39S ribosomal protein L21 mitochondrial

Overview
Name39S ribosomal protein L21 mitochondrial
Smed IDSMED30016471
Length (bp)490
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 39S ribosomal protein L21 mitochondrial (SMED30016471) t-SNE clustered cells

Violin plots show distribution of expression levels for 39S ribosomal protein L21 mitochondrial (SMED30016471) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 39S ribosomal protein L21 mitochondrial (SMED30016471) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 39S ribosomal protein L21 mitochondrial (SMED30016471) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016471

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30016471h1SMcG0005712 Contig684GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
posterior sideSMED30016471h1SMcG0005712 dd_Smed_v4_2553_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30016471h1SMcG0005712 dd_Smed_v4_2553_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 39S ribosomal protein L21 mitochondrial vs. Ensembl Human
Match: MRPL21 (mitochondrial ribosomal protein L21 [Source:HGNC Symbol;Acc:HGNC:14479])

HSP 1 Score: 89.7373 bits (221), Expect = 3.634e-23
Identity = 50/109 (45.87%), Postives = 70/109 (64.22%), Query Frame = 2
Query:  113 SRKFAIVHMFGRQFKVTNEDLVSITTMECDLDIGEEIVLEKVLMVGSENFSMFGRPILPKTDVRITATVVEKSSKFPLINYLFVAKRQTSVMRTQQENRVVFRINNIEL 439
             R FA+VH   RQ+KVT+EDL+ I   E DL  GE I LEKVL+VG++NF++ G+P+L K  VR+ ATV+EK+  +P I   F  ++     R     + V RIN+IE+
Sbjct:    8 GRLFAVVHFASRQWKVTSEDLILIGN-ELDLACGERIRLEKVLLVGADNFTLLGKPLLGKDLVRVEATVIEKTESWPRIIMRFRKRKNFKKKRIVTTPQTVLRINSIEI 115          
BLAST of 39S ribosomal protein L21 mitochondrial vs. Ensembl Human
Match: MRPL21 (mitochondrial ribosomal protein L21 [Source:HGNC Symbol;Acc:HGNC:14479])

HSP 1 Score: 89.7373 bits (221), Expect = 2.700e-22
Identity = 50/109 (45.87%), Postives = 70/109 (64.22%), Query Frame = 2
Query:  113 SRKFAIVHMFGRQFKVTNEDLVSITTMECDLDIGEEIVLEKVLMVGSENFSMFGRPILPKTDVRITATVVEKSSKFPLINYLFVAKRQTSVMRTQQENRVVFRINNIEL 439
             R FA+VH   RQ+KVT+EDL+ I   E DL  GE I LEKVL+VG++NF++ G+P+L K  VR+ ATV+EK+  +P I   F  ++     R     + V RIN+IE+
Sbjct:   93 GRLFAVVHFASRQWKVTSEDLILIGN-ELDLACGERIRLEKVLLVGADNFTLLGKPLLGKDLVRVEATVIEKTESWPRIIMRFRKRKNFKKKRIVTTPQTVLRINSIEI 200          
BLAST of 39S ribosomal protein L21 mitochondrial vs. Ensembl Human
Match: MRPL21 (mitochondrial ribosomal protein L21 [Source:HGNC Symbol;Acc:HGNC:14479])

HSP 1 Score: 85.8853 bits (211), Expect = 7.692e-21
Identity = 42/79 (53.16%), Postives = 57/79 (72.15%), Query Frame = 2
Query:  113 SRKFAIVHMFGRQFKVTNEDLVSITTMECDLDIGEEIVLEKVLMVGSENFSMFGRPILPKTDVRITATVVEKSSKFPLI 349
             R FA+VH   RQ+KVT+EDL+ I   E DL  GE I LEKVL+VG++NF++ G+P+L K  VR+ ATV+EK+  +P I
Sbjct:    8 GRLFAVVHFASRQWKVTSEDLILIGN-ELDLACGERIRLEKVLLVGADNFTLLGKPLLGKDLVRVEATVIEKTESWPRI 85          
BLAST of 39S ribosomal protein L21 mitochondrial vs. Ensembl Human
Match: MRPL21 (mitochondrial ribosomal protein L21 [Source:HGNC Symbol;Acc:HGNC:14479])

HSP 1 Score: 68.5514 bits (166), Expect = 1.097e-14
Identity = 32/58 (55.17%), Postives = 43/58 (74.14%), Query Frame = 2
Query:  113 SRKFAIVHMFGRQFKVTNEDLVSITTMECDLDIGEEIVLEKVLMVGSENFSMFGRPIL 286
             R FA+VH   RQ+KVT+EDL+ I   E DL  GE I LEKVL+VG++NF++ G+P+L
Sbjct:   93 GRLFAVVHFASRQWKVTSEDLILIGN-ELDLACGERIRLEKVLLVGADNFTLLGKPLL 149          
BLAST of 39S ribosomal protein L21 mitochondrial vs. Ensembl Celegans
Match: mrpl-21 (Mitochondrial Ribosomal Protein, Large [Source:UniProtKB/TrEMBL;Acc:Q6A575])

HSP 1 Score: 93.5893 bits (231), Expect = 1.541e-24
Identity = 48/114 (42.11%), Postives = 75/114 (65.79%), Query Frame = 2
Query:  116 RKFAIVHMFGRQFKVTNEDLVSITTMECDL--DIGEEIVLEKVLMVGSENFSMFGRPILPKTDVRITATVVEKSSKFPLINYLFVAKRQTSVMRTQQENRVVFRINNIELKNVE 451
            R FA+V++ GRQ+KV++ DL++   ME +L  ++G+EI LEKVLMVG  NFS+FGRP+L  + V + A VVEK +  P ++Y+ +   QT  +  + +   V RI ++  K +E
Sbjct:   60 RLFAVVYVNGRQWKVSDGDLIN---MEGNLPLNVGDEIKLEKVLMVGGTNFSLFGRPLLDASAVTVDAVVVEKKTTNPELHYVHLNHHQTKFLNWKSDEATVLRIKSVTAKQIE 170          
BLAST of 39S ribosomal protein L21 mitochondrial vs. Ensembl Fly
Match: mRpL21 (gene:FBgn0036853 transcript:FBtr0333224)

HSP 1 Score: 78.5666 bits (192), Expect = 2.304e-18
Identity = 49/132 (37.12%), Postives = 73/132 (55.30%), Query Frame = 2
Query:   50 DCISLLEVLNLVKMDALNKNTSRKFAIVHMFGRQFKVTNEDLVSITTMECDLDIGEEIVLEKVLMVGSENFSMFGRPILPKTDVRITATVVEKSSKFPLINYLFVAKRQTSVMRT--QQENRVVFRINNIEL 439
            +C+S+ E +N            R FA+VH+ G+QFKVT  D++ +        IG+EI L+KVL+ G+ +F++ GRPIL    + + ATVVEK+         F  KR+   MR   Q+    + RIN+IEL
Sbjct:   58 ECLSICERIN---RQVQKSEQGRLFAVVHLCGKQFKVTPGDIILVEGY-WPPTIGDEISLDKVLLAGARDFTLVGRPILEPGLILVKATVVEKT--LSHTKTHFRKKRRKQYMRINFQRSPHTMVRINSIEL 183          
BLAST of 39S ribosomal protein L21 mitochondrial vs. Ensembl Fly
Match: mRpL21 (gene:FBgn0036853 transcript:FBtr0075022)

HSP 1 Score: 78.5666 bits (192), Expect = 2.304e-18
Identity = 49/132 (37.12%), Postives = 73/132 (55.30%), Query Frame = 2
Query:   50 DCISLLEVLNLVKMDALNKNTSRKFAIVHMFGRQFKVTNEDLVSITTMECDLDIGEEIVLEKVLMVGSENFSMFGRPILPKTDVRITATVVEKSSKFPLINYLFVAKRQTSVMRT--QQENRVVFRINNIEL 439
            +C+S+ E +N            R FA+VH+ G+QFKVT  D++ +        IG+EI L+KVL+ G+ +F++ GRPIL    + + ATVVEK+         F  KR+   MR   Q+    + RIN+IEL
Sbjct:   58 ECLSICERIN---RQVQKSEQGRLFAVVHLCGKQFKVTPGDIILVEGY-WPPTIGDEISLDKVLLAGARDFTLVGRPILEPGLILVKATVVEKT--LSHTKTHFRKKRRKQYMRINFQRSPHTMVRINSIEL 183          
BLAST of 39S ribosomal protein L21 mitochondrial vs. Ensembl Fly
Match: mRpL21 (gene:FBgn0036853 transcript:FBtr0346548)

HSP 1 Score: 78.5666 bits (192), Expect = 2.304e-18
Identity = 49/132 (37.12%), Postives = 73/132 (55.30%), Query Frame = 2
Query:   50 DCISLLEVLNLVKMDALNKNTSRKFAIVHMFGRQFKVTNEDLVSITTMECDLDIGEEIVLEKVLMVGSENFSMFGRPILPKTDVRITATVVEKSSKFPLINYLFVAKRQTSVMRT--QQENRVVFRINNIEL 439
            +C+S+ E +N            R FA+VH+ G+QFKVT  D++ +        IG+EI L+KVL+ G+ +F++ GRPIL    + + ATVVEK+         F  KR+   MR   Q+    + RIN+IEL
Sbjct:   58 ECLSICERIN---RQVQKSEQGRLFAVVHLCGKQFKVTPGDIILVEGY-WPPTIGDEISLDKVLLAGARDFTLVGRPILEPGLILVKATVVEKT--LSHTKTHFRKKRRKQYMRINFQRSPHTMVRINSIEL 183          
BLAST of 39S ribosomal protein L21 mitochondrial vs. Ensembl Zebrafish
Match: mrpl21 (mitochondrial ribosomal protein L21 [Source:ZFIN;Acc:ZDB-GENE-061027-183])

HSP 1 Score: 86.6557 bits (213), Expect = 3.331e-21
Identity = 45/120 (37.50%), Postives = 73/120 (60.83%), Query Frame = 2
Query:   86 KMDAL--NKNTSRKFAIVHMFGRQFKVTNEDLVSITTMECDLDIGEEIVLEKVLMVGSENFSMFGRPILPKTDVRITATVVEKSSKFPLINYLFVAKRQTSVMRTQQENRVVFRINNIEL 439
            K++AL       R FA+VH   RQ+KVTNEDL+ I     D + G+ I +EKVL+VG  +F++ G+P+L +  V++ ATV+EK+  +P+++  F  + +    R   + + V RIN I +
Sbjct:   85 KVNALIEEGQYGRLFAVVHFAARQWKVTNEDLILIEN-HLDAECGDRIRMEKVLLVGGSDFTLVGKPLLGRDLVQVQATVIEKTQSWPMVHMRFWKRHRFQKKRIIVQPQTVLRINTIHI 203          
BLAST of 39S ribosomal protein L21 mitochondrial vs. Ensembl Xenopus
Match: ouro1 (ouroboros 1 [Source:Xenbase;Acc:XB-GENE-6000695])

HSP 1 Score: 90.1225 bits (222), Expect = 1.794e-22
Identity = 47/111 (42.34%), Postives = 73/111 (65.77%), Query Frame = 2
Query:  116 RKFAIVHMFGRQFKVTNEDLVSITTMECDLDIGEEIVLEKVLMVGSENFSMFGRPILPKTDVRITATVVEKSSKFPLINYLFVAKRQTSVMRTQQENRVVFRINNIELKNV 448
            R FA+V +  RQ+KVTNEDL+ I + E   + G++I LEKVL+VGS+NF++ G+P+L K  V++ ATV+EK+  +P I+  F  + +    +     + V RIN+IE+  V
Sbjct:   90 RLFAVVFLASRQWKVTNEDLILINS-EMGAECGDKIHLEKVLLVGSDNFTLIGKPLLGKDLVKVEATVIEKTESYPKISMRFWRRHRHQRKKITIRPQTVLRINSIEIAPV 199          
BLAST of 39S ribosomal protein L21 mitochondrial vs. Ensembl Mouse
Match: Mrpl21 (mitochondrial ribosomal protein L21 [Source:MGI Symbol;Acc:MGI:2660674])

HSP 1 Score: 87.0409 bits (214), Expect = 2.136e-21
Identity = 47/109 (43.12%), Postives = 68/109 (62.39%), Query Frame = 2
Query:  113 SRKFAIVHMFGRQFKVTNEDLVSITTMECDLDIGEEIVLEKVLMVGSENFSMFGRPILPKTDVRITATVVEKSSKFPLINYLFVAKRQTSVMRTQQENRVVFRINNIEL 439
             R FA+VH    Q+KVT EDL+ I   E D+  GE I LEKVL+VG++NF++ G+P+L K  VR+ ATV+EK+  +P IN  F  ++     +     + + RIN IE+
Sbjct:   97 GRLFAVVHFASHQWKVTAEDLILIEN-ELDIKCGERIRLEKVLLVGADNFTLLGKPLLRKELVRVEATVIEKTESWPKINMKFRKRKNFRKKKIIVNPQTILRINTIEI 204          
BLAST of 39S ribosomal protein L21 mitochondrial vs. Ensembl Mouse
Match: Mrpl21 (mitochondrial ribosomal protein L21 [Source:MGI Symbol;Acc:MGI:2660674])

HSP 1 Score: 84.3445 bits (207), Expect = 2.839e-20
Identity = 41/79 (51.90%), Postives = 56/79 (70.89%), Query Frame = 2
Query:  116 RKFAIVHMFGRQFKVTNEDLVSITTMECDLDIGEEIVLEKVLMVGSENFSMFGRPILPKTDVRITATVVEKSSKFPLIN 352
            R FA+VH    Q+KVT EDL+ I   E D+  GE I LEKVL+VG++NF++ G+P+L K  VR+ ATV+EK+  +P IN
Sbjct:   98 RLFAVVHFASHQWKVTAEDLILIEN-ELDIKCGERIRLEKVLLVGADNFTLLGKPLLRKELVRVEATVIEKTESWPKIN 175          
BLAST of 39S ribosomal protein L21 mitochondrial vs. UniProt/SwissProt
Match: sp|Q7Z2W9|RM21_HUMAN (39S ribosomal protein L21, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL21 PE=1 SV=2)

HSP 1 Score: 89.7373 bits (221), Expect = 1.297e-21
Identity = 50/109 (45.87%), Postives = 70/109 (64.22%), Query Frame = 2
Query:  113 SRKFAIVHMFGRQFKVTNEDLVSITTMECDLDIGEEIVLEKVLMVGSENFSMFGRPILPKTDVRITATVVEKSSKFPLINYLFVAKRQTSVMRTQQENRVVFRINNIEL 439
             R FA+VH   RQ+KVT+EDL+ I   E DL  GE I LEKVL+VG++NF++ G+P+L K  VR+ ATV+EK+  +P I   F  ++     R     + V RIN+IE+
Sbjct:   93 GRLFAVVHFASRQWKVTSEDLILIGN-ELDLACGERIRLEKVLLVGADNFTLLGKPLLGKDLVRVEATVIEKTESWPRIIMRFRKRKNFKKKRIVTTPQTVLRINSIEI 200          
BLAST of 39S ribosomal protein L21 mitochondrial vs. UniProt/SwissProt
Match: sp|Q2TBS2|RM21_BOVIN (39S ribosomal protein L21, mitochondrial OS=Bos taurus OX=9913 GN=MRPL21 PE=1 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 1.383e-21
Identity = 46/109 (42.20%), Postives = 69/109 (63.30%), Query Frame = 2
Query:  113 SRKFAIVHMFGRQFKVTNEDLVSITTMECDLDIGEEIVLEKVLMVGSENFSMFGRPILPKTDVRITATVVEKSSKFPLINYLFVAKRQTSVMRTQQENRVVFRINNIEL 439
             R FA+VH    Q+KVT+EDL+ I   + D+  GE I +EKVL+VG+++F++ GRP+L K  VR+ ATV+EK+  +P +N  F  ++     R     + V RIN IE+
Sbjct:   97 GRLFAVVHFASHQWKVTSEDLILIEN-KLDIACGERIRMEKVLLVGADDFTLLGRPLLGKDLVRVEATVIEKTESWPRVNMRFQKRKNYKRKRIIVNPQTVLRINTIEI 204          
BLAST of 39S ribosomal protein L21 mitochondrial vs. UniProt/SwissProt
Match: sp|Q9D1N9|RM21_MOUSE (39S ribosomal protein L21, mitochondrial OS=Mus musculus OX=10090 GN=Mrpl21 PE=1 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.494e-20
Identity = 47/109 (43.12%), Postives = 68/109 (62.39%), Query Frame = 2
Query:  113 SRKFAIVHMFGRQFKVTNEDLVSITTMECDLDIGEEIVLEKVLMVGSENFSMFGRPILPKTDVRITATVVEKSSKFPLINYLFVAKRQTSVMRTQQENRVVFRINNIEL 439
             R FA+VH    Q+KVT EDL+ I   E D+  GE I LEKVL+VG++NF++ G+P+L K  VR+ ATV+EK+  +P IN  F  ++     +     + + RIN IE+
Sbjct:   97 GRLFAVVHFASHQWKVTAEDLILIEN-ELDIKCGERIRLEKVLLVGADNFTLLGKPLLRKELVRVEATVIEKTESWPKINMKFRKRKNFRKKKIIVNPQTILRINTIEI 204          
BLAST of 39S ribosomal protein L21 mitochondrial vs. UniProt/SwissProt
Match: sp|Q54IF0|RM21_DICDI (Probable 39S ribosomal protein L21, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=mrpl21 PE=3 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 2.441e-10
Identity = 28/70 (40.00%), Postives = 51/70 (72.86%), Query Frame = 2
Query:  122 FAIVHMFGRQFKVTNEDLVSITTMECDLDIGEEIVLEKVLMVGSENFSMFGRPILPKTDVRITATVVEKS 331
            FA+VH+ G+Q+KV   D+  I T +  +D+GE IVL+KVL+VG++N ++ G+PI+  ++ ++ A + E++
Sbjct:   62 FAVVHISGKQYKVIEGDI--IMTDKIQVDVGEHIVLDKVLLVGTKNETIIGKPII--SNFKVHAYIEEQA 127          
BLAST of 39S ribosomal protein L21 mitochondrial vs. UniProt/SwissProt
Match: sp|Q3A1D6|RL21_PELCD (50S ribosomal protein L21 OS=Pelobacter carbinolicus (strain DSM 2380 / NBRC 103641 / GraBd1) OX=338963 GN=rplU PE=3 SV=1)

HSP 1 Score: 52.373 bits (124), Expect = 3.018e-8
Identity = 31/102 (30.39%), Postives = 58/102 (56.86%), Query Frame = 2
Query:  122 FAIVHMFGRQFKVTNEDLVSITTMECDLDIGEEIVLEKVLMVGSENFSMFGRPILPKTDVRITATVVEKSSKFPLINYLFVAKRQTSVMRTQQENRVVFRIN 427
            +A++   G+Q+KV+  DLV I  +E    +G+ I L++VLMVG E   + G P+LP    ++TA +V++     ++  +F +KR+    +T    + + R+ 
Sbjct:    2 YAVIKTGGKQYKVSEGDLVKIEKIEG--AVGDTIELDEVLMVGGEEVKI-GTPLLP--GAKVTARIVQQGKDKKVL--VFHSKRRKGYRKTYGHRQPITRLQ 96          
BLAST of 39S ribosomal protein L21 mitochondrial vs. TrEMBL
Match: A0A2Z3D361 (Mitochondrial large ribosomal subunit protein bL21m OS=Schmidtea mediterranea OX=79327 GN=Mrpl21 PE=2 SV=1)

HSP 1 Score: 263.462 bits (672), Expect = 3.255e-87
Identity = 135/151 (89.40%), Postives = 136/151 (90.07%), Query Frame = 2
Query:    2 QDEDLSQSKLQT*NRFDCISLLEVLNLVKMDALNKNTSRKFAIVHMFGRQFKVTNEDLVSITTMECDLDIGEEIVLEKVLMVGSENFSMFGRPILPKTDVRITATVVEKSSKFPLINYLFVAKRQTSVMRTQQENRVVFRINNIELKNVEL 454
            QDEDLSQ               +VLNLVKMDALNKNTSRKFAIVHMFGRQFKVTNEDLVSITTMECDLDIGEEIVLEKVLMVGSENFSMFGRPILPKTDVRITATVVEKSSKFPLINYLFVAKRQTSVMRTQQENRVVFRINNIELKNVEL
Sbjct:   75 QDEDLSQ---------------KVLNLVKMDALNKNTSRKFAIVHMFGRQFKVTNEDLVSITTMECDLDIGEEIVLEKVLMVGSENFSMFGRPILPKTDVRITATVVEKSSKFPLINYLFVAKRQTSVMRTQQENRVVFRINNIELKNVEL 210          
BLAST of 39S ribosomal protein L21 mitochondrial vs. TrEMBL
Match: A0A0R3WK73 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS1107 PE=4 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 6.570e-28
Identity = 55/133 (41.35%), Postives = 89/133 (66.92%), Query Frame = 2
Query:   65 LEVLNLVK---MDALNKNTSRKFAIVHMFGRQFKVTNEDLVSITTMECDLDIGEEIVLEKVLMVGSENFSMFGRPILPKTDVRITATVVEKSSKFPLINYLFVAKRQTSVMRTQQENRVVFRINNIELKNVEL 454
            +EV N V+   ++++ KN SR FA++H  G+QFKVTN DL+S+     +   GE I LEK+L+ G+ +FS+ GRP+LP+++V +TA +VEK+ + P + + F  +R+   MR  Q+N V  RI ++ +KNV+ 
Sbjct:   88 IEVYNEVRKKVVESIAKNASRYFAVIHFAGKQFKVTNNDLISVKAPLLEAKPGEMIRLEKILLAGNADFSIVGRPLLPRSNVLVTAMIVEKTLQHPSLWFQFHRRRRHQAMRVYQDNLVTLRIVDVAVKNVQF 220          
BLAST of 39S ribosomal protein L21 mitochondrial vs. TrEMBL
Match: A0A068WGD0 (39S ribosomal protein L21 mitochondrial OS=Echinococcus granulosus OX=6210 GN=EgrG_000660200 PE=4 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 6.402e-26
Identity = 60/131 (45.80%), Postives = 88/131 (67.18%), Query Frame = 2
Query:   65 LEVLNLVK---MDALNKNTSRKFAIVHMFGRQFKVTNEDLVSITTMECDLDIGEEIVLEKVLMVGSENFSMFGRPILPKTDVRITATVVEKSSKFPLINYLFVAKRQTSVMRTQQENRVVFRINNIELKNV 448
            +EV N V+    ++L KN SR FA+VH  G+QFKVTN DL+S+     + + GE I LEK+L+ G+ +FS+ GRP+LP+ +V +TA VVEK+ + P + Y F  +R+  VMR  Q+N V  RI ++ +KNV
Sbjct:   86 IEVYNEVRKNVAESLAKNASRYFAVVHFAGKQFKVTNNDLISVKAPLIEAEPGELIRLEKILLAGNADFSIVGRPLLPRNNVLVTAMVVEKTLRHPSLWYQFHRRRRHRVMRVYQDNLVTLRIVDVAIKNV 216          
BLAST of 39S ribosomal protein L21 mitochondrial vs. TrEMBL
Match: A0A068Y7A5 (39S ribosomal protein L21 mitochondrial OS=Echinococcus multilocularis OX=6211 PE=4 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 7.935e-26
Identity = 60/131 (45.80%), Postives = 88/131 (67.18%), Query Frame = 2
Query:   65 LEVLNLVK---MDALNKNTSRKFAIVHMFGRQFKVTNEDLVSITTMECDLDIGEEIVLEKVLMVGSENFSMFGRPILPKTDVRITATVVEKSSKFPLINYLFVAKRQTSVMRTQQENRVVFRINNIELKNV 448
            +EV N V+    ++L KN SR FA+VH  G+QFKVTN DL+S+     + + GE I LEK+L+ G+ +FS+ GRP+LP+ +V +TA VVEK+ + P + Y F  +R+  VMR  Q+N V  RI ++ +KNV
Sbjct:   86 IEVYNEVRKNVAESLAKNASRYFAVVHFAGKQFKVTNNDLISVKAPLIEAEPGELIRLEKILLAGNADFSIVGRPLLPRNNVLVTAMVVEKTLRHPSLWYQFHRRRRHRVMRVYQDNLVTLRIVDVAIKNV 216          
BLAST of 39S ribosomal protein L21 mitochondrial vs. TrEMBL
Match: W6UPT5 (39S ribosomal protein L21 OS=Echinococcus granulosus OX=6210 GN=EGR_09725 PE=4 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 1.686e-25
Identity = 60/131 (45.80%), Postives = 88/131 (67.18%), Query Frame = 2
Query:   65 LEVLNLVK---MDALNKNTSRKFAIVHMFGRQFKVTNEDLVSITTMECDLDIGEEIVLEKVLMVGSENFSMFGRPILPKTDVRITATVVEKSSKFPLINYLFVAKRQTSVMRTQQENRVVFRINNIELKNV 448
            +EV N V+    ++L KN SR FA+VH  G+QFKVTN DL+S+     + + GE I LEK+L+ G+ +FS+ GRP+LP+ +V +TA VVEK+ + P + Y F  +R+  VMR  Q+N V  RI ++ +KNV
Sbjct:  130 IEVYNEVRKNVAESLAKNASRYFAVVHFAGKQFKVTNNDLISVKAPLIEAEPGELIRLEKILLAGNADFSIVGRPLLPRNNVLVTAMVVEKTLRHPSLWYQFHRRRRHRVMRVYQDNLVTLRIVDVAIKNV 260          
BLAST of 39S ribosomal protein L21 mitochondrial vs. Ensembl Cavefish
Match: mrpl21 (mitochondrial ribosomal protein L21 [Source:NCBI gene;Acc:103025247])

HSP 1 Score: 89.7373 bits (221), Expect = 9.495e-23
Identity = 47/120 (39.17%), Postives = 76/120 (63.33%), Query Frame = 2
Query:   86 KMDAL--NKNTSRKFAIVHMFGRQFKVTNEDLVSITTMECDLDIGEEIVLEKVLMVGSENFSMFGRPILPKTDVRITATVVEKSSKFPLINYLFVAKRQTSVMRTQQENRVVFRINNIEL 439
            K++AL  N    R FA+VH   RQ+KVTNEDL+ I     +   G+ I++EKVL+VG E+F++ G+P++    VR+ ATV+EK+  +P+++  F  + +    R   + + V RIN+IE+
Sbjct:   68 KVNALIENGEYGRLFAVVHFASRQWKVTNEDLILIEN-HIEAQCGDRIIMEKVLLVGGEDFTLIGKPLVSCDLVRVEATVIEKTESWPMVHMRFRKRHRFQRKRIIVQPQTVLRINSIEV 186          
BLAST of 39S ribosomal protein L21 mitochondrial vs. Ensembl Cavefish
Match: mrpl21 (mitochondrial ribosomal protein L21 [Source:NCBI gene;Acc:103025247])

HSP 1 Score: 89.7373 bits (221), Expect = 1.069e-22
Identity = 47/120 (39.17%), Postives = 76/120 (63.33%), Query Frame = 2
Query:   86 KMDAL--NKNTSRKFAIVHMFGRQFKVTNEDLVSITTMECDLDIGEEIVLEKVLMVGSENFSMFGRPILPKTDVRITATVVEKSSKFPLINYLFVAKRQTSVMRTQQENRVVFRINNIEL 439
            K++AL  N    R FA+VH   RQ+KVTNEDL+ I     +   G+ I++EKVL+VG E+F++ G+P++    VR+ ATV+EK+  +P+++  F  + +    R   + + V RIN+IE+
Sbjct:   69 KVNALIENGEYGRLFAVVHFASRQWKVTNEDLILIEN-HIEAQCGDRIIMEKVLLVGGEDFTLIGKPLVSCDLVRVEATVIEKTESWPMVHMRFRKRHRFQRKRIIVQPQTVLRINSIEV 187          
BLAST of 39S ribosomal protein L21 mitochondrial vs. Ensembl Sea Lamprey
Match: mrpl21 (mitochondrial ribosomal protein L21 [Source:ZFIN;Acc:ZDB-GENE-061027-183])

HSP 1 Score: 82.4185 bits (202), Expect = 6.692e-21
Identity = 43/111 (38.74%), Postives = 68/111 (61.26%), Query Frame = 2
Query:  107 NTSRKFAIVHMFGRQFKVTNEDLVSITTMECDLDIGEEIVLEKVLMVGSENFSMFGRPILPKTDVRITATVVEKSSKFPLINYLFVAKRQTSVMRTQQENRVVFRINNIEL 439
            +  R FA+VH  G+QFKVT  DL+ I   E   + G+ I +EKV++VG+ENF++ GRP+L +  VR+ ATV+EK+     I   F  +++      +   + V RIN+I++
Sbjct:   40 DYGRLFAVVHFSGKQFKVTAADLILIE-HEFQAECGDRIRMEKVMLVGAENFTLLGRPLLDRDLVRVEATVIEKTHSVEKIRMFFRRRKRWQRKYVRTTPQTVLRINSIDI 149          
BLAST of 39S ribosomal protein L21 mitochondrial vs. Ensembl Nematostella
Match: EDO38433 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD11])

HSP 1 Score: 68.5514 bits (166), Expect = 7.209e-15
Identity = 40/99 (40.40%), Postives = 62/99 (62.63%), Query Frame = 2
Query:  143 GRQFKVTNEDLVSITTMECDLDIGEEIVLEKVLMVGSENFSMFGRPILPKTDVRITATVVEKSSKFPLINYLFVAKRQTSVMRTQQENRVVFRINNIEL 439
            GRQFK+T  D ++I  +  D ++G +I LEKVL+VG ENF++ GRP+L +  V I ATV+EK+    +I +    ++     R  +++  V RIN+I L
Sbjct:  117 GRQFKITVNDTITINRI--DAEMGNKIRLEKVLLVGGENFTVIGRPLLERDLVTIFATVIEKTKTAKVIVFKKKRRKGYKRTRGHRQDITVLRINSILL 213          
BLAST of 39S ribosomal protein L21 mitochondrial vs. Ensembl Medaka
Match: MRPL21 (mitochondrial ribosomal protein L21 [Source:HGNC Symbol;Acc:HGNC:14479])

HSP 1 Score: 96.6709 bits (239), Expect = 2.296e-25
Identity = 48/113 (42.48%), Postives = 74/113 (65.49%), Query Frame = 2
Query:  101 NKNTSRKFAIVHMFGRQFKVTNEDLVSITTMECDLDIGEEIVLEKVLMVGSENFSMFGRPILPKTDVRITATVVEKSSKFPLINYLFVAKRQTSVMRTQQENRVVFRINNIEL 439
            N++  R FA+VH  GRQ+KVTNEDL+ I     D + GE I +EKVL+VG+E+F++ GRP+L +   R+ ATV+EK+  +P ++  F  + +    R   + + V RIN+I+L
Sbjct:   78 NQDFGRLFAVVHFAGRQWKVTNEDLILIEN-HIDAECGERIRVEKVLLVGAEDFTLVGRPLLGRELARVEATVIEKTESWPKVHMRFWKRHRYQRKRIIVQPQTVLRINSIDL 189          
BLAST of 39S ribosomal protein L21 mitochondrial vs. Planmine SMEST
Match: SMESG000072214.1 (SMESG000072214.1)

HSP 1 Score: 208.379 bits (529), Expect = 1.702e-70
Identity = 101/102 (99.02%), Postives = 102/102 (100.00%), Query Frame = 2
Query:   89 MDALNKNTSRKFAIVHMFGRQFKVTNEDLVSITTMECDLDIGEEIVLEKVLMVGSENFSMFGRPILPKTDVRITATVVEKSSKFPLINYLFVAKRQTSVMRT 394
            MDALNKNTSRKFAIVHMFGRQFKVTNEDLVSITTMECDLDIGEEIVLEKVLMVGSENFSMFGRPILPKTDVRITATVVEKSSKFPLINYLFVAKRQTSVMR+
Sbjct:    1 MDALNKNTSRKFAIVHMFGRQFKVTNEDLVSITTMECDLDIGEEIVLEKVLMVGSENFSMFGRPILPKTDVRITATVVEKSSKFPLINYLFVAKRQTSVMRS 102          
BLAST of 39S ribosomal protein L21 mitochondrial vs. Planmine SMEST
Match: SMESG000024477.1 (SMESG000024477.1)

HSP 1 Score: 208.379 bits (529), Expect = 1.702e-70
Identity = 101/102 (99.02%), Postives = 102/102 (100.00%), Query Frame = 2
Query:   89 MDALNKNTSRKFAIVHMFGRQFKVTNEDLVSITTMECDLDIGEEIVLEKVLMVGSENFSMFGRPILPKTDVRITATVVEKSSKFPLINYLFVAKRQTSVMRT 394
            MDALNKNTSRKFAIVHMFGRQFKVTNEDLVSITTMECDLDIGEEIVLEKVLMVGSENFSMFGRPILPKTDVRITATVVEKSSKFPLINYLFVAKRQTSVMR+
Sbjct:    1 MDALNKNTSRKFAIVHMFGRQFKVTNEDLVSITTMECDLDIGEEIVLEKVLMVGSENFSMFGRPILPKTDVRITATVVEKSSKFPLINYLFVAKRQTSVMRS 102          
The following BLAST results are available for this feature:
BLAST of 39S ribosomal protein L21 mitochondrial vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
MRPL213.634e-2345.87mitochondrial ribosomal protein L21 [Source:HGNC S... [more]
MRPL212.700e-2245.87mitochondrial ribosomal protein L21 [Source:HGNC S... [more]
MRPL217.692e-2153.16mitochondrial ribosomal protein L21 [Source:HGNC S... [more]
MRPL211.097e-1455.17mitochondrial ribosomal protein L21 [Source:HGNC S... [more]
back to top
BLAST of 39S ribosomal protein L21 mitochondrial vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mrpl-211.541e-2442.11Mitochondrial Ribosomal Protein, Large [Source:Un... [more]
back to top
BLAST of 39S ribosomal protein L21 mitochondrial vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
mRpL212.304e-1837.12gene:FBgn0036853 transcript:FBtr0333224[more]
mRpL212.304e-1837.12gene:FBgn0036853 transcript:FBtr0075022[more]
mRpL212.304e-1837.12gene:FBgn0036853 transcript:FBtr0346548[more]
back to top
BLAST of 39S ribosomal protein L21 mitochondrial vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mrpl213.331e-2137.50mitochondrial ribosomal protein L21 [Source:ZFIN;A... [more]
back to top
BLAST of 39S ribosomal protein L21 mitochondrial vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ouro11.794e-2242.34ouroboros 1 [Source:Xenbase;Acc:XB-GENE-6000695][more]
back to top
BLAST of 39S ribosomal protein L21 mitochondrial vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Mrpl212.136e-2143.12mitochondrial ribosomal protein L21 [Source:MGI Sy... [more]
Mrpl212.839e-2051.90mitochondrial ribosomal protein L21 [Source:MGI Sy... [more]
back to top
BLAST of 39S ribosomal protein L21 mitochondrial vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7Z2W9|RM21_HUMAN1.297e-2145.8739S ribosomal protein L21, mitochondrial OS=Homo s... [more]
sp|Q2TBS2|RM21_BOVIN1.383e-2142.2039S ribosomal protein L21, mitochondrial OS=Bos ta... [more]
sp|Q9D1N9|RM21_MOUSE1.494e-2043.1239S ribosomal protein L21, mitochondrial OS=Mus mu... [more]
sp|Q54IF0|RM21_DICDI2.441e-1040.00Probable 39S ribosomal protein L21, mitochondrial ... [more]
sp|Q3A1D6|RL21_PELCD3.018e-830.3950S ribosomal protein L21 OS=Pelobacter carbinolic... [more]
back to top
BLAST of 39S ribosomal protein L21 mitochondrial vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2Z3D3613.255e-8789.40Mitochondrial large ribosomal subunit protein bL21... [more]
A0A0R3WK736.570e-2841.35Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
A0A068WGD06.402e-2645.8039S ribosomal protein L21 mitochondrial OS=Echinoc... [more]
A0A068Y7A57.935e-2645.8039S ribosomal protein L21 mitochondrial OS=Echinoc... [more]
W6UPT51.686e-2545.8039S ribosomal protein L21 OS=Echinococcus granulos... [more]
back to top
BLAST of 39S ribosomal protein L21 mitochondrial vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mrpl219.495e-2339.17mitochondrial ribosomal protein L21 [Source:NCBI g... [more]
mrpl211.069e-2239.17mitochondrial ribosomal protein L21 [Source:NCBI g... [more]
back to top
BLAST of 39S ribosomal protein L21 mitochondrial vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mrpl216.692e-2138.74mitochondrial ribosomal protein L21 [Source:ZFIN;A... [more]
back to top
BLAST of 39S ribosomal protein L21 mitochondrial vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 39S ribosomal protein L21 mitochondrial vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO384337.209e-1540.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 39S ribosomal protein L21 mitochondrial vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
MRPL212.296e-2542.48mitochondrial ribosomal protein L21 [Source:HGNC S... [more]
back to top
BLAST of 39S ribosomal protein L21 mitochondrial vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000072214.11.702e-7099.02SMESG000072214.1[more]
SMESG000024477.11.702e-7099.02SMESG000024477.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016471 ID=SMED30016471|Name=39S ribosomal protein L21 mitochondrial|organism=Schmidtea mediterranea sexual|type=transcript|length=490bp
ACAAGATGAAGATTTATCTCAAAGTAAATTACAAACTTAAAATAGGTTTG
ATTGCATTTCTTTGTTAGAAGTGTTAAATTTGGTTAAAATGGACGCGTTA
AATAAAAACACTAGCCGAAAATTTGCCATAGTTCACATGTTCGGTAGACA
GTTTAAAGTGACTAATGAAGATTTAGTTTCAATAACGACAATGGAATGCG
ATTTGGATATCGGGGAAGAGATTGTTCTGGAAAAGGTTTTAATGGTAGGA
TCGGAAAATTTCTCGATGTTTGGCCGTCCGATTCTACCGAAAACTGACGT
TCGGATCACCGCGACAGTCGTGGAAAAGAGTAGCAAATTTCCGTTGATTA
ATTATTTATTCGTAGCAAAGCGGCAGACCTCGGTAATGAGGACGCAACAG
GAGAATCGAGTCGTCTTCAGGATCAATAATATCGAACTGAAAAATGTCGA
ATTATAAGTAATAAATTTTGTCTTGACTTCTTTAAAAAAA
back to top

protein sequence of SMED30016471-orf-1

>SMED30016471-orf-1 ID=SMED30016471-orf-1|Name=SMED30016471-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=123bp
MDALNKNTSRKFAIVHMFGRQFKVTNEDLVSITTMECDLDIGEEIVLEKV
LMVGSENFSMFGRPILPKTDVRITATVVEKSSKFPLINYLFVAKRQTSVM
RTQQENRVVFRINNIELKNVEL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR028909L21p-like
Vocabulary: cellular component
TermDefinition
GO:0005840ribosome