ +F  LL +L + +  N++LP G+R I+T   GK+I S D+L + E+YV A  EPF+ + Y++  + N      +                 + N+L+    ++  KPK++TVI+       A+R++LNK +  S  Q++  + ++ +    DS  + +L+T+ GK +  ++D    DDVF+  
Sbjct:   49 YRTRTLQSLTSEKKAKKVRFYRNGDKYFKGLVYAVSGDRFRSFDALLMELTRSLSDNVNLPQGVRSIYTADGGKKITSLDDLVEGESYVCASNEPFRKVDYTKNVNPNWSVNVKTGASRSMPSLTA------TKNELRERESKDYIKPKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITDAIK---LDSGAVKRLYTLEGKQIICLQDFFGDDDVFIAC 263          
BLAST of Serine/threonine-protein kinase vs. Ensembl Xenopus
Match: arhgap24 (Rho GTPase activating protein 24 [Source:Xenbase;Acc:XB-GENE-996257])

HSP 1 Score: 117.857 bits (294), Expect = 5.619e-27
Identity = 67/220 (30.45%), Postives = 122/220 (55.45%), Query Frame = 2
Query:  284 HRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKG-KQIYSTDELEDCEAYVIAGPEPFKALVYSQKPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDNDLQRNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVGI 940
            +R  T   L+  ++ K + FY NGD ++KGI  +I+P+R+ +F+ LL DL + +  N++LP G+R I+T  G K+I S D+L + E+YV    EPFK L Y++  + N      +      +Q +       S+    ++  +PK++T+I+       A+R++LNK +  S  Q++  + ++ +    DS  + +L+T+ GK V  ++D    DD+F+  
Sbjct:   42 YRTRTLQALSSEKKAKKVRFYRNGDRYFKGIVYAISPDRFRSFEALLADLTRTLSDNVNLPQGVRTIYTVDGSKKITSLDQLVEGESYVCGSIEPFKKLDYTKNVNPNWSVNVKTTAAPRSAQPLAAPKQSFSEGRENKDFIRPKLVTIIRSGVKPRKAVRILLNKKTAHSFEQVLTDITDAIK---LDSGVVKRLYTLDGKQVLCLQDFFGDDDIFIAC 258          
BLAST of Serine/threonine-protein kinase vs. Ensembl Xenopus
Match: arhgap24 (Rho GTPase activating protein 24 [Source:Xenbase;Acc:XB-GENE-996257])

HSP 1 Score: 117.857 bits (294), Expect = 6.908e-27
Identity = 67/220 (30.45%), Postives = 122/220 (55.45%), Query Frame = 2
Query:  284 HRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKG-KQIYSTDELEDCEAYVIAGPEPFKALVYSQKPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDNDLQRNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVGI 940
            +R  T   L+  ++ K + FY NGD ++KGI  +I+P+R+ +F+ LL DL + +  N++LP G+R I+T  G K+I S D+L + E+YV    EPFK L Y++  + N      +      +Q +       S+    ++  +PK++T+I+       A+R++LNK +  S  Q++  + ++ +    DS  + +L+T+ GK V  ++D    DD+F+  
Sbjct:   42 YRTRTLQALSSEKKAKKVRFYRNGDRYFKGIVYAISPDRFRSFEALLADLTRTLSDNVNLPQGVRTIYTVDGSKKITSLDQLVEGESYVCGSIEPFKKLDYTKNVNPNWSVNVKTTAAPRSAQPLAAPKQSFSEGRENKDFIRPKLVTIIRSGVKPRKAVRILLNKKTAHSFEQVLTDITDAIK---LDSGVVKRLYTLDGKQVLCLQDFFGDDDIFIAC 258          
BLAST of Serine/threonine-protein kinase vs. Ensembl Xenopus
Match: arhgap24 (Rho GTPase activating protein 24 [Source:Xenbase;Acc:XB-GENE-996257])

HSP 1 Score: 117.472 bits (293), Expect = 7.630e-27
Identity = 67/219 (30.59%), Postives = 122/219 (55.71%), Query Frame = 2
Query:  284 HRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKG-KQIYSTDELEDCEAYVIAGPEPFKALVYSQKPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDNDLQRNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVG 937
            +R  T   L+  ++ K + FY NGD ++KGI  +I+P+R+ +F+ LL DL + +  N++LP G+R I+T  G K+I S D+L + E+YV    EPFK L Y++  + N      +      +Q +       S+    ++  +PK++T+I+       A+R++LNK +  S  Q++  + ++ +    DS  + +L+T+ GK V  ++D    DD+F+ 
Sbjct:   42 YRTRTLQALSSEKKAKKVRFYRNGDRYFKGIVYAISPDRFRSFEALLADLTRTLSDNVNLPQGVRTIYTVDGSKKITSLDQLVEGESYVCGSIEPFKKLDYTKNVNPNWSVNVKTTAAPRSAQPLAAPKQSFSEGRENKDFIRPKLVTIIRSGVKPRKAVRILLNKKTAHSFEQVLTDITDAIK---LDSGVVKRLYTLDGKQVLCLQDFFGDDDIFIA 257          
BLAST of Serine/threonine-protein kinase vs. Ensembl Xenopus
Match: arhgap24 (Rho GTPase activating protein 24 [Source:Xenbase;Acc:XB-GENE-996257])

HSP 1 Score: 117.087 bits (292), Expect = 1.046e-26
Identity = 67/219 (30.59%), Postives = 122/219 (55.71%), Query Frame = 2
Query:  284 HRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKG-KQIYSTDELEDCEAYVIAGPEPFKALVYSQKPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDNDLQRNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVG 937
            +R  T   L+  ++ K + FY NGD ++KGI  +I+P+R+ +F+ LL DL + +  N++LP G+R I+T  G K+I S D+L + E+YV    EPFK L Y++  + N      +      +Q +       S+    ++  +PK++T+I+       A+R++LNK +  S  Q++  + ++ +    DS  + +L+T+ GK V  ++D    DD+F+ 
Sbjct:   42 YRTRTLQALSSEKKAKKVRFYRNGDRYFKGIVYAISPDRFRSFEALLADLTRTLSDNVNLPQGVRTIYTVDGSKKITSLDQLVEGESYVCGSIEPFKKLDYTKNVNPNWSVNVKTTAAPRSAQPLAAPKQSFSEGRENKDFIRPKLVTIIRSGVKPRKAVRILLNKKTAHSFEQVLTDITDAIK---LDSGVVKRLYTLDGKQVLCLQDFFGDDDIFIA 257          
BLAST of Serine/threonine-protein kinase vs. Ensembl Xenopus
Match: arhgap24 (Rho GTPase activating protein 24 [Source:Xenbase;Acc:XB-GENE-996257])

HSP 1 Score: 116.316 bits (290), Expect = 1.662e-26
Identity = 67/219 (30.59%), Postives = 122/219 (55.71%), Query Frame = 2
Query:  284 HRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKG-KQIYSTDELEDCEAYVIAGPEPFKALVYSQKPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDNDLQRNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVG 937
            +R  T   L+  ++ K + FY NGD ++KGI  +I+P+R+ +F+ LL DL + +  N++LP G+R I+T  G K+I S D+L + E+YV    EPFK L Y++  + N      +      +Q +       S+    ++  +PK++T+I+       A+R++LNK +  S  Q++  + ++ +    DS  + +L+T+ GK V  ++D    DD+F+ 
Sbjct:   36 YRTRTLQALSSEKKAKKVRFYRNGDRYFKGIVYAISPDRFRSFEALLADLTRTLSDNVNLPQGVRTIYTVDGSKKITSLDQLVEGESYVCGSIEPFKKLDYTKNVNPNWSVNVKTTAAPRSAQPLAAPKQSFSEGRENKDFIRPKLVTIIRSGVKPRKAVRILLNKKTAHSFEQVLTDITDAIK---LDSGVVKRLYTLDGKQVLCLQDFFGDDDIFIA 251          
BLAST of Serine/threonine-protein kinase vs. Ensembl Mouse
Match: Dclk1 (doublecortin-like kinase 1 [Source:MGI Symbol;Acc:MGI:1330861])

HSP 1 Score: 118.627 bits (296), Expect = 1.337e-28
Identity = 78/281 (27.76%), Postives = 144/281 (51.25%), Query Frame = 2
Query:  284 HRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKG-KQIYSTDELEDCEAYVIAGPEPFKALVYSQKPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDNDLQRNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVGIDKDGVTWKE---INNIICDLFKD-DYEKINIYLQRWEINQEIRSSNLSTKSEHPKKAIQVN 1111
            +R  T   L+  ++ K + FY NGD ++KGI  +I+P+R+ +F+ LL DL + +  N++LP G+R I+T  G K+I S D+L + E+YV    EPFK L Y++  + N      +   +     +       S+    ++  +PK++T+I+       A+R++LNK +  S  Q++  + ++ +    DS  + +L+T+ GK V  ++D    DD+F+    +   +++   ++   C + K   Y KI    +R       +S   S +S+ P     VN
Sbjct:   42 YRTRTLQTLSSEKKAKKVRFYRNGDRYFKGIVYAISPDRFRSFEALLADLTRTLSDNVNLPQGVRTIYTIDGLKKISSLDQLVEGESYVCGSIEPFKKLEYTKNVNPNWSVNVKTTSASRAVSSLATAKGGPSEVRENKDFIRPKLVTIIRSGVKPRKAVRILLNKKTAHSFEQVLTDITDAIK---LDSGVVKRLYTLDGKQVMCLQDFFGDDDIFIACGPEKFRYQDDFLLDESECRVVKSTSYTKIASASRRG----TTKSPGPSRRSKSPASTSSVN 315          
BLAST of Serine/threonine-protein kinase vs. Ensembl Mouse
Match: Dclk1 (doublecortin-like kinase 1 [Source:MGI Symbol;Acc:MGI:1330861])

HSP 1 Score: 117.857 bits (294), Expect = 4.281e-27
Identity = 78/281 (27.76%), Postives = 144/281 (51.25%), Query Frame = 2
Query:  284 HRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKG-KQIYSTDELEDCEAYVIAGPEPFKALVYSQKPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDNDLQRNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVGIDKDGVTWKE---INNIICDLFKD-DYEKINIYLQRWEINQEIRSSNLSTKSEHPKKAIQVN 1111
            +R  T   L+  ++ K + FY NGD ++KGI  +I+P+R+ +F+ LL DL + +  N++LP G+R I+T  G K+I S D+L + E+YV    EPFK L Y++  + N      +   +     +       S+    ++  +PK++T+I+       A+R++LNK +  S  Q++  + ++ +    DS  + +L+T+ GK V  ++D    DD+F+    +   +++   ++   C + K   Y KI    +R       +S   S +S+ P     VN
Sbjct:   42 YRTRTLQTLSSEKKAKKVRFYRNGDRYFKGIVYAISPDRFRSFEALLADLTRTLSDNVNLPQGVRTIYTIDGLKKISSLDQLVEGESYVCGSIEPFKKLEYTKNVNPNWSVNVKTTSASRAVSSLATAKGGPSEVRENKDFIRPKLVTIIRSGVKPRKAVRILLNKKTAHSFEQVLTDITDAIK---LDSGVVKRLYTLDGKQVMCLQDFFGDDDIFIACGPEKFRYQDDFLLDESECRVVKSTSYTKIASASRR----GTTKSPGPSRRSKSPASTSSVN 315          
BLAST of Serine/threonine-protein kinase vs. Ensembl Mouse
Match: Dclk1 (doublecortin-like kinase 1 [Source:MGI Symbol;Acc:MGI:1330861])

HSP 1 Score: 117.857 bits (294), Expect = 4.479e-27
Identity = 78/281 (27.76%), Postives = 144/281 (51.25%), Query Frame = 2
Query:  284 HRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKG-KQIYSTDELEDCEAYVIAGPEPFKALVYSQKPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDNDLQRNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVGIDKDGVTWKE---INNIICDLFKD-DYEKINIYLQRWEINQEIRSSNLSTKSEHPKKAIQVN 1111
            +R  T   L+  ++ K + FY NGD ++KGI  +I+P+R+ +F+ LL DL + +  N++LP G+R I+T  G K+I S D+L + E+YV    EPFK L Y++  + N      +   +     +       S+    ++  +PK++T+I+       A+R++LNK +  S  Q++  + ++ +    DS  + +L+T+ GK V  ++D    DD+F+    +   +++   ++   C + K   Y KI    +R       +S   S +S+ P     VN
Sbjct:   42 YRTRTLQTLSSEKKAKKVRFYRNGDRYFKGIVYAISPDRFRSFEALLADLTRTLSDNVNLPQGVRTIYTIDGLKKISSLDQLVEGESYVCGSIEPFKKLEYTKNVNPNWSVNVKTTSASRAVSSLATAKGGPSEVRENKDFIRPKLVTIIRSGVKPRKAVRILLNKKTAHSFEQVLTDITDAIK---LDSGVVKRLYTLDGKQVMCLQDFFGDDDIFIACGPEKFRYQDDFLLDESECRVVKSTSYTKIASASRR----GTTKSPGPSRRSKSPASTSSVN 315          
BLAST of Serine/threonine-protein kinase vs. Ensembl Mouse
Match: Dcx (doublecortin [Source:MGI Symbol;Acc:MGI:1277171])

HSP 1 Score: 105.916 bits (263), Expect = 3.215e-24
Identity = 64/220 (29.09%), Postives = 119/220 (54.09%), Query Frame = 2
Query:  284 HRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKG-KQIYSTDELEDCEAYVIAGPEPFKALVYSQKPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDNDLQRNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVGI 940
            +R  T   L++ ++ K + FY NGD ++KGI  +++ +R+ +F  LL DL + +  NI+LP G+R I+T  G ++I S DELE+ E+YV +    FK + Y++  + N      +       Q +    +  +  +  ++  +PK++T+I+       A+RV+LNK +  S  Q++  +  + + +   +  + KL+T+ GK V  + D    DDVF+  
Sbjct:   38 YRTRTLQALSNEKKAKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFKKVEYTKNVNPNWSVNVKTSANMKAPQSLASSNSAQAREN--KDFVRPKLVTIIRSGVKPRKAVRVLLNKKTAHSFEQVLTDITEAIKLE---TGVVKKLYTLDGKQVTCLHDFFGDDDVFIAC 252          
BLAST of Serine/threonine-protein kinase vs. Ensembl Mouse
Match: Dcx (doublecortin [Source:MGI Symbol;Acc:MGI:1277171])

HSP 1 Score: 105.916 bits (263), Expect = 3.240e-24
Identity = 64/220 (29.09%), Postives = 119/220 (54.09%), Query Frame = 2
Query:  284 HRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKG-KQIYSTDELEDCEAYVIAGPEPFKALVYSQKPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDNDLQRNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVGI 940
            +R  T   L++ ++ K + FY NGD ++KGI  +++ +R+ +F  LL DL + +  NI+LP G+R I+T  G ++I S DELE+ E+YV +    FK + Y++  + N      +       Q +    +  +  +  ++  +PK++T+I+       A+RV+LNK +  S  Q++  +  + + +   +  + KL+T+ GK V  + D    DDVF+  
Sbjct:   38 YRTRTLQALSNEKKAKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFKKVEYTKNVNPNWSVNVKTSANMKAPQSLASSNSAQAREN--KDFVRPKLVTIIRSGVKPRKAVRVLLNKKTAHSFEQVLTDITEAIKLE---TGVVKKLYTLDGKQVTCLHDFFGDDDVFIAC 252          
BLAST of Serine/threonine-protein kinase vs. UniProt/SwissProt
Match: sp|Q9JLM8|DCLK1_MOUSE (Serine/threonine-protein kinase DCLK1 OS=Mus musculus OX=10090 GN=Dclk1 PE=1 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 2.995e-26
Identity = 78/281 (27.76%), Postives = 144/281 (51.25%), Query Frame = 2
Query:  284 HRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKG-KQIYSTDELEDCEAYVIAGPEPFKALVYSQKPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDNDLQRNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVGIDKDGVTWKE---INNIICDLFKD-DYEKINIYLQRWEINQEIRSSNLSTKSEHPKKAIQVN 1111
            +R  T   L+  ++ K + FY NGD ++KGI  +I+P+R+ +F+ LL DL + +  N++LP G+R I+T  G K+I S D+L + E+YV    EPFK L Y++  + N      +   +     +       S+    ++  +PK++T+I+       A+R++LNK +  S  Q++  + ++ +    DS  + +L+T+ GK V  ++D    DD+F+    +   +++   ++   C + K   Y KI    +R       +S   S +S+ P     VN
Sbjct:   42 YRTRTLQTLSSEKKAKKVRFYRNGDRYFKGIVYAISPDRFRSFEALLADLTRTLSDNVNLPQGVRTIYTIDGLKKISSLDQLVEGESYVCGSIEPFKKLEYTKNVNPNWSVNVKTTSASRAVSSLATAKGGPSEVRENKDFIRPKLVTIIRSGVKPRKAVRILLNKKTAHSFEQVLTDITDAIK---LDSGVVKRLYTLDGKQVMCLQDFFGDDDIFIACGPEKFRYQDDFLLDESECRVVKSTSYTKIASASRR----GTTKSPGPSRRSKSPASTSSVN 315          
BLAST of Serine/threonine-protein kinase vs. UniProt/SwissProt
Match: sp|O15075|DCLK1_HUMAN (Serine/threonine-protein kinase DCLK1 OS=Homo sapiens OX=9606 GN=DCLK1 PE=1 SV=2)

HSP 1 Score: 116.701 bits (291), Expect = 7.690e-26
Identity = 66/219 (30.14%), Postives = 121/219 (55.25%), Query Frame = 2
Query:  284 HRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKG-KQIYSTDELEDCEAYVIAGPEPFKALVYSQKPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDNDLQRNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVG 937
            +R  T   L+  ++ K + FY NGD ++KGI  +I+P+R+ +F+ LL DL + +  N++LP G+R I+T  G K+I S D+L + E+YV    EPFK L Y++  + N      +   +     +       S+    ++  +PK++T+I+       A+R++LNK +  S  Q++  + ++ +    DS  + +L+T+ GK V  ++D    DD+F+ 
Sbjct:   42 YRTRTLQTLSSEKKAKKVRFYRNGDRYFKGIVYAISPDRFRSFEALLADLTRTLSDNVNLPQGVRTIYTIDGLKKISSLDQLVEGESYVCGSIEPFKKLEYTKNVNPNWSVNVKTTSASRAVSSLATAKGSPSEVRENKDFIRPKLVTIIRSGVKPRKAVRILLNKKTAHSFEQVLTDITDAIK---LDSGVVKRLYTLDGKQVMCLQDFFGDDDIFIA 257          
BLAST of Serine/threonine-protein kinase vs. UniProt/SwissProt
Match: sp|O43602|DCX_HUMAN (Neuronal migration protein doublecortin OS=Homo sapiens OX=9606 GN=DCX PE=1 SV=4)

HSP 1 Score: 105.916 bits (263), Expect = 2.204e-23
Identity = 64/220 (29.09%), Postives = 119/220 (54.09%), Query Frame = 2
Query:  284 HRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKG-KQIYSTDELEDCEAYVIAGPEPFKALVYSQKPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDNDLQRNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVGI 940
            +R  T   L++ ++ K + FY NGD ++KGI  +++ +R+ +F  LL DL + +  NI+LP G+R I+T  G ++I S DELE+ E+YV +    FK + Y++  + N      +       Q +    +  +  +  ++  +PK++T+I+       A+RV+LNK +  S  Q++  +  + + +   +  + KL+T+ GK V  + D    DDVF+  
Sbjct:   38 YRTRTLQALSNEKKAKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFKKVEYTKNVNPNWSVNVKTSANMKAPQSLASSNSAQAREN--KDFVRPKLVTIIRSGVKPRKAVRVLLNKKTAHSFEQVLTDITEAIKLE---TGVVKKLYTLDGKQVTCLHDFFGDDDVFIAC 252          
BLAST of Serine/threonine-protein kinase vs. UniProt/SwissProt
Match: sp|O88809|DCX_MOUSE (Neuronal migration protein doublecortin OS=Mus musculus OX=10090 GN=Dcx PE=1 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 2.645e-23
Identity = 64/220 (29.09%), Postives = 119/220 (54.09%), Query Frame = 2
Query:  284 HRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKG-KQIYSTDELEDCEAYVIAGPEPFKALVYSQKPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDNDLQRNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVGI 940
            +R  T   L++ ++ K + FY NGD ++KGI  +++ +R+ +F  LL DL + +  NI+LP G+R I+T  G ++I S DELE+ E+YV +    FK + Y++  + N      +       Q +    +  +  +  ++  +PK++T+I+       A+RV+LNK +  S  Q++  +  + + +   +  + KL+T+ GK V  + D    DDVF+  
Sbjct:   38 YRTRTLQALSNEKKAKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFKKVEYTKNVNPNWSVNVKTSANMKAPQSLASSNSAQAREN--KDFVRPKLVTIIRSGVKPRKAVRVLLNKKTAHSFEQVLTDITEAIKLE---TGVVKKLYTLDGKQVTCLHDFFGDDDVFIAC 252          
BLAST of Serine/threonine-protein kinase vs. UniProt/SwissProt
Match: sp|D2I3C6|DCLK2_AILME (Serine/threonine-protein kinase DCLK2 OS=Ailuropoda melanoleuca OX=9646 GN=DCLK2 PE=3 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 3.025e-22
Identity = 69/250 (27.60%), Postives = 129/250 (51.60%), Query Frame = 2
Query:  284 HRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKG-KQIYSTDELEDCEAYVIAGPEPFKALVYSQ--KPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDNDLQRNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVGIDKDGVTWKEINNII----CDLFKDDYEK 1012
            +R  T   L+  ++ K   FY NGD ++KG+  +I+ +R+ +F  LL +L + +  N++LP G+R I+T  G +++ S DEL + E+YV A  EPF+ + Y++   P+ +   K  +         V       S+    ++  KPK++TVI+       A+R++LNK +  S  Q++  +  + +    DS  + +L T+ GK V  ++D    DDVF+    +   + + + ++    C + K  Y +
Sbjct:   57 YRTRTLQALSSEKKAKKARFYRNGDRYFKGLVFAISSDRFRSFDALLMELTRSLSDNVNLPQGVRTIYTIDGSRKVTSLDELLEGESYVCASNEPFRKVDYTKNINPNWSVNIKGGTARALAAPSSV------KSEVKESKDFIKPKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITEAIK---LDSGVVKRLCTLDGKQVTCLQDFFGDDDVFIACGPEKFRYAQDDFVLDHSECRVLKSSYSR 297          
BLAST of Serine/threonine-protein kinase vs. TrEMBL
Match: V3ZYP2 (Uncharacterized protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_64764 PE=4 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 7.437e-35
Identity = 79/209 (37.80%), Postives = 125/209 (59.81%), Query Frame = 2
Query:  320 RRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKGKQIYSTDELEDCEAYVIAGPEPFKALVYSQKPHXXXXXXXXXXXXXXXXQHVGH--HYAHHSDNDLQRNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVGI 940
            RRP+ ++FYVNGD ++KG  + +TPNRY NF DLLN+L  K+  N++LP G+R+++ + G++I   D+L+D + YV AG E FK++ Y             S     +S   G   H    SDN     + KPKVITV++        ++++LN+ S+ S  QL+  ++ +F ++ + S  + KL+TI GK V+S+ D  R DDVF+G+
Sbjct:    1 RRPRRVNFYVNGDRYFKGKKMFVTPNRYYNFNDLLNELTGKLPSNLNLPYGVRQLYEKHGQRITDVDDLQDGDWYVAAGFEGFKSIKYGSTDMEVWSMTHGSYSNKRWSGPSGTSPHKFSTSDN---YGSNKPKVITVVRNGVAPRSNVKILLNRRSVQSFEQLMCDISEAFTAKGR-SHKVNKLYTIKGKAVQSVSDFFRNDDVFIGV 205          
BLAST of Serine/threonine-protein kinase vs. TrEMBL
Match: A0A3Q0FN01 (serine/threonine-protein kinase DCLK1 isoform X2 OS=Alligator sinensis OX=38654 GN=LOC102379795 PE=4 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 2.228e-26
Identity = 79/281 (28.11%), Postives = 144/281 (51.25%), Query Frame = 2
Query:  284 HRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKG-KQIYSTDELEDCEAYVIAGPEPFKALVYSQKPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDNDLQRNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVGIDKDGVTWKE---INNIICDLFKD-DYEKINIYLQRWEINQEIRSSNLSTKSEHPKKAIQVN 1111
            +R  T   L+  ++ K + FY NGD ++KGI  +I+P+R+ +F+ LL DL + +  N++LP G+R I+T  G K+I S D+L + E+YV    EPFK L Y++  + N      +   +     +       SD    ++  +PK++T+I+       A+R++LNK +  S  Q++  + ++ +    DS  + +L+T+ GK V  ++D    DD+F+    +   +++   ++   C + K   Y KI    +R       +S   S +S+ P     VN
Sbjct:   51 YRTRTLQTLSSEKKAKKVRFYRNGDRYFKGIVYAISPDRFRSFEALLADLTRTLSDNVNLPQGVRTIYTIDGSKKISSLDQLVEGESYVCGSIEPFKKLEYTKNVNPNWSVNVKTTSASRTVPSLATAKGSTSDTKENKDFIRPKLVTIIRSGVKPRKAVRILLNKKTAHSFEQVLTDITDAIK---LDSGVVKRLYTLDGKQVMCLQDFFGDDDIFIACGPEKFRYQDDFLLDESECRVVKSTSYTKIASTSRR----STTKSPGPSRRSKSPASTSSVN 324          
BLAST of Serine/threonine-protein kinase vs. TrEMBL
Match: G1KZ24 (Uncharacterized protein OS=Anolis carolinensis OX=28377 PE=4 SV=2)

HSP 1 Score: 121.709 bits (304), Expect = 2.848e-26
Identity = 78/281 (27.76%), Postives = 144/281 (51.25%), Query Frame = 2
Query:  284 HRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKG-KQIYSTDELEDCEAYVIAGPEPFKALVYSQKPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDNDLQRNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVGIDKDGVTWKE---INNIICDLFKD-DYEKINIYLQRWEINQEIRSSNLSTKSEHPKKAIQVN 1111
            +R  T   L+  ++ K + FY NGD ++KGI  +I+P+R+ +F+ LL DL + +  N++LP G+R I+T  G K+I + D+L + E+YV    EPFK L Y++  + N      +         +G       D+   ++  +PK++T+I+       A+R++LNK +  S  Q++  + ++ +    DS  + +L+T+ GK V  ++D    DD+F+    +   +++   ++   C + K   Y KI    +R       +S   S +S+ P     VN
Sbjct:   42 YRTRTLQTLSSEKKAKKVRFYRNGDRYFKGIVYAISPDRFRSFEALLADLTRTLSDNVNLPQGVRTIYTIDGVKKITTLDQLVEGESYVCGSIEPFKKLEYTKNVNPNWSVNVKTTSAARAVASLGAAKGSPLDSKENKDFIRPKLVTIIRSGVKPRKAVRILLNKKTAHSFEQVLTDITDAIK---LDSGVVKRLYTLDGKQVMCLQDFFGEDDIFIACGPEKFRYQDDFLLDESECRVVKSTSYTKIASTPRR----SATKSPGPSRRSKSPASTSSVN 315          
BLAST of Serine/threonine-protein kinase vs. TrEMBL
Match: A0A4X2LVW7 (Uncharacterized protein OS=Vombatus ursinus OX=29139 GN=DCLK1 PE=4 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 1.320e-25
Identity = 78/281 (27.76%), Postives = 144/281 (51.25%), Query Frame = 2
Query:  284 HRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKG-KQIYSTDELEDCEAYVIAGPEPFKALVYSQKPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDNDLQRNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVGIDKDGVTWKE---INNIICDLFKD-DYEKINIYLQRWEINQEIRSSNLSTKSEHPKKAIQVN 1111
            +R  T   L+  ++ K + FY NGD ++KGI  +I+P+R+ +F+ LL DL + +  N++LP G+R I+T  G K+I + D+L + E+YV    EPFK L Y++  + N      +   +     +       SD    ++  +PK++T+I+       A+R++LNK +  S  Q++  + ++ +    DS  + +L+T+ GK V  ++D    DD+F+    +   +++   ++   C + K   Y KI    +R       +S   S +S+ P     VN
Sbjct:   42 YRTRTLQTLSSEKKAKKVRFYRNGDRYFKGIVYAISPDRFRSFEALLADLTRTLSDNVNLPQGVRTIYTIDGLKKISTLDQLVEGESYVCGSIEPFKKLEYTKNVNPNWSVNVKTTSASRTVSSLATAKGSPSDVRENKDFIRPKLVTIIRSGVKPRKAVRILLNKKTAHSFEQVLTDITDAIK---LDSGVVKRLYTLDGKQVMCLQDFFGDDDIFIACGPEKFRYQDDFLLDESECRVVKSTSYTKIASTSRR----STTKSPGPSRRSKSPASTSSVN 315          
BLAST of Serine/threonine-protein kinase vs. TrEMBL
Match: A0A5F8HL85 (Doublecortin like kinase 1 OS=Monodelphis domestica OX=13616 GN=DCLK1 PE=4 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 1.320e-25
Identity = 78/281 (27.76%), Postives = 144/281 (51.25%), Query Frame = 2
Query:  284 HRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKG-KQIYSTDELEDCEAYVIAGPEPFKALVYSQKPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDNDLQRNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVGIDKDGVTWKE---INNIICDLFKD-DYEKINIYLQRWEINQEIRSSNLSTKSEHPKKAIQVN 1111
            +R  T   L+  ++ K + FY NGD ++KGI  +I+P+R+ +F+ LL DL + +  N++LP G+R I+T  G K+I + D+L + E+YV    EPFK L Y++  + N      +   +     +       SD    ++  +PK++T+I+       A+R++LNK +  S  Q++  + ++ +    DS  + +L+T+ GK V  ++D    DD+F+    +   +++   ++   C + K   Y KI    +R       +S   S +S+ P     VN
Sbjct:   42 YRTRTLQTLSSEKKAKKVRFYRNGDRYFKGIVYAISPDRFRSFEALLADLTRTLSDNVNLPQGVRTIYTIDGLKKISTLDQLVEGESYVCGSIEPFKKLEYTKNVNPNWSVNVKTTSASRTVSSLATAKGSPSDVRENKDFIRPKLVTIIRSGVKPRKAVRILLNKKTAHSFEQVLTDITDAIK---LDSGVVKRLYTLDGKQVMCLQDFFGDDDIFIACGPEKFRYQDDFLLDESECRVVKSTSYTKIASTSRR----STTKSPGPSRRSKSPASTSSVN 315          
BLAST of Serine/threonine-protein kinase vs. Ensembl Cavefish
Match: ENSAMXT00000018326.2 (doublecortin [Source:NCBI gene;Acc:103035707])

HSP 1 Score: 101.679 bits (252), Expect = 5.753e-23
Identity = 71/223 (31.84%), Postives = 119/223 (53.36%), Query Frame = 2
Query:  284 HRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKGK-QIYSTDELEDCEAYVIAGPEPFKALVYSQ--KPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDNDLQRNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIK-LFTIGGKYVKSIEDILRPDDVFVGI 940
            +R  T   L   ++ K + FY NGD ++KGI  ++  +R+  F  LL DL + +  +I+LP G+R IFT  G  +I S DELE+ E+YV A    +K + Y++   P+ +   K  +  RN      G   A   +N   ++  +PK++TV++       A+RV+LNK +  S  Q++  +  +    IK  S ++K ++T+ GK V  ++D    DDVF+  
Sbjct:   38 YRTRTLQALTSEKKAKKVRFYRNGDRYFKGIVYAVANDRFRTFDALLADLTRSLSDHINLPQGVRFIFTIDGAHKITSLDELEEGESYVCASENYYKKVDYTKNVNPNWSVNVKACAGQRNAMCVSGGRPGAEPREN---KDFVRPKLVTVMRSGVKPRKAVRVLLNKKTAHSFEQVLTDITEA----IKLESGVVKRIYTLDGKQVTCLQDFFGDDDVFIAC 253          
BLAST of Serine/threonine-protein kinase vs. Ensembl Cavefish
Match: dclk1b (doublecortin-like kinase 1b [Source:ZFIN;Acc:ZDB-GENE-080516-7])

HSP 1 Score: 104.375 bits (259), Expect = 6.478e-23
Identity = 59/220 (26.82%), Postives = 119/220 (54.09%), Query Frame = 2
Query:  284 HRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKG-KQIYSTDELEDCEAYVIAGPEPFKALVYSQKPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDNDLQRNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVGI 940
            +R  T   L+  ++ K + FY NGD ++KGI  +I+  R+ +F  LL DL + +  N++LP G+R +++  G  +I S ++LE+ E+YV    EP+K L Y++  ++N      +   +     +    A   D    ++  +PK++T+I+       A+R++LNK +  +  Q++  + ++ +    D+  + +L+T+ GK +  ++D    DD+F+  
Sbjct:   36 YRTRTLQALSTEKKAKKVRFYRNGDRYFKGIVYAISQERFRSFDALLADLTRSLSDNVNLPQGVRTLYSIDGVSRITSMEQLEEGESYVCGSIEPYKKLDYTK--NVNPNWSVKTTASSRAPSSLASTKACSLDAKESKDFIRPKLVTIIRSGVKPRKAVRILLNKKTAHTFEQVLSDITDAIK---LDTGAVKRLYTVDGKLISCLQDFFGEDDIFIAC 250          
BLAST of Serine/threonine-protein kinase vs. Ensembl Cavefish
Match: dclk2a (doublecortin like kinase 2 [Source:NCBI gene;Acc:103023338])

HSP 1 Score: 101.293 bits (251), Expect = 5.917e-22
Identity = 63/248 (25.40%), Postives = 128/248 (51.61%), Query Frame = 2
Query:  284 HRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKG-KQIYSTDELEDCEAYVIAGPEPFKALVYSQ--KPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDNDLQRNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVGIDKDGVTWKEINNII----CDLFKDDY 1006
            +R  T   L   ++ + + FY NGD ++KG+  +++ +R+ +   LL +L + +  N++LP G+R I+T  G +++ S D+L + E+YV A  EPF+ + Y++   P+ +   K  +         + +      + D      KPK++TVI+       A+R++LNK +  S  Q++  + ++ +    DS  + +L+T+ GK +  ++D    DDVF+    +   + + + ++    C + K  Y
Sbjct:   50 YRTRTLQSLTTEKKARKVRFYRNGDRYFKGLVYAVSGDRFRSLDALLMELTRSLSDNVNLPQGVRFIYTVDGARRVTSLDDLLEGESYVCASNEPFRKMEYTKNVNPNWSVNVKTGTSRSLSSLPTLKNELRERENKDF----IKPKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITDAIK---LDSGVVKRLYTLEGKQITCLQDFFGEDDVFIACGPEKFRYAQDDFVLDHSECRVLKSSY 290          
BLAST of Serine/threonine-protein kinase vs. Ensembl Cavefish
Match: dclk2a (doublecortin like kinase 2 [Source:NCBI gene;Acc:103023338])

HSP 1 Score: 99.7525 bits (247), Expect = 2.313e-21
Identity = 60/225 (26.67%), Postives = 119/225 (52.89%), Query Frame = 2
Query:  284 HRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKG-KQIYSTDELEDCEAYVIAGPEPFKALVYSQ--KPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDNDLQRNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVGIDKD 949
            +R  T   L   ++ + + FY NGD ++KG+  +++ +R+ +   LL +L + +  N++LP G+R I+T  G +++ S D+L + E+YV A  EPF+ + Y++   P+ +   K  +         + +      + D      KPK++TVI+       A+R++LNK +  S  Q++  + ++ +    DS  + +L+T+ GK +  ++D    DDVF+    +
Sbjct:   49 YRTRTLQSLTTEKKARKVRFYRNGDRYFKGLVYAVSGDRFRSLDALLMELTRSLSDNVNLPQGVRFIYTVDGARRVTSLDDLLEGESYVCASNEPFRKMEYTKNVNPNWSVNVKTGTSRSLSSLPTLKNELRERENKDF----IKPKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITDAIK---LDSGVVKRLYTLEGKQITCLQDFFGEDDVFIACGPE 266          
BLAST of Serine/threonine-protein kinase vs. Ensembl Cavefish
Match: dclk2a (doublecortin like kinase 2 [Source:NCBI gene;Acc:103023338])

HSP 1 Score: 99.7525 bits (247), Expect = 2.425e-21
Identity = 60/222 (27.03%), Postives = 118/222 (53.15%), Query Frame = 2
Query:  284 HRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKG-KQIYSTDELEDCEAYVIAGPEPFKALVYSQ--KPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDNDLQRNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVGI 940
            +R  T   L   ++ + + FY NGD ++KG+  +++ +R+ +   LL +L + +  N++LP G+R I+T  G +++ S D+L + E+YV A  EPF+ + Y++   P+ +   K  +         + +      + D      KPK++TVI+       A+R++LNK +  S  Q++  + ++ +    DS  + +L+T+ GK +  ++D    DDVF+  
Sbjct:   49 YRTRTLQSLTTEKKARKVRFYRNGDRYFKGLVYAVSGDRFRSLDALLMELTRSLSDNVNLPQGVRFIYTVDGARRVTSLDDLLEGESYVCASNEPFRKMEYTKNVNPNWSVNVKTGTSRSLSSLPTLKNELRERENKDF----IKPKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITDAIK---LDSGVVKRLYTLEGKQITCLQDFFGEDDVFIAC 263          
BLAST of Serine/threonine-protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007114.1 (pep scaffold:Pmarinus_7.0:GL477366:299514:356138:-1 gene:ENSPMAG00000006368.1 transcript:ENSPMAT00000007114.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.39 bits (285), Expect = 9.858e-27
Identity = 74/276 (26.81%), Postives = 143/276 (51.81%), Query Frame = 2
Query:  284 HRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKG-KQIYSTDELEDCEAYVIAGPEPFKALVYSQK--PHXXXXXXXXXXXXXXXXQHVGHHYAHHSDNDLQRNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVGIDKDGVTWKEINNIICDLFKDDYEKINIYLQRWEINQEIRSSNLSTKSEHPKKAI 1102
            +R  T   L+  +R K + FY NGD +++GI  +++P+R+ +F  LL DL + +  N++LP G+R I+T  G +++ + DEL + E+YV A  EP++ L Y++   P+ +   K         +       A  S     R+  +PK++TVI+       A+R++LNK +  S  Q++  + ++ +    D+  + +L+T+ GK V  ++D    DDVF+    +   +   + +I     DD E+  +  +  +++    ++N  +    P KA+
Sbjct:   46 YRTRTLRALSTEKRAKKVRFYRNGDRYFRGIVYAVSPDRFRSFDALLEDLTRTLTDNVNLPQGVRAIYTCDGSRRMLTLDELVEGESYVCASNEPYRRLDYTKTLNPNWSVNIKSSGGKAQSAAGSSRQAVAGVSTGSESRDFIRPKLVTVIRSGVKPRKAVRILLNKKTAHSFDQVLTDITDAIK---LDTGVVKRLYTLDGKQVTCLQDFFGDDDVFIACGPEKFRYASDDFLI-----DDGEQCKVMEKYAKLHA---TANARSPVRSPGKAL 310          
BLAST of Serine/threonine-protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007117.1 (pep scaffold:Pmarinus_7.0:GL477366:363732:368225:-1 gene:ENSPMAG00000006438.1 transcript:ENSPMAT00000007117.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 102.834 bits (255), Expect = 5.646e-25
Identity = 62/204 (30.39%), Postives = 114/204 (55.88%), Query Frame = 2
Query:  284 HRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKG-KQIYSTDELEDCEAYVIAGPEPFKALVYSQKPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDNDLQRNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYV 892
            +R  T   L+  +R K + FY NGD +++GI  +++P+R+ +F  LL DL + +  N++LP G+R I+T  G +++ + DEL + E+YV A  EP++ L Y++  + N      S      S      Y   S++   R+  +PK++TVI+       A+R++LNK +  S  Q++  + ++ +    D+  + +L+T+ GK V
Sbjct:   42 YRTRTLRALSTEKRAKKVRFYRNGDRYFRGIVYAVSPDRFRSFDALLEDLTRTLTDNVNLPQGVRAIYTCDGSRRMLTLDELVEGESYVCASNEPYRRLDYTKTLNPNWSVNIKSSGGKAQSAAGSSRYTAGSES---RDFIRPKLVTVIRSGVKPRKAVRILLNKKTAHSFDQVLTDITDAIK---LDTGVVKRLYTLDGKQV 239          
BLAST of Serine/threonine-protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010548.1 (pep scaffold:Pmarinus_7.0:GL477749:266235:284843:-1 gene:ENSPMAG00000009555.1 transcript:ENSPMAT00000010548.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.8929 bits (224), Expect = 2.086e-19
Identity = 61/214 (28.50%), Postives = 108/214 (50.47%), Query Frame = 2
Query:  320 RRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKGKQ--IYSTDELEDCEAYVIAGPEPFKAL--VYSQKPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDNDLQRNTYKPKVIT-VIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVGIDK 946
            RRPK++ FY NGD +++   L ITP+RY+++ +LL DL + V     LP G+R+++T  G      S D L D EAYV A  EPF+++      K      +           + V  ++    +N +     +PKVIT V    +     + ++LN+ +  S  +L+  ++ +       ++ + +L+T+ G+  +S+ D  R DDVF+   +
Sbjct:    1 RRPKVVRFYRNGDRYFRARTLHITPHRYVSWPELLADLSRAV----PLPYGVRRLYTPLGGSPVAGSVDALRDGEAYVCASFEPFRSVKDFSRNKQPQLSYNATCGASTICLDKGVRQNFLRRPENYV---PARPKVITVVRVGGRGPRRRITLLLNRRAAQSFEELLGDISEALGLPRWRTNHVRRLYTLRGREARSVSDFFRGDDVFLAATR 207          
BLAST of Serine/threonine-protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002186.1 (pep scaffold:Pmarinus_7.0:GL485622:7659:8531:-1 gene:ENSPMAG00000001989.1 transcript:ENSPMAT00000002186.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.4546 bits (132), Expect = 3.695e-9
Identity = 23/75 (30.67%), Postives = 45/75 (60.00%), Query Frame = 2
Query:  329 KLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKGKQIYSTDELEDCEAYVIA 553
            K ++FY +GD  +  + L ++   +  F+ LL++L ++V     LPMG+R++ T +G+ +   +EL D  AY+ +
Sbjct:    4 KRVYFYKSGDPQFGALPLVVSERSFRTFESLLDELSRRVP----LPMGVRRVTTPRGRHVVQLNELHDGSAYMCS 74          
BLAST of Serine/threonine-protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009748.1 (pep scaffold:Pmarinus_7.0:GL478245:10970:15566:-1 gene:ENSPMAG00000008812.1 transcript:ENSPMAT00000009748.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.6766 bits (117), Expect = 1.213e-6
Identity = 51/218 (23.39%), Postives = 99/218 (45.41%), Query Frame = 2
Query:  308 LADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKG-KQIYSTDELEDCEAYVIAGPEPFKALVYSQKPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDND-LQRNTYKPKVITVIKKSKNSHIALRVILNKCSLIS--IGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVGIDKD 949
            LA+    K ++FY +GD  + G+ ++I    +  F  LL++L ++    + LP G+R + T +G   +   ++LED +AYV +     K L   Q     +  +  S  R              ++   L R T  P+ +T+++    +     ++L++ S  S   G L ++      SQI   S + +L+T  G+ V+S++ +L      V   ++
Sbjct:   35 LAEPITAKRVYFYKSGDPQFGGLKVAINNRTFKTFDALLDNLSRR----MPLPFGVRTVSTPRGLHAVRDLEQLEDGKAYVCSDRRRAKPLDLEQASRRPQPWRSSSSRRQALRLLRRQEMGGGAEEPRLARAT--PRRLTLVRNGDATGPRYALLLSRRSASSGLAGLLADA------SQIMGFS-VARLYTTDGRKVESLQALLHVPSTLVAAGRE 239          
BLAST of Serine/threonine-protein kinase vs. Ensembl Nematostella
Match: EDO44490 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVP9])

HSP 1 Score: 58.9214 bits (141), Expect = 4.838e-10
Identity = 50/198 (25.25%), Postives = 94/198 (47.47%), Query Frame = 2
Query:  326 PKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMG-IRKIF-TRKGKQIYSTDELEDCEAYVIAGPEPFKALVYSQKPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDNDLQRNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDIL 913
             K I FY NGD F+ G+ L+++  RY  F  LL +L  K    I L  G +R IF +  G ++    EL+   +YV +    F+ +   +  + N + +          +    ++  +   D Q++  + K++TV+K  K     + ++LNK +  S+ Q+++ L++           + KL+T+  K V+ +  IL
Sbjct:    1 AKQIMFYRNGDRFFSGLKLAVSSERYKEFDSLLTELSAK----IDLQTGAVRYIFNSETGNEVQDVTELQYGVSYVCSSSNHFQRI---EGGYRNNQPQWALTSAKGNPKSELQNWQQNEQVDQQKDFIRAKLVTVVKHGKKPQKKVTMLLNKKTASSLNQVLDHLSSKV-----TVGKVDKLYTVDMKPVRFVSLIL 186          
BLAST of Serine/threonine-protein kinase vs. Ensembl Medaka
Match: ENSORLT00000033772.1 (doublecortin [Source:NCBI gene;Acc:101157476])

HSP 1 Score: 104.375 bits (259), Expect = 5.561e-24
Identity = 64/220 (29.09%), Postives = 117/220 (53.18%), Query Frame = 2
Query:  284 HRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKG-KQIYSTDELEDCEAYVIAGPEPFKALVYSQKPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDNDLQRNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVGI 940
            +R  T   L + ++ K + FY NGD ++KGI  ++  +R+ +F  LL DL + +  +I+LP G+R IFT  G ++I + DELE+ E+YV A    +K + Y++  + N      +       Q +    A  S+    +   +PK++TV++       A+RV+LNK +  S  Q++  +  + + +   S  + +++T+ GK V  ++D    DDVF+  
Sbjct:   38 YRTRTLQALTNEKKAKKVRFYRNGDRYFKGIVYAVASDRFRSFDSLLADLTRSLSDHINLPQGVRFIFTIDGSRKISTLDELEEGESYVCASENFYKKVDYTKNVNPNWSVNVKASASQKNMQSLAAKAA--SEPRENKEFVRPKLVTVMRSGVKPRKAVRVLLNKKTAHSFEQVLTDITEAIKLE---SGAVKRIYTLDGKQVTCLQDFFGDDDVFIAC 252          
BLAST of Serine/threonine-protein kinase vs. Ensembl Medaka
Match: dclk1b (serine/threonine-protein kinase DCLK1 [Source:NCBI gene;Acc:101155370])

HSP 1 Score: 106.686 bits (265), Expect = 1.290e-23
Identity = 65/233 (27.90%), Postives = 121/233 (51.93%), Query Frame = 2
Query:  284 HRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKG-KQIYSTDELEDCEAYVIAGPEPFKALVYSQKPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDNDLQRNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVGIDKDGVTWKEINNI 979
            +R  T   L   ++ K I FY NGD ++KGI  +I+  R+ +   LL DL + +  N++LP G+R I+T  G  +I S D+L + E+YV A  EPFK L Y++  + N      +         +  + A   +    ++  +PK++T+++       A+R++LNK +  S  Q++  + ++ +    DS  + +L+T+ GK V  ++D    DD+F     +   +++  N+
Sbjct:   37 YRTRTLQTLISEKKAKKIRFYRNGDRYFKGIVYAISSERFGSLDALLADLTRCLSDNVNLPQGVRTIYTIDGVTKIASMDQLVEGESYVCASIEPFKKLDYTKNVNPNWSLGAKTAASVRDPPFLCSNKAGSPETRESKDFIRPKLVTIVRSGVKPRKAVRILLNKKTAHSFEQVMTDITDAIK---LDSGVVKRLYTVDGKMVTCLQDFFGEDDIFFACGPEKFRYQDDFNL 266          
BLAST of Serine/threonine-protein kinase vs. Ensembl Medaka
Match: dclk1b (serine/threonine-protein kinase DCLK1 [Source:NCBI gene;Acc:101155370])

HSP 1 Score: 106.301 bits (264), Expect = 1.533e-23
Identity = 65/233 (27.90%), Postives = 121/233 (51.93%), Query Frame = 2
Query:  284 HRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKG-KQIYSTDELEDCEAYVIAGPEPFKALVYSQKPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDNDLQRNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVGIDKDGVTWKEINNI 979
            +R  T   L   ++ K I FY NGD ++KGI  +I+  R+ +   LL DL + +  N++LP G+R I+T  G  +I S D+L + E+YV A  EPFK L Y++  + N      +         +  + A   +    ++  +PK++T+++       A+R++LNK +  S  Q++  + ++ +    DS  + +L+T+ GK V  ++D    DD+F     +   +++  N+
Sbjct:   37 YRTRTLQTLISEKKAKKIRFYRNGDRYFKGIVYAISSERFGSLDALLADLTRCLSDNVNLPQGVRTIYTIDGVTKIASMDQLVEGESYVCASIEPFKKLDYTKNVNPNWSLGAKTAASVRDPPFLCSNKAGSPETRESKDFIRPKLVTIVRSGVKPRKAVRILLNKKTAHSFEQVMTDITDAIK---LDSGVVKRLYTVDGKMVTCLQDFFGEDDIFFACGPEKFRYQDDFNL 266          
BLAST of Serine/threonine-protein kinase vs. Ensembl Medaka
Match: dclk1b (serine/threonine-protein kinase DCLK1 [Source:NCBI gene;Acc:101155370])

HSP 1 Score: 105.916 bits (263), Expect = 2.020e-23
Identity = 65/233 (27.90%), Postives = 121/233 (51.93%), Query Frame = 2
Query:  284 HRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKG-KQIYSTDELEDCEAYVIAGPEPFKALVYSQKPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDNDLQRNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVGIDKDGVTWKEINNI 979
            +R  T   L   ++ K I FY NGD ++KGI  +I+  R+ +   LL DL + +  N++LP G+R I+T  G  +I S D+L + E+YV A  EPFK L Y++  + N      +         +  + A   +    ++  +PK++T+++       A+R++LNK +  S  Q++  + ++ +    DS  + +L+T+ GK V  ++D    DD+F     +   +++  N+
Sbjct:   42 YRTRTLQTLISEKKAKKIRFYRNGDRYFKGIVYAISSERFGSLDALLADLTRCLSDNVNLPQGVRTIYTIDGVTKIASMDQLVEGESYVCASIEPFKKLDYTKNVNPNWSLGAKTAASVRDPPFLCSNKAGSPETRESKDFIRPKLVTIVRSGVKPRKAVRILLNKKTAHSFEQVMTDITDAIK---LDSGVVKRLYTVDGKMVTCLQDFFGEDDIFFACGPEKFRYQDDFNL 271          
BLAST of Serine/threonine-protein kinase vs. Ensembl Medaka
Match: ENSORLT00000003850.2 (serine/threonine-protein kinase DCLK2 [Source:NCBI gene;Acc:101173659])

HSP 1 Score: 102.449 bits (254), Expect = 3.109e-22
Identity = 76/263 (28.90%), Postives = 129/263 (49.05%), Query Frame = 2
Query:  242 PNDESDSSYGISLSHRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKG-KQIYSTDELEDCEAYVIAGPEPFKALVY------SQKPHXXXXXXXXXXXXXX------XXQHVGHHYAHHSDNDLQRNT---YKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVGIDKDGVTWKEINNII 982
            P   ++ SY     +R  T   L   RR K + FY NGD ++KG+  +++ +R+ ++  LL +L + +  N+ LP G+R I+T  G K+I S DEL + E YV A  +PF+ + Y      S KP  +  S   S  R         +          SD+   R +    KPK++TVI+       A+RV+LNK +  S  Q++  +  + +    DS  + +L+T+ GK +  ++D    DDVF+    +   + + + I+
Sbjct:   51 PAHSANCSY-----YRTRTLQALTSERRAKKVRFYRNGDRYFKGLVYAVSSDRFRSYDALLMELTRSLADNLHLPQGVRSIYTIDGSKKITSMDELVEGECYVCASNQPFRKVDYTKISVPSWKPGASAGSGSSSSSRTTTASTGVSTSTASTASKERSDSRESRESKDFIKPKLVTVIRSGVKPRKAVRVLLNKKTAHSFDQVLADITEAIK---LDSGAVKRLYTLDGKQLTCLQDFFGDDDVFMACGPEKFRYAQDDFIL 305          
BLAST of Serine/threonine-protein kinase vs. Planmine SMEST
Match: SMESG000040958.1 (SMESG000040958.1)

HSP 1 Score: 1069.3 bits (2764), Expect = 0.000e+0
Identity = 552/553 (99.82%), Postives = 553/553 (100.00%), Query Frame = 2
Query:  206 MEFYNNHYVEVDPNDESDSSYGISLSHRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKGKQIYSTDELEDCEAYVIAGPEPFKALVYSQKPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDNDLQRNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVGIDKDGVTWKEINNIICDLFKDDYEKINIYLQRWEINQEIRSSNLSTKSEHPKKAIQVNIDNKSEVKHEDSTNIKQSSKKSIKFERSQSMDEIVPEEIPXXXXXXXXXXXXXXQMTEDLVIPIGKGPLPTSHLQNIIRNELQSRRHLECTRKALIDREKARQNQKRMMYFERPNSDIEIFSDDEIRRIRTPMSEHLGPRYSSQHYRDNFMDIEKYKCMPFMQPTRNYQLIQPIMSREILHSTSHKIFLPDESKLLKNRPRQNSLSVYLTKYRTLNMDKREVENNLNEMKGKTDRSGKIPELDSLRQFQEM 1864
            MEFYNNHYVEVDPNDESDSSYGISLSHRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKGKQIYSTDELEDCEAYVIAGPEPFKALVYSQKPHLNRKSKKLSKLRNYYSQHVGHHYAHHSDNDLQRNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVGIDKDGVTWKEINNIICDLFKDDYEKINIYLQRWEINQEIRSSNLSTKSEHPKKAIQVNIDNKSEVKHEDSTNIKQSSKKSIKFERSQSMDEIVPEEIPVKKLSKVLSKEKNNQMTEDLVIPIGKGPLPTSHLQNIIRNELQSRRHLECTRKALIDREKARQNQKRMMYFERPNSDIEIFSDDEIRRIRTPMSEHLGPRYSSQHYRDNFMDIEKYKCMPFMQPTRNYQLIQPIMSREILHSTSHKIFLPDESKLLKNRPRQNSLSVYLTKYRTLNMDKREVENNLNEMKGKTDRSGKIPELDSLRQFQE+
Sbjct:    1 MEFYNNHYVEVDPNDESDSSYGISLSHRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKGKQIYSTDELEDCEAYVIAGPEPFKALVYSQKPHLNRKSKKLSKLRNYYSQHVGHHYAHHSDNDLQRNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVGIDKDGVTWKEINNIICDLFKDDYEKINIYLQRWEINQEIRSSNLSTKSEHPKKAIQVNIDNKSEVKHEDSTNIKQSSKKSIKFERSQSMDEIVPEEIPVKKLSKVLSKEKNNQMTEDLVIPIGKGPLPTSHLQNIIRNELQSRRHLECTRKALIDREKARQNQKRMMYFERPNSDIEIFSDDEIRRIRTPMSEHLGPRYSSQHYRDNFMDIEKYKCMPFMQPTRNYQLIQPIMSREILHSTSHKIFLPDESKLLKNRPRQNSLSVYLTKYRTLNMDKREVENNLNEMKGKTDRSGKIPELDSLRQFQEI 553          
BLAST of Serine/threonine-protein kinase vs. Planmine SMEST
Match: SMESG000040958.1 (SMESG000040958.1)

HSP 1 Score: 618.231 bits (1593), Expect = 0.000e+0
Identity = 319/319 (100.00%), Postives = 319/319 (100.00%), Query Frame = 2
Query:  206 MEFYNNHYVEVDPNDESDSSYGISLSHRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKGKQIYSTDELEDCEAYVIAGPEPFKALVYSQKPHXXXXXXXXXXXXXXXXQHVGHHYAHHSDNDLQRNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVGIDKDGVTWKEINNIICDLFKDDYEKINIYLQRWEINQEIRSSNLSTKSEHPKKAIQVNIDNKSEVKHEDSTNIKQ 1162
            MEFYNNHYVEVDPNDESDSSYGISLSHRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKGKQIYSTDELEDCEAYVIAGPEPFKALVYSQKPHLNRKSKKLSKLRNYYSQHVGHHYAHHSDNDLQRNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVGIDKDGVTWKEINNIICDLFKDDYEKINIYLQRWEINQEIRSSNLSTKSEHPKKAIQVNIDNKSEVKHEDSTNIKQ
Sbjct:    1 MEFYNNHYVEVDPNDESDSSYGISLSHRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKGKQIYSTDELEDCEAYVIAGPEPFKALVYSQKPHLNRKSKKLSKLRNYYSQHVGHHYAHHSDNDLQRNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVGIDKDGVTWKEINNIICDLFKDDYEKINIYLQRWEINQEIRSSNLSTKSEHPKKAIQVNIDNKSEVKHEDSTNIKQ 319          
BLAST of Serine/threonine-protein kinase vs. Planmine SMEST
Match: SMESG000040958.1 (SMESG000040958.1)

HSP 1 Score: 428.328 bits (1100), Expect = 3.431e-143
Identity = 220/221 (99.55%), Postives = 221/221 (100.00%), Query Frame = 2
Query: 1202 MDEIVPEEIPXXXXXXXXXXXXXXQMTEDLVIPIGKGPLPTSHLQNIIRNELQSRRHLECTRKALIDREKARQNQKRMMYFERPNSDIEIFSDDEIRRIRTPMSEHLGPRYSSQHYRDNFMDIEKYKCMPFMQPTRNYQLIQPIMSREILHSTSHKIFLPDESKLLKNRPRQNSLSVYLTKYRTLNMDKREVENNLNEMKGKTDRSGKIPELDSLRQFQEM 1864
            MDEIVPEEIPVKKLSKVLSKEKNNQMTEDLVIPIGKGPLPTSHLQNIIRNELQSRRHLECTRKALIDREKARQNQKRMMYFERPNSDIEIFSDDEIRRIRTPMSEHLGPRYSSQHYRDNFMDIEKYKCMPFMQPTRNYQLIQPIMSREILHSTSHKIFLPDESKLLKNRPRQNSLSVYLTKYRTLNMDKREVENNLNEMKGKTDRSGKIPELDSLRQFQE+
Sbjct:    1 MDEIVPEEIPVKKLSKVLSKEKNNQMTEDLVIPIGKGPLPTSHLQNIIRNELQSRRHLECTRKALIDREKARQNQKRMMYFERPNSDIEIFSDDEIRRIRTPMSEHLGPRYSSQHYRDNFMDIEKYKCMPFMQPTRNYQLIQPIMSREILHSTSHKIFLPDESKLLKNRPRQNSLSVYLTKYRTLNMDKREVENNLNEMKGKTDRSGKIPELDSLRQFQEI 221          
BLAST of Serine/threonine-protein kinase vs. Planmine SMEST
Match: SMESG000080647.1 (SMESG000080647.1)

HSP 1 Score: 78.9518 bits (193), Expect = 5.901e-16
Identity = 39/86 (45.35%), Postives = 57/86 (66.28%), Query Frame = 2
Query:  326 PKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKGKQIYSTDELEDCEAYVIAGPEPF--KAL 577
            PK I  YVN +  +KGI++S+T NRY NF++ L DL+ K+K ++ L  G RK++ + GK IYS  ++ D E Y++ G EP   KAL
Sbjct:   16 PKNIRIYVNNNENFKGINVSVTKNRYKNFENFLQDLDYKLKQHVFLATGARKLYNKYGKTIYSLLDIVDSENYIVGGLEPLNKKAL 101          
BLAST of Serine/threonine-protein kinase vs. Planmine SMEST
Match: SMESG000072629.1 (SMESG000072629.1)

HSP 1 Score: 81.2629 bits (199), Expect = 1.244e-15
Identity = 46/109 (42.20%), Postives = 60/109 (55.05%), Query Frame = 2
Query:  266 YGISLSHRLLTDDRLADMRRPKLIHFYVNGDIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKGKQIYSTDELEDCEAYVIAGPEPFKALVYSQK 592
            Y  S S R +TDD   ++R+PK + F VNG+  + G  LSITPNRY    DLL+DL K     I  P G+R+I+ R G Q+   D+LE    Y+  G E  K   Y  K
Sbjct:    7 YNPSQSFRDITDDYYQELRKPKRVLFIVNGNRTFSGKLLSITPNRYFILNDLLDDLTKYFSNFI--PTGVRRIYDRNGWQVQDIDDLEHRNIYICCGQESLKTYDYDTK 113          

HSP 2 Score: 55.4546 bits (132), Expect = 1.153e-7
Identity = 34/105 (32.38%), Postives = 60/105 (57.14%), Query Frame = 2
Query:  707 KPKVITVIKKSKNSHIALRVILNKCSLISIGQLIESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVGI-DKD-GVTWKEINNIICDLFKDDYEKI 1015
            KP+++T+I+     +   +++LNK S  S   L+  ++++F S  K  S I +++ I GK ++   D  R    FV I DKD  +  +E+ NI+ +LF  +YEK+
Sbjct:  201 KPRILTIIRTGIKPYSFFKILLNKTSSQSYEDLLSDISDAFGSNWKGKS-IQRIYNIDGKEIQQTSDFFRSGKYFVAIGDKDPNLNQEEVRNIVAELFP-NYEKM 303          
The following BLAST results are available for this feature:
BLAST of Serine/threonine-protein kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DCLK15.802e-2830.00doublecortin like kinase 1 [Source:HGNC Symbol;Acc... [more]
DCLK11.601e-2630.14doublecortin like kinase 1 [Source:HGNC Symbol;Acc... [more]
DCLK12.270e-2630.14doublecortin like kinase 1 [Source:HGNC Symbol;Acc... [more]
DCX4.553e-2429.09doublecortin [Source:HGNC Symbol;Acc:HGNC:2714][more]
DCX4.553e-2429.09doublecortin [Source:HGNC Symbol;Acc:HGNC:2714][more]
back to top
BLAST of Serine/threonine-protein kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
zyg-83.550e-1831.82Serine/threonine-protein kinase zyg-8 [Source:Uni... [more]
zyg-83.559e-1831.82Serine/threonine-protein kinase zyg-8 [Source:Uni... [more]
back to top
BLAST of Serine/threonine-protein kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG175282.860e-1524.22gene:FBgn0261387 transcript:FBtr0111274[more]
CG175282.860e-1524.22gene:FBgn0261387 transcript:FBtr0111277[more]
DCX-EMAP7.536e-1035.56gene:FBgn0259099 transcript:FBtr0331181[more]
DCX-EMAP8.331e-1035.56gene:FBgn0259099 transcript:FBtr0299509[more]
back to top
BLAST of Serine/threonine-protein kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dclk1b3.772e-2427.06doublecortin-like kinase 1b [Source:ZFIN;Acc:ZDB-G... [more]
dclk2a1.797e-2326.80doublecortin-like kinase 2a [Source:ZFIN;Acc:ZDB-G... [more]
dclk2a3.130e-2326.80doublecortin-like kinase 2a [Source:ZFIN;Acc:ZDB-G... [more]
dclk2a6.791e-2328.57doublecortin-like kinase 2a [Source:ZFIN;Acc:ZDB-G... [more]
dclk2a6.791e-2328.57doublecortin-like kinase 2a [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Serine/threonine-protein kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arhgap245.619e-2730.45Rho GTPase activating protein 24 [Source:Xenbase;A... [more]
arhgap246.908e-2730.45Rho GTPase activating protein 24 [Source:Xenbase;A... [more]
arhgap247.630e-2730.59Rho GTPase activating protein 24 [Source:Xenbase;A... [more]
arhgap241.046e-2630.59Rho GTPase activating protein 24 [Source:Xenbase;A... [more]
arhgap241.662e-2630.59Rho GTPase activating protein 24 [Source:Xenbase;A... [more]
back to top
BLAST of Serine/threonine-protein kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dclk11.337e-2827.76doublecortin-like kinase 1 [Source:MGI Symbol;Acc:... [more]
Dclk14.281e-2727.76doublecortin-like kinase 1 [Source:MGI Symbol;Acc:... [more]
Dclk14.479e-2727.76doublecortin-like kinase 1 [Source:MGI Symbol;Acc:... [more]
Dcx3.215e-2429.09doublecortin [Source:MGI Symbol;Acc:MGI:1277171][more]
Dcx3.240e-2429.09doublecortin [Source:MGI Symbol;Acc:MGI:1277171][more]
back to top
BLAST of Serine/threonine-protein kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9JLM8|DCLK1_MOUSE2.995e-2627.76Serine/threonine-protein kinase DCLK1 OS=Mus muscu... [more]
sp|O15075|DCLK1_HUMAN7.690e-2630.14Serine/threonine-protein kinase DCLK1 OS=Homo sapi... [more]
sp|O43602|DCX_HUMAN2.204e-2329.09Neuronal migration protein doublecortin OS=Homo sa... [more]
sp|O88809|DCX_MOUSE2.645e-2329.09Neuronal migration protein doublecortin OS=Mus mus... [more]
sp|D2I3C6|DCLK2_AILME3.025e-2227.60Serine/threonine-protein kinase DCLK2 OS=Ailuropod... [more]
back to top
BLAST of Serine/threonine-protein kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V3ZYP27.437e-3537.80Uncharacterized protein (Fragment) OS=Lottia gigan... [more]
A0A3Q0FN012.228e-2628.11serine/threonine-protein kinase DCLK1 isoform X2 O... [more]
G1KZ242.848e-2627.76Uncharacterized protein OS=Anolis carolinensis OX=... [more]
A0A4X2LVW71.320e-2527.76Uncharacterized protein OS=Vombatus ursinus OX=291... [more]
A0A5F8HL851.320e-2527.76Doublecortin like kinase 1 OS=Monodelphis domestic... [more]
back to top
BLAST of Serine/threonine-protein kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000018326.25.753e-2331.84doublecortin [Source:NCBI gene;Acc:103035707][more]
dclk1b6.478e-2326.82doublecortin-like kinase 1b [Source:ZFIN;Acc:ZDB-G... [more]
dclk2a5.917e-2225.40doublecortin like kinase 2 [Source:NCBI gene;Acc:1... [more]
dclk2a2.313e-2126.67doublecortin like kinase 2 [Source:NCBI gene;Acc:1... [more]
dclk2a2.425e-2127.03doublecortin like kinase 2 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Serine/threonine-protein kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007114.19.858e-2726.81pep scaffold:Pmarinus_7.0:GL477366:299514:356138:-... [more]
ENSPMAT00000007117.15.646e-2530.39pep scaffold:Pmarinus_7.0:GL477366:363732:368225:-... [more]
ENSPMAT00000010548.12.086e-1928.50pep scaffold:Pmarinus_7.0:GL477749:266235:284843:-... [more]
ENSPMAT00000002186.13.695e-930.67pep scaffold:Pmarinus_7.0:GL485622:7659:8531:-1 ge... [more]
ENSPMAT00000009748.11.213e-623.39pep scaffold:Pmarinus_7.0:GL478245:10970:15566:-1 ... [more]
back to top
BLAST of Serine/threonine-protein kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/threonine-protein kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO444904.838e-1025.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Serine/threonine-protein kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000033772.15.561e-2429.09doublecortin [Source:NCBI gene;Acc:101157476][more]
dclk1b1.290e-2327.90serine/threonine-protein kinase DCLK1 [Source:NCBI... [more]
dclk1b1.533e-2327.90serine/threonine-protein kinase DCLK1 [Source:NCBI... [more]
dclk1b2.020e-2327.90serine/threonine-protein kinase DCLK1 [Source:NCBI... [more]
ENSORLT00000003850.23.109e-2228.90serine/threonine-protein kinase DCLK2 [Source:NCBI... [more]
back to top
BLAST of Serine/threonine-protein kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000040958.10.000e+099.82SMESG000040958.1[more]
SMESG000040958.10.000e+0100.00SMESG000040958.1[more]
SMESG000040958.13.431e-14399.55SMESG000040958.1[more]
SMESG000080647.15.901e-1645.35SMESG000080647.1[more]
SMESG000072629.11.244e-1542.20SMESG000072629.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016474 ID=SMED30016474|Name=Serine/threonine-protein kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=1902bp
GTTAAAATTAAATCTACTTTTAAAAGATTTTAATTAATTAAAAAGGAGGA
ACCAAATAACTACTATGTCATATTTACAATGTTAATTTACGGTAATTGTT
TGCAAGAAATATTTGAATTTTAGCTGCCTTAACTACTGAGTGCAAAGTGA
CATTTAGAATTTTGATGAGTGATTTTATAAATGTGCTAAATATCTTTTGA
TTCGAATGGAGTTTTATAACAATCATTACGTTGAAGTCGATCCCAATGAT
GAATCTGACAGTTCATATGGGATTTCACTCTCCCATCGGCTACTTACTGA
TGACAGACTAGCGGACATGCGTCGGCCTAAACTGATCCACTTTTACGTCA
ATGGAGACATATTTTATAAAGGAATAGATTTGAGTATAACACCGAATCGT
TATATGAATTTCCAAGACCTTCTAAATGATTTGGAGAAAAAGGTCAAACC
AAATATTTCGTTGCCGATGGGAATTCGAAAAATATTCACTCGAAAAGGCA
AACAGATCTATTCGACTGATGAACTTGAGGACTGCGAAGCTTATGTTATA
GCTGGCCCTGAGCCGTTTAAAGCTCTTGTATATAGTCAGAAACCTCATTT
GAATAGAAAGTCAAAAAAATTATCAAAATTAAGAAACTATTATAGTCAGC
ATGTTGGACATCACTATGCTCACCACAGTGACAACGACCTGCAACGAAAT
ACTTATAAACCAAAGGTTATTACTGTGATTAAAAAGTCGAAAAACTCTCA
CATCGCTCTCCGGGTAATTCTGAACAAGTGTTCTTTAATTTCAATCGGTC
AATTAATTGAGAGCTTAAATAATAGTTTTGAAAGTCAAATAAAGGATTCT
TCACCTATCATAAAGCTTTTTACTATTGGAGGCAAATATGTAAAATCAAT
TGAGGACATCCTAAGACCGGATGATGTGTTTGTCGGAATTGATAAAGATG
GAGTGACATGGAAAGAAATTAACAACATCATTTGTGACTTGTTTAAAGAT
GATTATGAAAAGATAAATATTTATTTGCAACGATGGGAAATAAATCAAGA
AATTCGATCATCAAACCTTAGCACCAAAAGTGAGCATCCGAAAAAAGCAA
TTCAAGTCAATATTGATAACAAAAGTGAAGTAAAACATGAAGATTCAACA
AACATAAAACAATCATCAAAAAAGTCTATCAAATTTGAGAGATCGCAGTC
AATGGATGAAATTGTCCCAGAGGAAATTCCAGTGAAAAAATTGTCAAAGG
TTTTGTCTAAAGAAAAGAATAATCAAATGACTGAAGATTTGGTTATACCA
ATAGGAAAAGGACCCCTGCCAACAAGTCATTTACAAAATATAATTAGAAA
TGAATTGCAATCTAGAAGACATTTAGAATGCACAAGAAAGGCATTGATAG
ATCGAGAGAAAGCTAGACAAAATCAAAAGAGAATGATGTATTTTGAGCGA
CCTAATTCAGATATTGAAATATTTTCTGACGATGAAATAAGAAGAATAAG
AACTCCAATGAGTGAACATTTAGGACCTAGGTACAGTTCTCAACATTACA
GAGATAATTTTATGGATATTGAAAAATATAAATGTATGCCCTTCATGCAA
CCGACTAGAAACTACCAACTTATCCAACCTATAATGAGTAGAGAAATTTT
ACACTCAACCTCGCACAAAATTTTCCTTCCCGATGAATCAAAATTACTGA
AAAACCGTCCACGACAAAATAGTTTGTCCGTTTATTTAACGAAATATCGG
ACACTCAATATGGACAAAAGAGAAGTGGAAAATAATTTAAATGAAATGAA
AGGAAAAACTGACAGATCTGGGAAAATCCCAGAATTAGATTCGTTGAGAC
AATTTCAAGAAATGTGAGTGCCATTTCCAAATTTAAAGCTCTTAGACTCG
AG
back to top

protein sequence of SMED30016474-orf-1

>SMED30016474-orf-1 ID=SMED30016474-orf-1|Name=SMED30016474-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=554bp
MEFYNNHYVEVDPNDESDSSYGISLSHRLLTDDRLADMRRPKLIHFYVNG
DIFYKGIDLSITPNRYMNFQDLLNDLEKKVKPNISLPMGIRKIFTRKGKQ
IYSTDELEDCEAYVIAGPEPFKALVYSQKPHLNRKSKKLSKLRNYYSQHV
GHHYAHHSDNDLQRNTYKPKVITVIKKSKNSHIALRVILNKCSLISIGQL
IESLNNSFESQIKDSSPIIKLFTIGGKYVKSIEDILRPDDVFVGIDKDGV
TWKEINNIICDLFKDDYEKINIYLQRWEINQEIRSSNLSTKSEHPKKAIQ
VNIDNKSEVKHEDSTNIKQSSKKSIKFERSQSMDEIVPEEIPVKKLSKVL
SKEKNNQMTEDLVIPIGKGPLPTSHLQNIIRNELQSRRHLECTRKALIDR
EKARQNQKRMMYFERPNSDIEIFSDDEIRRIRTPMSEHLGPRYSSQHYRD
NFMDIEKYKCMPFMQPTRNYQLIQPIMSREILHSTSHKIFLPDESKLLKN
RPRQNSLSVYLTKYRTLNMDKREVENNLNEMKGKTDRSGKIPELDSLRQF
QEM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000418head
PLANA:0000420parapharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR036572Doublecortin_dom_sf
IPR003533Doublecortin_dom
Vocabulary: biological process
TermDefinition
GO:0035556intracellular signal transduction
GO:0001764neuron migration
GO:0006468protein phosphorylation
GO:0007275multicellular organism development
GO:0007399nervous system development
GO:0007409axonogenesis
GO:0007417central nervous system development
GO:0007420brain development
GO:0009615response to virus
GO:0016197endosomal transport
GO:0016310phosphorylation
GO:0018105peptidyl-serine phosphorylation
GO:0018107peptidyl-threonine phosphorylation
GO:0021952central nervous system projection neuron axonogenesis
GO:0030154cell differentiation
GO:0030900forebrain development
GO:0048675axon extension
GO:0048812neuron projection morphogenesis
GO:0048813dendrite morphogenesis
GO:1900181negative regulation of protein localization to nucleus
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0004672protein kinase activity
GO:0004674protein serine/threonine kinase activity
GO:0005057signal transducer activity, downstream of receptor
GO:0005524ATP binding
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005887integral component of plasma membrane
GO:0014069postsynaptic density
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 514..534
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 308..331
NoneNo IPR availablePANTHERPTHR23004DOUBLECORTIN DOMAIN CONTAINING 2coord: 40..346
NoneNo IPR availableCDDcd17140DCX1_DCLK1coord: 40..127
e-value: 1.53482E-20
score: 84.2834
NoneNo IPR availableCDDcd16111DCX_DCLK3coord: 168..251
e-value: 3.46403E-12
score: 60.1414
IPR003533Doublecortin domainSMARTSM00537doub1_11coord: 37..127
e-value: 1.1E-18
score: 78.0
IPR003533Doublecortin domainPFAMPF03607DCXcoord: 61..121
e-value: 1.1E-11
score: 44.6
IPR003533Doublecortin domainPROSITEPS50309DCcoord: 170..256
score: 10.096
IPR003533Doublecortin domainPROSITEPS50309DCcoord: 42..127
score: 22.449
IPR036572Doublecortin domain superfamilyGENE3DG3DSA:3.10.20.230coord: 34..143
e-value: 3.7E-27
score: 96.2
IPR036572Doublecortin domain superfamilyGENE3DG3DSA:3.10.20.230coord: 161..250
e-value: 1.0E-10
score: 43.1
IPR036572Doublecortin domain superfamilySUPERFAMILYSSF89837Doublecortin (DC)coord: 165..249
IPR036572Doublecortin domain superfamilySUPERFAMILYSSF89837Doublecortin (DC)coord: 36..132