Cytochrome P450

Overview
NameCytochrome P450
Smed IDSMED30016464
Length (bp)1796
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cytochrome P450 (SMED30016464) t-SNE clustered cells

Violin plots show distribution of expression levels for Cytochrome P450 (SMED30016464) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cytochrome P450 (SMED30016464) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cytochrome P450 (SMED30016464) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016464

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30016464SMESG000060680.1 dd_Smed_v4_9863_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30016464SMESG000060680.1 SMED30016464smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30016464SMESG000060680.1 SMED30016464smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cytochrome P450 vs. Ensembl Human
Match: CYP3A4 (cytochrome P450 family 3 subfamily A member 4 [Source:HGNC Symbol;Acc:HGNC:2637])

HSP 1 Score: 247.284 bits (630), Expect = 2.640e-74
Identity = 166/532 (31.20%), Postives = 272/532 (51.13%), Query Frame = 2
Query:  131 YRRRKISLFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQ-FSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGI--SQKINFLKIRSTLLQIINARKKSSEK-RFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGIRER 1714
            Y      LF +  I GP P    GN++ Y    F     +  +KYGKV+ +++G  P + I DPD+++ VLVK+ +S F  R+ F     P    K+++  A  + WKRLRS ++P F+  K++ M+P+I Q  DVL+  L  E++   + + + DV    +MD+I    FG+  +   N  DPF+ + K  L         +++ + FP      I ++E  N  +   +  NFL  R ++ ++  +R + ++K R D LQL++DS+                     + KE +++        K L+  E++  + +F+FAGY+T+S  +S+I++ LA + D Q KL  EID V              YD+++++ YL+ V+ ETLR +P ++  + R+C K       NG +IPK   +++  +++H D   W   +P  F PERF + N D        +P I+ PFG GPRNCIG R ALM +KL L  ++  F   P + T+ PL+L LG  + P   V L +  R
Sbjct:   25 YGTHSHGLFKKLGIPGPTPLPFLGNILSYHKG-FCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPF----GPVGFMKSAISIAEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETG-KPVTLKDVFGAYSMDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITV-FP----FLIPILEVLNICVFPREVTNFL--RKSVKRMKESRLEDTQKHRVDFLQLMIDSQ---------------------NSKETESH--------KALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPT------YDTVLQMEYLDMVVNETLRLFP-IAMRLERVCKKDVEI---NGMFIPKGVVVMIPSYALHRDPKYW--TEPEKFLPERFSKKNKDN------IDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESR 496          
BLAST of Cytochrome P450 vs. Ensembl Human
Match: CYP3A5 (cytochrome P450 family 3 subfamily A member 5 [Source:HGNC Symbol;Acc:HGNC:2638])

HSP 1 Score: 245.743 bits (626), Expect = 1.073e-73
Identity = 169/536 (31.53%), Postives = 269/536 (50.19%), Query Frame = 2
Query:  131 YRRRKISLFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQ-FSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGISQK--INFLKIRSTLLQIINARKKS-----SEKRFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGIRER 1714
            Y  R   LF +  I GP P  + GN++ YR  + ++   +  +KYGK++  +EG  P + I DPD+++ VLVK+ +S F  R+       P    K+++  A  + WKR+RS ++P F+  K++ M P+I Q  DVL+  L  E++K  + + + D+    +MD+I    FG+  +   N  DPF+ S K FL       L ++++L FP +  +F    E  N  +  K  INFL       + +N  KKS      + R D LQL++DS+                     + KE +++        K L+  E+   + +F+FAGY+T+S  +S+ L+ LA + D Q KL  EID V              YD++V++ YL+ V+ ETLR +P V+  + R C K       NG +IPK + +++  +++H D   W   +P  F PERF +            +P I+ PFG GPRNCIG R ALM +KL L  ++  F   P + T+ PL+L     + P   + L +  R
Sbjct:   25 YGTRTHGLFKRLGIPGPTPLPLLGNVLSYRQGL-WKFDTECYKKYGKMWGTYEGQLPVLAITDPDVIRTVLVKECYSVFTNRRSL----GPVGFMKSAISLAEDEEWKRIRSLLSPTFTSGKLKEMFPIIAQYGDVLVRNLRREAEKG-KPVTLKDIFGAYSMDVITGTSFGVNIDSLNNPQDPFVESTKKFLKFGFLDPLFLSIIL-FPFLTPVF----EALNVSLFPKDTINFLS------KSVNRMKKSRLNDKQKHRLDFLQLMIDSQ---------------------NSKETESH--------KALSDLELAAQSIIFIFAGYETTSSVLSFTLYELATHPDVQQKLQKEIDAVLPNKAPPT------YDAVVQMEYLDMVVNETLRLFP-VAIRLERTCKKDVEI---NGVFIPKGSMVVIPTYALHHDPKYW--TEPEEFRPERFSKKKDS-------IDPYIYTPFGTGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLDTQGLLQPEKPIVLKVDSR 495          
BLAST of Cytochrome P450 vs. Ensembl Human
Match: CYP3A7 (cytochrome P450 family 3 subfamily A member 7 [Source:HGNC Symbol;Acc:HGNC:2640])

HSP 1 Score: 239.195 bits (609), Expect = 4.097e-71
Identity = 164/534 (30.71%), Postives = 270/534 (50.56%), Query Frame = 2
Query:  125 YVYRRRKISLFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQ-FSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGI--SQKINFLKIRSTLLQIINARKKSSEK-RFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGIRER 1714
            Y+Y  R   LF +  I GP P    GN + +R   ++    +  +KY KV+  ++   P + I DPD+++ VLVK+ +S F  R+ F     P    K ++  A  + WKR+RS ++P F+  K++ M+P+I Q  DVL+  L  E++   + + +  V    +MD+I    FG+  +   N  DPF+ + K  L         +++ + FP +  I    +E  N  +   + I+FL    ++ QI   R K ++K R D LQL++DS+                     + K+ +T+        K L+  E++  + +F+FAGY+T+S  +S+I++ LA + D Q K+  EID V              YD++++L YL+ V+ ETLR +P V+  + R+C K       NG +IPK   +++  + +H D   W   +P  F PERF + N D        +P I+ PFG GPRNCIG R AL+ +KL L  ++  F   P + T+ PL+L+LG  + P   + L +  R
Sbjct:   23 YLYGTRTHGLFKKLGIPGPTPLPFLGNALSFRKG-YWTFDMECYKKYRKVWGIYDCQQPMLAITDPDMIKTVLVKECYSVFTNRRPF----GPVGFMKNAISIAEDEEWKRIRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETG-KPVTLKHVFGAYSMDVITSTSFGVSIDSLNNPQDPFVENTKKLLRFNPLDPFVLSIKV-FPFLTPI----LEALNITVFPRKVISFLT--KSVKQIKEGRLKETQKHRVDFLQLMIDSQ---------------------NSKDSETH--------KALSDLELMAQSIIFIFAGYETTSSVLSFIIYELATHPDVQQKVQKEIDTVLPNKAPPT------YDTVLQLEYLDMVVNETLRLFP-VAMRLERVCKKDVEI---NGMFIPKGVVVMIPSYVLHHDPKYW--TEPEKFLPERFSKKNKDN------IDPYIYTPFGSGPRNCIGMRFALVNMKLALVRVLQNFSFKPCKETQIPLKLRLGGLLQPEKPIVLKVESR 496          
BLAST of Cytochrome P450 vs. Ensembl Human
Match: CYP3A4 (cytochrome P450 family 3 subfamily A member 4 [Source:HGNC Symbol;Acc:HGNC:2637])

HSP 1 Score: 235.343 bits (599), Expect = 1.970e-69
Identity = 166/557 (29.80%), Postives = 273/557 (49.01%), Query Frame = 2
Query:  131 YRRRKISLFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQ-FSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGI--SQKINFLKIRSTLLQIINARKKSSEK-RFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERF---------LQINGDEYEFVAP----------------TNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGIRER 1714
            Y      LF +  I GP P    GN++ Y    F     +  +KYGKV+ +++G  P + I DPD+++ VLVK+ +S F  R+ F     P    K+++  A  + WKRLRS ++P F+  K++ M+P+I Q  DVL+  L  E++   + + + DV    +MD+I    FG+  +   N  DPF+ + K  L         +++ + FP      I ++E  N  +   +  NFL  R ++ ++  +R + ++K R D LQL++DS+                     + KE +++        K L+  E++  + +F+FAGY+T+S  +S+I++ LA + D Q KL  EID V              YD+++++ YL+ V+ ETLR +P ++  + R+C K       NG +IPK   +++  +++H D   W   +P  F PER          +    DE   + P                 +P I+ PFG GPRNCIG R ALM +KL L  ++  F   P + T+ PL+L LG  + P   V L +  R
Sbjct:   25 YGTHSHGLFKKLGIPGPTPLPFLGNILSYHKG-FCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPF----GPVGFMKSAISIAEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETG-KPVTLKDVFGAYSMDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITV-FP----FLIPILEVLNICVFPREVTNFL--RKSVKRMKESRLEDTQKHRVDFLQLMIDSQ---------------------NSKETESH--------KALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPT------YDTVLQMEYLDMVVNETLRLFP-IAMRLERVCKKDVEI---NGMFIPKGVVVMIPSYALHRDPKYW--TEPEKFLPERLEKRKLQSSTIPTTYDEGHQLCPYGSSVSKIFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESR 527          
BLAST of Cytochrome P450 vs. Ensembl Human
Match: CYP3A7 (cytochrome P450 family 3 subfamily A member 7 [Source:HGNC Symbol;Acc:HGNC:2640])

HSP 1 Score: 232.646 bits (592), Expect = 1.020e-68
Identity = 162/534 (30.34%), Postives = 267/534 (50.00%), Query Frame = 2
Query:  125 YVYRRRKISLFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQ-FSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGI--SQKINFLKIRSTLLQIINARKKSSEK-RFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGIRER 1714
            Y+Y  R   LF +  I GP P    GN + +R   ++    +  +KY KV+  ++   P + I DPD+++ VLVK+ +S F  R+ F     P    K ++  A  + WKR+RS ++P F+  K++ M+P+I Q  DVL+  L  E++   + + +  V    +MD+I    FG+  +   N  DPF+ + K  L         +++ + FP +  I    +E  N  +   + I+FL    ++ QI   R K ++K R D LQL++DS+                     + K+ +T+        K L+  E++  + +F+FAGY+T+S  +S+I++ LA + D Q K+  EID V              YD++++L YL+ V+ ETLR +P V+  + R+C K       NG +IPK   +++  + +H D   W   +P  F PERF + N D        +P I+ PFG GPRNCIG R AL+ +KL L  ++  F   P + T+ PL+L+ G  +     + L    R
Sbjct:   23 YLYGTRTHGLFKKLGIPGPTPLPFLGNALSFRKG-YWTFDMECYKKYRKVWGIYDCQQPMLAITDPDMIKTVLVKECYSVFTNRRPF----GPVGFMKNAISIAEDEEWKRIRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETG-KPVTLKHVFGAYSMDVITSTSFGVSIDSLNNPQDPFVENTKKLLRFNPLDPFVLSIKV-FPFLTPI----LEALNITVFPRKVISFLT--KSVKQIKEGRLKETQKHRVDFLQLMIDSQ---------------------NSKDSETH--------KALSDLELMAQSIIFIFAGYETTSSVLSFIIYELATHPDVQQKVQKEIDTVLPNKAPPT------YDTVLQLEYLDMVVNETLRLFP-VAMRLERVCKKDVEI---NGMFIPKGVVVMIPSYVLHHDPKYW--TEPEKFLPERFSKKNKDN------IDPYIYTPFGSGPRNCIGMRFALVNMKLALVRVLQNFSFKPCKETQIPLKLRFGGLLLTEKPIVLKAESR 496          
BLAST of Cytochrome P450 vs. Ensembl Celegans
Match: cyp-13A12 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:O17807])

HSP 1 Score: 229.565 bits (584), Expect = 7.354e-68
Identity = 163/550 (29.64%), Postives = 287/550 (52.18%), Query Frame = 2
Query:   77 VMFIFISLVAFLFTLFYVYRRRKISLFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQFSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTN---FSSLKMA---------LLLTFPEI-KSIFIYMMERFNSGISQKINFLKIRSTLLQIINARKKSSEKRFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPAN 1687
            ++   I +++F    +  ++RR I+  S Y ILG     +      Y          +W ++YGKV+   EG +  +VI DPDL+Q+V VKQ+ NF GRKL P Q +P++D++ ++F ++G RWKRLR+  +P FS++ +R++   +E+    L+  + + +    + I+++D  Q  T+D+I +   G +T+ Q+  N P +  ++A  G      F S  +A         ++ + P I K+  ++++   ++ + Q++  L++      I     +      D + L LD++  D ++  EN           +E   K  + +    ++QLTTEE++G   +F+ AG+DT+++++SY    LA +   Q KL  EID        +  +    +D + KL Y+  VI ETLR YP  +   +R C+++  T + N + I + TNI+ +  ++H DK +WG  D   F PER+   +GDE+ +        ++PFG GPR CIG RLA M  KL LSH++ ++ +     T+ PL+L    T  P +
Sbjct:    8 ILTSIIGVLSFYLWTWSYWKRRGIAGPSGYPILGSALEMLSSENPPYLQ------LKEWTKQYGKVYGITEGLSRTLVISDPDLVQEVFVKQYDNFFGRKLNPIQGDPNKDKRVNLFSSQGHRWKRLRTISSPTFSNNSLRKLKTTVEECAVELLRHIEQHTDGG-QPIDLLDFYQEFTLDVIGRIAMG-QTDSQMFKN-PLLPYVRAVFGEPRKGLFLSGSLAPWIGPILRMVMFSLPNIVKNPAVHVIRHTSNAVEQRVK-LRMADEKAGIDPGEPQ------DFIDLFLDAKSDDVEL--EN-----------NEDFTKAGVKV----TRQLTTEEIVGQCFVFLIAGFDTTALSLSYSSFLLATHPKVQKKLQEEIDR-------ECADPEVTFDQLSKLKYMECVIKETLRMYPLGALANSRCCMRA--TKIGNYE-IDEGTNILCDTWTLHSDKSIWG-EDAEEFKPERWE--SGDEHFYQKGG----YIPFGLGPRQCIGMRLAYMEEKLLLSHILRKYTLEVCNKTQIPLKLIGSRTTQPES 507          
BLAST of Cytochrome P450 vs. Ensembl Celegans
Match: cyp-13A4 (Putative cytochrome P450 CYP13A4 [Source:UniProtKB/Swiss-Prot;Acc:Q27513])

HSP 1 Score: 229.18 bits (583), Expect = 1.010e-67
Identity = 171/554 (30.87%), Postives = 276/554 (49.82%), Query Frame = 2
Query:   80 MFIFISLVAFLFTLFYVYRRRKISLFSQYNILGPPPNFIFGNLI---EYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQFSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKA---------FLGGTNF---SSLKMALLLTFPEIKSIFIYM--MER-FNSGISQKINFLKIRSTLLQIINARKKSSEKRFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPAN 1687
            M + + +   LF  F  Y     S + +  + GP     FG ++   +Y +    +L  +W +KYG ++   EG    +V+ +P+ + +V VKQF NF+GRK  P Q +P+++++A +  A+G RWKRLR+  +P FS+  +R+++  +E+++  LM  L E S K  ++++++D  Q  T+DII +   G      L   +P +  +K          FL    F    +L   L + FP+    F  M  ME+  N  + Q+    K          A  + S +  D + L LD+        + + IE  + + F   + +K +        K LT +E+IG   +F+ AGYDT+++++SY  + LA + + Q KL  E+D        +  +    +D I KL Y+  V+ E LR YP  S + NR C+K        G  I + TN+ V+  ++H+D  +WG  D   F PER+    GDE  F A      +LPFG GPR CIG RLA+M  KL L+H++ ++    S  TE PL+L    TI P N
Sbjct:    1 MSLSLLIAGALFIGFLTYYIWIWSFWIRKGVKGPRGFPFFGVILKFHDYENPGLLKL-GEWTKKYGSIYGITEGVEKTLVVSNPEFVHEVFVKQFDNFYGRKTNPIQGDPNKNKRAHLVLAQGHRWKRLRTLASPTFSNKSLRKIMSTVEETVVELMRHLDEASAKG-KAVDLLDYYQEFTLDIIGRIAMG--QTESLMFRNPMLPKVKEIFKKGGKMPFLIAGVFPIAGTLMRQLFMKFPKFSPAFGIMNTMEKALNKRLEQRAADKK----------AGIEPSGEPQDFIDLFLDARA------NVDFIEEESTLGFAKSEVLKVD--------KHLTFDEIIGQLFVFLLAGYDTTALSLSYSSYLLATHPEIQKKLQEEVDR-------ECPDPEVTFDQISKLKYMECVVKEALRMYPLASLVHNRKCMKKTNVL---GVEIDEGTNVQVDTWTLHYDPKVWG-DDASEFKPERWE--TGDEL-FYAKGG---YLPFGMGPRICIGMRLAMMEEKLLLTHILKKYTFDTSTETEIPLKLVGSATIAPRN 509          
BLAST of Cytochrome P450 vs. Ensembl Celegans
Match: cyp-13A10 (Putative cytochrome P450 CYP13A10 [Source:UniProtKB/Swiss-Prot;Acc:Q09653])

HSP 1 Score: 228.409 bits (581), Expect = 2.043e-67
Identity = 155/553 (28.03%), Postives = 279/553 (50.45%), Query Frame = 2
Query:   86 IFISLVAFLFTLFYVYRRRKISLFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQFSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGISQKINFLKIRSTLLQII--------NARKKSSE--KRFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGIRER 1714
            +FI  +++   ++  +RRR I     Y ++G  P  +     +Y           W + YG ++ Y EG    +++ D D+++ + V+Q+ NF+GRKL P Q +P++DE+ ++F A+G RWKRLR+  +P FS++ +R++   +E S   L+  + E++ +  + I+++   Q  TMD I +   G +T+ Q+  N P +  ++A   G N   + + +   FP +  +F + M +F   +    NF+ +  T++  +        N RK   E  +  D + L L++   D +   EN  + S    +                ++QLTT+E++G   +F+ AG+DT+++++SY    LA + + Q KL  EI+    E           +D + KL Y++ +I ETLR YP  +   +R C+++  T L N + +   T + V+  S+H D  +WG  D   F PER+L  N D+           ++ FG GPR C+G RLA M  K+ L+H++ ++       TE PL+L +G        V + +++R
Sbjct:   11 LFIGFISYYLWIWTYWRRRGIPGPLGYPLVGSFPKTLKSEYPQYLQ------IRDWTKLYGPIYGYTEGTIKTLIVSDIDIVRQIFVEQYDNFYGRKLNPIQGDPEKDERTNLFSAQGFRWKRLRAISSPTFSNNSLRKINVTVEDSAMELLRHIEEQTSEG-QQIDMLQFYQEFTMDTIGRIAMG-QTDSQMFKN-PLLKFVRAIF-GDNRKHIPL-IGGVFPTLAQVFRFFMLKFP--LLGAANFIHVNKTVVTAVQNRIDQRENDRKNGIEIGEPQDFIDLFLEARADDVEHFQENNGDFSKTSSY---------------GNRQLTTQEIVGQCLVFLIAGFDTTALSLSYTTFLLATHPEVQKKLQEEIERECIEPSIS-------FDHLSKLKYMDCIIKETLRLYPLGTMANSRRCMRA--TKLGNVE-VEVGTMVQVDTWSLHTDTKIWG-DDAKEFKPERWLDPNCDQV-----FQKGGYISFGLGPRQCVGMRLAYMEEKMLLAHILRKYTFEVGTKTEIPLKL-VGRATTQPETVWMHLKQR 518          
BLAST of Cytochrome P450 vs. Ensembl Celegans
Match: cyp-13A8 (Putative cytochrome P450 CYP13A8 [Source:UniProtKB/Swiss-Prot;Acc:Q27516])

HSP 1 Score: 225.328 bits (573), Expect = 2.247e-66
Identity = 162/541 (29.94%), Postives = 282/541 (52.13%), Query Frame = 2
Query:   86 IFISLVAFLFTLFYVYRRRKISLFSQYNILGPPPNFIFGN---LIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQFSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPE--IKSIFIYMMERFNSGISQKINFLKIRSTLLQIINARKKSSEKRFDLLQLLLDSEVTDKKMIDENA-IESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNP-LIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPAN 1687
            I IS+V + F  +  ++RR +         GP    IFG    ++E      Y L  KW ++YGK++ + EG    +VI DPDL+Q++LVKQ+ NF+GRK  P Q +PD+D+   +  A+G RWKRLR+   PAFS+  ++++L  +E S   LM KL EES+   +++ +    Q  T D+I +   G + + Q+  N P +  +K F     +     +    F    +K +FI  + +F +G      F+ ++ ++   + +R   +++  D    +   E  D   +  NA  E  +  +  DE    ++      N++QLTT+E+I    +F+ AG+DT+++++SY+ + LA+N   Q+KL  E+D+       +  N    +D + KL Y++ VI E+LR +PF S   +R C+++    +   Q +    +++++  ++H DK++WG +D   F PER          + +P  P   +L FG GPR C+G R AL+  K  LSH++ ++    +  T+ P++L    T  P N
Sbjct:    6 ILISIVTYYFWHWTFWKRRGLP--------GPWGVPIFGKAGAMLEDSFPPGYTL-QKWTKEYGKIYGFTEGMQKVMVISDPDLVQEILVKQYDNFYGRKHNPVQGDPDKDKDIHIVGAQGFRWKRLRTITAPAFSNGSIKKVLTTMEDSTQELMKKLREESENG-KAVNMHLFYQEYTFDVISRVAMG-QPDSQMFKN-PLLKDVKGFFEHNRWQIWMFSGGFPFAVSFLKWLFI-KVGKFGAG-----PFIVVQKSVTDAVMSR--IAQREADKKHGVEPGEAADYIDMFLNARAEVEHFGESNDEFHKSSS-----YNNRQLTTQEIISQCFVFLVAGFDTTAISLSYVTYFLALNPKIQSKLQDEVDK-------ECPNDEITFDQLSKLKYMDNVIKESLRLFPFASFANSRRCMRNT---VIGEQIVEAGVDVMIDTWTLHHDKNVWG-NDVEEFKPER----------WDSPLTPQQAYLSFGAGPRVCLGMRFALLEQKGLLSHILKKYTFETNAKTQLPIKLVGRATARPEN 500          
BLAST of Cytochrome P450 vs. Ensembl Celegans
Match: cyp-13A2 (Putative cytochrome P450 CYP13A2 [Source:UniProtKB/Swiss-Prot;Acc:Q27518])

HSP 1 Score: 224.557 bits (571), Expect = 5.071e-66
Identity = 155/545 (28.44%), Postives = 271/545 (49.72%), Query Frame = 2
Query:   86 IFISLVAFLFTLFYVYRRRKISLFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQFSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGISQKINFLKIRSTLLQIINARKKSSEKRF--------DLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKS---EGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPAN 1687
            IF+ ++ +   ++  + R+ +         G P   +   L+E+ +    +L  +W +KYGKV+ Y +G    +V+ DP ++ ++ VKQF NF+GRKL P Q NP+++++  +  A+G RWKRLR+  + +FS++ +++M   +E S   L+  + +++    E I+++   Q  TMD+I +   G +T+  +  N P +  ++    G+  +   M +   FP I      +  +F      +I   K+ S +  ++ AR    E+          D + L LD+   D   +D +A    +          K N+ +    +K+L+ +EV+G   LF+  G+DT+++++SY+ + LAVN   Q K+  EI   F   E +       ++ + +L Y++ VI E LR YP  S   +R C+K+    G  +  G Y+  DT       S+H+D +LWG  D   F PER+      E++         +LPFG GPR CIG RLA+M  K+ L+HL+  +       T  PL+L    T  P +
Sbjct:   13 IFLGILTYYLWIWTYWMRKGVK-----GPRGRPFVGVLDVLLEHETPGLIKL-GEWTKKYGKVYGYTDGTQRTLVVADPAMVHEIFVKQFDNFYGRKLNPIQGNPEKEQRVHLLAAQGYRWKRLRTISSQSFSNASLKKMKRTVEDSALELLRHIEKQTAGG-EQIDMLRFYQEYTMDVIGRFAMG-QTDSMMFKN-PIVNVVREIFCGSRKNL--MLICQVFPPIGQFIRDLTFKF-----PRIPAFKLYSIMQDVVAARIAQREREKGAESGEPQDFIDLFLDARSDD---VDFSAEAREDFS--------KRNLKI----TKELSADEVVGQCFLFLIGGFDTTALSLSYVTYLLAVNPKIQEKVIEEIAREFGTSEVE-------FEKLGRLKYMDCVIKEALRLYPLASISNSRKCMKTTTVNGVKIEAGVYVQMDT------WSLHYDPELWG-EDVKEFKPERWSTDEPLEHKGA-------YLPFGLGPRQCIGMRLAIMEQKILLTHLLKNYTFETGNKTRIPLKLVGSATTSPED 505          
BLAST of Cytochrome P450 vs. Ensembl Fly
Match: Cyp6a2 (gene:FBgn0000473 transcript:FBtr0086133)

HSP 1 Score: 197.208 bits (500), Expect = 1.006e-55
Identity = 162/542 (29.89%), Postives = 257/542 (47.42%), Query Frame = 2
Query:   80 MFIFISL-VAFLFTLFYVYRRRKISLFSQYNILGPP---PNFIFGNLIEYRST-VFYELFAKWERKYGKVFVYFEG----PTPNVVIGDPDLLQDVLVKQFSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEE--SQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGISQKINFLKIRSTLLQIINA----RKKSSEKRFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVF--AGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQ 1654
            MF+ I L +A    L Y+Y R     F+ +N  G P   P+ ++GN++ +R   V ++ F  +  KY K    F G      P   I D  L +++L+K FSNF  R    F    D+     +F   GK+WK +R  + P F+  KM+ M P + +  +  +  + E+  + ++   +EI ++M R T D+I  C FGIE N    +  P  VS    +G   F+ ++   LLT      +F++   +  S +  ++    +    ++++N     R++ + KR D + LL++ +   +  +D   +                   +  M+  +L        A +FVF  AG++TSS  MSY L+ LA N D Q++L +EI  V +E E +       Y+SI  + YLN VI ETLR Y  V   + R  L            I K T +I+   + H D+DL+   +P  F PERF        E VA    + WLPFG GPRNCIG R   M  ++ L+ +I +FR++    TE PL+
Sbjct:    1 MFVLIYLLIAISSLLAYLYHRN----FNYWNRRGVPHDAPHPLYGNMVGFRKNRVMHDFFYDYYNKYRKSGFPFVGFYFLHKPAAFIVDTQLAKNILIKDFSNFADRG--QFHNGRDDPLTQHLFNLDGKKWKDMRQRLTPTFTSGKMKFMFPTVIKVSEEFVKVITEQVPAAQNGAVLEIKELMARFTTDVIGTCAFGIECN---TLRTP--VSDFRTMGQKVFTDMRHGKLLT------MFVFSFPKLASRLRMRMMPEDVHQFFMRLVNDTIALRERENFKRNDFMNLLIELKQKGRVTLDNGEV-------------------IEGMDIGELA-------AQVFVFYVAGFETSSSTMSYCLYELAQNQDIQDRLRNEIQTVLEEQEGQLT-----YESIKAMTYLNQVISETLRLYTLVPH-LERKALNDYVVPGHEKLVIEKGTQVIIPACAYHRDEDLYP--NPETFDPERF------SPEKVAARESVEWLPFGDGPRNCIGMRFGQMQARIGLAQIISRFRVSVCDTTEIPLK 485          
BLAST of Cytochrome P450 vs. Ensembl Fly
Match: Cyp6a13 (gene:FBgn0033304 transcript:FBtr0088690)

HSP 1 Score: 194.126 bits (492), Expect = 7.803e-55
Identity = 153/534 (28.65%), Postives = 253/534 (47.38%), Query Frame = 2
Query:   92 ISLVAFLFT---LFYVYRRRKISLFSQYNILGPPPNFIFGNLIEYRSTV--------FYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQFSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLP-LIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGISQKINFLKIRSTLLQIINARKKSSEKRFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPK-DTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQ 1654
            ++L+  +FT   L YV  R   S +S+  + G  P +  GN+      +         Y  F   ER  G    YF   T ++ I D +L++D++++ FS+F  R LF      D+    ++ F  G  W+ LR  +   F+  KM+ M P ++E     +  KL +  +  +  IE  D+  R T D+I  C FG+E N   +    F    ++       S L  A +   PE+     + +  F   +S+   FL    T+ Q ++ R++ +  R DL+QLL++        + E  ++ +                        L+ E++   A +F  AG+DTSS  MS+ L+ LA+N D Q +L  E+  V K   +K       YDS+ ++PYL+ V+ ETLR YP +  ++ R    ++   + N   I +  + II+ VHS+H D +L+   DP  F P RF      E E +   +P  +LPFG GPRNCIG+R   + +K+ L +L+  F+ + S+ T+ PL+
Sbjct:    2 LTLLVLVFTVGLLLYVKLRWHYSYWSRRGVAGERPVYFRGNMSGLGRDLHWTDINLRIYRKFRGVERYCG----YFTFMTKSLFIMDLELIRDIMIRDFSSFADRGLF--HNVRDDPLTGNLLFLDGPEWRWLRQNLTQVFTSGKMKFMFPNMVE-----VGEKLTQACRLQVGEIEAKDLCARFTTDVIGSCAFGLECNSLQDPESQFRRMGRSVTQEPLHSVLVQAFMFAQPELARKLRFRL--FRPEVSE--FFL---DTVRQTLDYRRRENIHRNDLIQLLME--------LGEEGVKDA------------------------LSFEQIAAQALVFFLAGFDTSSTTMSFCLYELALNPDVQERLRVEVLAVLKRNNQKLT-----YDSVQEMPYLDQVVAETLRKYPILPHLLRR---STKEYQIPNSNLILEPGSKIIIPVHSIHHDPELYP--DPEKFDPSRF------EPEEIKARHPFAYLPFGEGPRNCIGERFGKLQVKVGLVYLLRDFKFSRSEKTQIPLK 469          
BLAST of Cytochrome P450 vs. Ensembl Fly
Match: Cyp6a23 (gene:FBgn0033978 transcript:FBtr0087452)

HSP 1 Score: 191.045 bits (484), Expect = 1.316e-53
Identity = 143/536 (26.68%), Postives = 257/536 (47.95%), Query Frame = 2
Query:  137 RRKISLFSQYNILGPPPNFIFGNLIEYR-----STVFYELFAKWERK---YGKVFVYFEGPTPNVVIGDPDLLQDVLVKQFSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIES--IEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGISQKINFLKIRSTLLQIINARKKSSEKRFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPA-NGVNLGIRE 1711
            RR+   + +  I    P+ I+GN+ ++      + +F + + K++R    +   + +F   T + VI D +L++ VL+K F++F  R +F      D+   A++F   G++W+ LR  + P F+  KM+ M P+I + +   M K+        E   +EI+D++ R T D+I  C FG+  N   N N  F+   K  +    +  L   L+  FP++         R    +    +F    S +   I+ R +++EKR D +  L++                        EKE   N          L+  E++  A +F  AG++TSS  M + L+ LA++ D Q++L +EI+ V  +   +       Y+ I ++ YL  V+ ETLR YP ++  + RM  +++ +      +I K T +++    +H+D +++   +P  F PERF        E +A      WLPFG GPRNCIG R  LM   + L++LI  ++ + S  T+ P++  + + +  A NG++L + +
Sbjct:   20 RRRHGYWQRRGIPHDVPHPIYGNMKDWPKKRHIAMIFRDYYTKYKRSVYPFAGFYFFF---TRSAVITDLELVKRVLIKDFNHFENRGIF--YNEIDDPLSATLFSIEGQKWRHLRHKLTPTFTSGKMKNMFPIIVK-VGEEMEKIFSAKTTTGEGQVLEIVDLVARYTADVIGNCAFGLNCNSLQNPNAEFVTIGKRAIIERRYGGLLDFLIFGFPKLSRRL-----RLKLNVQDVEDFYT--SIVRNTIDYRLRTNEKRHDFMDSLIEMY----------------------EKEQAGN------TEDGLSFNEILAQAFIFFVAGFETSSTTMGFALYELALDQDIQDQLRAEINNVLSKHNNEFT-----YEGIKEMKYLEQVVMETLRKYPVLAH-LTRMT-QTDFSPEDPKYFIAKGTTVVIPALGIHYDPEIYP--EPEKFKPERFTD------EAIAARPSCTWLPFGEGPRNCIGLRFGLMQACVGLAYLIRGYKFSVSTETQIPMKFVVKSILLSAENGIHLKVEK 499          
BLAST of Cytochrome P450 vs. Ensembl Fly
Match: Cyp6a8 (gene:FBgn0013772 transcript:FBtr0087455)

HSP 1 Score: 189.889 bits (481), Expect = 4.829e-53
Identity = 146/528 (27.65%), Postives = 249/528 (47.16%), Query Frame = 2
Query:   83 FIFISLVAFLFTLFYVYRRRKISLFSQYNILGPPPNFIFGNLIEYRST-----VFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQFSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGISQKINFLKIRSTLLQIINARKKSSEKRFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPL 1651
            +I   +   L  +   Y  RK++ F +  I    P+ I GN+ E + T     +F + + K+         +F   +P   + D +L + +L+K FSNF  + +F  +K  D+   A +F   G +W+ LR+ ++  F+  KM+ M P +    +  MT +HE+  K+   +EI D++ R T+D+I  C FGI+ N   +    F+   K  L      +L    + ++P++       M R    I +  + +     + + +  R+K   KR D + +L+  E+ ++K   E  +E+ ++++                    LT EEV+  A +F  AG++TSS  M + L+ LA N D Q+K+ +E++EV ++ ++        Y+    L YLN V+ ETLR Y  V   ++RM  K           I    ++I+   ++H D  ++   +P  F PERF        E  A    + WLPFG GPRNCIG R   M  ++ L+ LI  F+ +    T NPL
Sbjct:    5 YILFQVAVALLAILTYYIHRKLTYFKRRGIPFVAPHLIRGNMEELQKTKNIHEIFQDHYNKFRESKAPFVGFFFFQSPAAFVIDLELAKQILIKDFSNFSNKGIFYNEK--DDPISAHLFNLDGAQWRLLRNKLSSTFTSGKMKLMYPTVVSVANEFMTVMHEKVPKN-SVLEIRDLVARFTVDVIGTCAFGIQCNSLRDEKAEFLYFGKRSLVDKRHGTLLNGFMRSYPKLARKL--GMVRTAPHIQEFYSRI-----VTETVAVREKEHIKRNDFMDMLI--ELKNQK---EMTLENGDVVR-------------------GLTMEEVLAQAFVFFIAGFETSSSTMGFALYELAKNPDIQDKVRAEVEEVIEQHDQNFT-----YECTKDLKYLNQVLDETLRLYTIVPN-LDRMAAKRYVVPGHPNFVIEAGQSVIIPSSAIHHDPSIYP--EPFEFRPERF------SPEESAGRPSVAWLPFGDGPRNCIGLRFGQMQARIGLALLIRNFKFSTCSKTPNPL 484          
BLAST of Cytochrome P450 vs. Ensembl Fly
Match: Cyp6w1 (gene:FBgn0033065 transcript:FBtr0085987)

HSP 1 Score: 186.422 bits (472), Expect = 1.046e-51
Identity = 146/525 (27.81%), Postives = 247/525 (47.05%), Query Frame = 2
Query:  110 LFTLFYVYRRRKISLFSQYNILGPPPNFIFGNLIEYRSTV--FYELFAKWERKYG---KVFV-YFEGPTPNVVIGDPDLLQDVLVKQFSNFHGRKLFPFQKNPDEDEKA--SMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIES---IEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGISQKINFLKIRSTLLQIINARKKSSEKRFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLS----NGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNT 1639
            L  +FY+++RR +S + ++ +    P  + G   E+ +    F+E   K+    G   + FV  +    P +VI D +L++ V++K+F  F+ R L   Q +P  D     ++FFAR   W+ LR+ I+P F+  K+++M PL+     V + K  ++S + + S   +++ D+  R T D+I    FG+E N   +    F    +A    T    +  A++   P + S     + R      +   F  IRS++  ++  R+++ EKR DL+ +LL  +                       +E   N   P   SK++  + ++  A +F  AG++TS+  M+  L+ LA N   Q++L  EI + F + +  +      Y+ I ++PYL+ V+ ETLR YP V  I       +EG   +    +   +P   +I ++  +VH D   W   DP  + PERF   N D     A      ++PFG GPRNCIG RL L+  KL L H++   R      T
Sbjct:   10 LTIVFYIWQRRTLSFWERHGVKYIRPFPVVGCTREFLTAKVPFFEQIQKFHEAPGFENEPFVGVYMTHRPALVIRDLELIKTVMIKKFQYFNNRVL---QTDPHNDALGYKNLFFARSPGWRELRTKISPVFTSGKIKQMYPLM-----VKIGKNLQDSAERLGSGTEVQVKDLCSRFTTDLIATIAFGVEANALQDAKSEFFYHNRAIFSLTLSRGIDFAIIFMIPALAS-----LARVKLFSRETTKF--IRSSVNYVLKERERTGEKRNDLIDILLALK-----------------------REAAAN---PGKMSKEVDLDYLVAQAAVFQTAGFETSASTMTMTLYELAKNEALQDRLRQEIVDFFGDEDHIS------YERIQEMPYLSQVVNETLRKYPIVGYIERECSQPAEGERFTLEPFHNMELPHGMSIYMSTVAVHRDPQYWP--DPEKYDPERFNSSNRDNLNMDA------YMPFGVGPRNCIGMRLGLLQSKLGLVHILRNHRFHTCDKT 479          
BLAST of Cytochrome P450 vs. Ensembl Zebrafish
Match: tbxas1 (thromboxane A synthase 1 (platelet) [Source:ZFIN;Acc:ZDB-GENE-030131-8805])

HSP 1 Score: 244.973 bits (624), Expect = 3.772e-73
Identity = 175/546 (32.05%), Postives = 279/546 (51.10%), Query Frame = 2
Query:  125 YVYRRRKISLFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQFSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKL--HEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMM-----ERFNSGISQKIN-FLKIRSTLLQIINARKKSSEKRFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNS-------KQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGIRERK 1717
            Y Y     S   +  I  P P    GNL+ +R+  F++  A    KYG++  Y+ G    V+I DPD+L+ V+VK+F+ F  R        P  D   S+   +G++WKR+RS + P FS +KM+ M+PLI  + + L+  L  H ES+    S  I       TMD+I    FG + + Q N +DPF+     F   + F  + M   + FP +  +   ++     +  NS  +Q I   +K R  L           ++R D LQL+LD   T+KK +   ++E  +++   DE+    +   P   S       + +T +E++G + +F+ AGY+TSS  +++  + LAV+ + Q KL  E+DE F   E  +      Y ++ +L YL+ VI E+LR YP       R+    E   + NGQ++PK  ++ +    +H+D + W   +P  F PERF        E  A  +P ++LPFG GPR+C+G RLA + IK+ L H+  +F +   ++TE PL+LK  TT+ P NGV + I ER+
Sbjct:   33 YWYSISPFSNLERCGIKHPKPLPFIGNLMMFRNG-FFKSQADLINKYGRICGYYIGRRSTVIIADPDMLRQVMVKEFNKFPNRMTARGITKPMSD---SLIMLKGEQWKRVRSILTPTFSAAKMKEMVPLINTATETLLRNLKSHAESEN---SFNIHKCFGCFTMDVIASVAFGTQVDSQNNPDDPFVHQASKFFAFSFFRPI-MIFFMAFPFLLRLLAGLLPNKSRDEMNSFFTQCIQKMIKQRDDL--------SPEQRRKDFLQLMLDVR-TNKKFL---SVEHFDVVNDADEEAYDGHENSPANESTKRSQQKRMMTEDEIVGQSFIFLVAGYETSSNTLAFTCYLLAVHPECQKKLQEEVDEFFSRHETVD------YANVQELKYLDMVICESLRLYPPAF----RVARDVEEDTVLNGQFLPKGASLEIPTGFLHYDPEHWT--EPTKFIPERFTP------EAKARRHPFVYLPFGAGPRSCVGMRLAQLEIKVALVHIFRRFNVLACEDTEIPLELKSHTTLGPKNGVMVKITERE 540          
BLAST of Cytochrome P450 vs. Ensembl Zebrafish
Match: cyp3c3 (cytochrome P450, family 3, subfamily c, polypeptide 3 [Source:ZFIN;Acc:ZDB-GENE-041114-102])

HSP 1 Score: 218.009 bits (554), Expect = 2.009e-63
Identity = 154/524 (29.39%), Postives = 267/524 (50.95%), Query Frame = 2
Query:   95 SLVAFLFTLFYVYRRRKISLFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQ-FSNFHGRKLFPFQ-KNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYM-MERFNSGISQKINFLKIRSTLLQIINARKKSSEKRFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQL 1657
            +LV  + TL Y+Y       F +  I GP P   FG  + Y +  F+    +  +KYGKV+  ++G  P +++ D ++++ ++VK+ +S F  R+        P  D  +++   + +RWKR+R T++P F+  +++ + P+     D  +  + +  + H + ++I +V+   ++D++    F ++ +   N +DPF+ ++K FL  + FS L + L L FP I ++   M +  F+  I   +NF     T L+ I    K S  R D L+L++ +++ D +  D  +           E+ +K            LT  E++  + +F+  GY+T+S  +S++LH+LA N D   KL  EID+ F      +      YD+++K+ YL   I E++R  P  +  + R+C K   T   NG  IPKDT + +  + ++ D  LW    P  F PERF   N  E+   A      ++PFG GPRNCIG R ALMI+KL +  L+  F +   + T+ PL+L
Sbjct:   12 TLVFLVITLLYMYGVWPHGFFKKLGIPGPRPWPFFGTFLSY-TKGFFNFDMECAKKYGKVWGIYDGRLPILMVTDLEMIKTIMVKECYSTFTNRREVNVDLAGPLADGISAV---KDERWKRIRGTLSPYFTSGRLKEIFPIAMTHADRFIKNMQK--RDHEQPVKIKEVVAPYSLDVVTSSSFSVDIDSINNPDDPFVTNIKNFLKFSLFSPLILFLTL-FPSIANLLGKMGISVFSRSI---MNFF---YTALRKIKDEHKDSNGRVDFLRLMIQNQIPDDQAKDTTS-----------EQPVK-----------GLTDHEILSQSFIFILGGYETTSTTLSFLLHNLATNPDCLEKLVEEIDKNFPLDTPIS------YDALMKMDYLEMSINESMRLLP-TAPRLERVCKK---TVELNGITIPKDTLVAIPTYVLNRDPQLW--DSPQEFRPERFSPENKSEFLQYA------FMPFGLGPRNCIGMRFALMIVKLLVVKLLQNFSLETCKETQIPLEL 482          
BLAST of Cytochrome P450 vs. Ensembl Zebrafish
Match: cyp3a65 (cytochrome P450, family 3, subfamily A, polypeptide 65 [Source:ZFIN;Acc:ZDB-GENE-050604-1])

HSP 1 Score: 209.149 bits (531), Expect = 6.057e-60
Identity = 148/540 (27.41%), Postives = 267/540 (49.44%), Query Frame = 2
Query:  155 FSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQ-FSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLT--FPEIK--------SIFIYMMERFNSGISQKINFLKIRSTLLQIINARKKSSEKRFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGIRERKI*RLRFIC 1741
            F +  I GP     FG ++ Y+   F+        KYG+++  ++G  P + I D  +++ VL+K+ +S F  R+   F+ N    +  S+  A    W+R+RS ++P+F+  +++ M  ++++   +L+  + + +++  ES +I +     +MD++    F ++ +   N  DPF+ ++K  L    F  L    LL   FP +         ++F   +  F     QKI   +   T+       K +++KR D LQL++DS+   K   D    E                        K L+  E++  + +F+FAGY+TSS  +S++ ++LA N +   KL  EIDE F      +      Y++++ + YL+A + E+LR YP V+  + R+C K   T   NG  IPKD  ++V  +++H D D W   +P  F PERF + N +        +P +++PFG GPRNCIG R A + +KL +  ++ +F ++    T+ PL+L     + P + + L ++ RK+ +   +C
Sbjct:   29 FKKLGIPGPKTIPFFGTMLRYKDG-FHVFDMDCFEKYGRIWGIYDGRQPVLCIMDQTIIKTVLIKECYSLFTNRR--NFRLNGALYDAVSI--AEDDDWRRIRSVLSPSFTSGRLKEMFGIMKKHSHILVDSMGKTAKRG-ESADIKEFFGAYSMDVVTSTAFSVDIDSLNNPKDPFVTNIKKML---KFDLLNPLFLLIAFFPFMAPVLEKMDFALFPTSVTDFFYAALQKIKSDRDTKTVA------KDNTKKRVDFLQLMVDSQTGVKHKSDGEHTE------------------------KGLSDHEILSQSMIFIFAGYETSSSTLSFLFYNLATNPETMKKLQEEIDETFPNQAPVD------YETLMSMDYLDAALSESLRLYP-VAARLERVCKK---TVEINGLLIPKDLVVMVPTYALHRDPDYWS--EPESFKPERFTKGNKES------IDPYMYMPFGLGPRNCIGMRFAQVTMKLAIVEILQRFDVSVCDETQVPLELGFNGLLSPKDPIKLKLQPRKLSQSPDVC 511          
BLAST of Cytochrome P450 vs. Ensembl Zebrafish
Match: cyp3c3 (cytochrome P450, family 3, subfamily c, polypeptide 3 [Source:ZFIN;Acc:ZDB-GENE-041114-102])

HSP 1 Score: 197.593 bits (501), Expect = 7.080e-56
Identity = 144/513 (28.07%), Postives = 252/513 (49.12%), Query Frame = 2
Query:  125 YVYRRRKISLFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQ-FSNFHGRKLFPFQ-KNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGISQKINFLKIRSTLLQIINARKKSSEKRFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQL 1657
            Y+Y       F +  I GP P   FG  + Y +  F+    +  +KYGKV+  ++G  P +++ D ++++ ++VK+ +S F  R+        P  D   ++   + +RWKR+R T++P F+  +++ + P+     D  +  + +    H + ++I +VM   ++D++    F ++ +   N +DPF+ ++K FL   N   L + LL  FP I ++   M     S  +    +  +R      I    K S  R D  +L++ +E+ D ++ D  +                      +   K LT  E++  + +F+  GY+T+S  ++++L++LA+N D   KL  +ID+ F      +      YD+++K+ YL   I E++R  P  +  + R+C K   T   NG  IPKDT I +  + ++ D  LW    PH F PERF   N  E+   A      ++PFG GPRNCIG R ALMI+KL +  L+  F +   + T+ PL+L
Sbjct:   22 YMYGVWPHGFFKKLGIPGPRPWPFFGTFLSY-TKGFFNFDMECAKKYGKVWGIYDGRLPILMVTDLEMIKTIMVKECYSTFTNRREINVDLAGPLADGITAV---KDERWKRIRGTLSPYFTSGRLKEIFPIAMTHADRFIKNMQKGD--HEQPVKIKEVMASYSLDVVTSSAFSVDIDSINNPDDPFVTNIKNFLK-FNLFGLFVLLLTVFPSIANLLGKMGLSMFSKPTVDFFYKALRK-----IKEEHKDSNGRVDFFRLMIQNEIPDDQVKDTTS----------------------EQPEKGLTDHEILSQSFIFIMGGYETTSTTLTFLLYNLAINPDCLEKLVEKIDKNFPLDTPIS------YDALMKIDYLEMSINESMRLLP-TAPRLERVCKK---TVEMNGITIPKDTMITIPTYVLNQDPQLW--DSPHEFRPERFSPENKSEFLQYA------FMPFGLGPRNCIGMRYALMIVKLLVVKLLQNFSVETCKETQIPLEL 482          
BLAST of Cytochrome P450 vs. Ensembl Zebrafish
Match: cyp3c3 (cytochrome P450, family 3, subfamily c, polypeptide 3 [Source:ZFIN;Acc:ZDB-GENE-041114-102])

HSP 1 Score: 196.052 bits (497), Expect = 1.844e-55
Identity = 142/505 (28.12%), Postives = 249/505 (49.31%), Query Frame = 2
Query:  149 SLFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQ-FSNFHGRKLFPFQ-KNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGISQKINFLKIRSTLLQIINARKKSSEKRFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQL 1657
              F +  I GP P   FG  + Y +  F+    +  +KYGKV+  ++G  P +++ D ++++ ++VK+ +S F  R+        P  D   ++   + +RWKR+R T++P F+  +++ + P+     D  +  + +    H + ++I +VM   ++D++    F ++ +   N +DPF+ ++K FL   N   L + LL  FP I ++   M     S  +    +  +R      I    K S  R D  +L++ +E+ D ++ D  +                      +   K LT  E++  + +F+  GY+T+S  ++++L++LA+N D   KL  +ID+ F      +      YD+++K+ YL   I E++R  P  +  + R+C K   T   NG  IPKDT I +  + ++ D  LW    PH F PERF   N  E+   A      ++PFG GPRNCIG R ALMI+KL +  L+  F +   + T+ PL+L
Sbjct:    9 GFFKKLGIPGPRPWPFFGTFLSY-TKGFFNFDMECAKKYGKVWGIYDGRLPILMVTDLEMIKTIMVKECYSTFTNRREINVDLAGPLADGITAV---KDERWKRIRGTLSPYFTSGRLKEIFPIAMTHADRFIKNMQKGD--HEQPVKIKEVMASYSLDVVTSSAFSVDIDSINNPDDPFVTNIKNFLK-FNLFGLFVLLLTVFPSIANLLGKMGLSMFSKPTVDFFYKALRK-----IKEEHKDSNGRVDFFRLMIQNEIPDDQVKDTTS----------------------EQPEKGLTDHEILSQSFIFIMGGYETTSTTLTFLLYNLAINPDCLEKLVEKIDKNFPLDTPIS------YDALMKIDYLEMSINESMRLLP-TAPRLERVCKK---TVEMNGITIPKDTMITIPTYVLNQDPQLW--DSPHEFRPERFSPENKSEFLQYA------FMPFGLGPRNCIGMRYALMIVKLLVVKLLQNFSVETCKETQIPLEL 461          
BLAST of Cytochrome P450 vs. Ensembl Xenopus
Match: cyp3a5 (cytochrome P450 3A29-like [Source:NCBI gene;Acc:100487054])

HSP 1 Score: 213.001 bits (541), Expect = 1.847e-61
Identity = 147/509 (28.88%), Postives = 260/509 (51.08%), Query Frame = 2
Query:  152 LFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQ-FSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFN-SGISQKI-NFLKIRSTLLQIINARKKSS-EKRFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFL---QINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQL 1657
            LF +Y I GP P    G  +  R  +  E   +  +KYGKV+  +EG  P + I DP +++ ++VK+ ++NF  R+ F          K+S+  ++ ++WKR+R+ ++P F+  K+++M PL+    ++L+  +H++     E +++  +    +MDI+    F +  +   N NDPF+ + +     + F+ L +  +L         + ++++ N   +S KI NF K    +  I   R+K + E R D LQL++D++  + K + E                        K   K+L+  E++  + +F+ AGY+T+S  + ++ +++A + D Q KL  EID +              YD+++K+ Y++ VI E+LR +P    I +R+C K   T   NG  IP    I+V + ++H + ++W   +P  F PERF    Q N D Y F         LPFG GPRNCIG R AL+ +K+ L+ L+  FR+   ++T  PL++
Sbjct:   24 LFKRYGIPGPTPIPFIGTFLGNRHGLM-EFDMECFKKYGKVWGIYEGQKPLLAIVDPVIIKSIMVKECYTNFTNRRDFGLSG----PLKSSVLISKDEQWKRIRTVLSPTFTSGKLKQMFPLMNHYGELLVKNIHKKINNK-EPLDMKHIFGSYSMDIVLSTSFSVNVDSMNNPNDPFVTNARNLFTFSFFNPLFLISILC-----PFLVPLLDKMNFCFLSLKILNFFK--DAVASIKKKRQKGTHEDRVDFLQLMVDAQSNEGKSVPEEE----------------------KHGYKELSDTEILAQSLIFIMAGYETTSTTLMFLAYNIATHPDVQRKLEEEIDALLPNKAPPT------YDALMKMEYMDMVINESLRMFPPAIRI-DRVCKK---TMEINGVTIPAGVVIVVPLFALHLNPEIW--PEPEEFQPERFSKENQKNQDPYNF---------LPFGVGPRNCIGMRFALVNMKVALTILLQNFRLETCKDTPVPLKI 476          
BLAST of Cytochrome P450 vs. Ensembl Xenopus
Match: cyp3a5 (cytochrome P450 3A29-like [Source:NCBI gene;Acc:100487054])

HSP 1 Score: 213.001 bits (541), Expect = 2.300e-61
Identity = 150/525 (28.57%), Postives = 264/525 (50.29%), Query Frame = 2
Query:  152 LFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQ-FSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFN-SGISQKI-NFLKIRSTLLQIINARKKSS-EKRFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFL---QINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGI 1705
            LF +Y I GP P    G  +  R  +  E   +  +KYGKV+  +EG  P + I DP +++ +++K+ +SNF  R+            K+S+  ++ ++WKR+R+ ++P F+  K+++M PL++   ++L+  +H++     E +++  +    +MDI+    F +  +   N NDPF+ + +     + F+ L +  +L         + ++++ N   +S KI NF K    +  I   R+K + E R DLLQL++D++  + + + E                        K   K+L+  E++  + +F+ AGY+T+S  + ++ +++A + D Q KL  EID +              YD+++K+ Y++ VI ETLR +P    I +R+C K   T   NG  IP    I+V +  +H + ++W   +P  F PERF    Q N D Y F         LPFG GPRNCIG R AL+ +KL L+ L+  FR    ++T  PL++     + P   + L +
Sbjct:   32 LFKRYGIPGPTPIPFIGTFLGNRKGLM-EFDMECFKKYGKVWGIYEGQKPLLAIVDPVIIKSIMIKECYSNFTNRRDLGLTG----PLKSSVLVSKDEQWKRIRTVLSPTFTSGKLKQMFPLMKHYGELLVKNIHKKIDNK-EPLDMKHIFGSYSMDIVLSTSFSVNVDSMNNPNDPFVTNARNLFKFSFFNPLFLIAILC-----PFLVPLLDKMNFCFLSLKILNFFK--DAVASIKKKRQKGTHEDRVDLLQLMVDAQSNEGESVPEEE----------------------KHGYKELSDTEILAQSLIFIMAGYETTSTTLMFLAYNIATHPDVQRKLEEEIDALLPNKAPPT------YDALMKMEYMDMVINETLRMFPPAIRI-DRVCKK---TMEINGVTIPAGVVIVVPLFVLHLNPEIW--PEPEEFQPERFSKENQKNQDPYNF---------LPFGVGPRNCIGMRFALVNMKLVLTILLQNFRFETCKDTPVPLKICTDGYLKPTKPIILNL 500          
BLAST of Cytochrome P450 vs. Ensembl Xenopus
Match: ENSXETT00000012846.1 (cytochrome P450 3A8-like [Source:NCBI gene;Acc:100487846])

HSP 1 Score: 210.305 bits (534), Expect = 2.371e-60
Identity = 149/525 (28.38%), Postives = 263/525 (50.10%), Query Frame = 2
Query:  152 LFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQ-FSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFN-SGISQKINFLKI-RSTLLQIINARKKSSE-KRFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFL---QINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGI 1705
            LF +Y I GP P    G  +  R  +  E   K  +KYG V+ +++GP P + I DP +++ ++VK+ ++NF  R+ F          K+S+  ++ ++WKR+R+ ++P F+  K+++M PL++   ++L+  +H++     E +++  +    +MD I    F +  +   N NDPF+ + +       FS  K   L+T   +    + ++++ N   +S K  FLK  +  +  I   R+K +   R D LQL++D++  + + + E                        K   K+L+  E++  + +F+ AGY+T+S  + ++ +++A   D Q KL  EI+ +              YD+++K+ Y++ VI ETLR  P    I +R+C K   T   NG  IP    I+V + ++H + ++W   +P  F PERF    Q N D Y F         LPFG GPRNCIG R AL+ IKL L+ L+  F++   ++T  PL++     + P   + L +
Sbjct:   32 LFKRYGIPGPTPIPFIGTFLGNRHGLM-EFDMKCFKKYGNVWGFYDGPQPVLAILDPVIIKSIMVKECYTNFTNRRDFGLSG----PLKSSVLMSKDEQWKRIRTVLSPTFTSGKLKQMFPLMKHYGELLVKNIHKKIDNK-EPLDMKSIFGSYSMDTILSTSFSVNVDSMNNPNDPFVTNARNLF---TFSFFKPLFLITI--LCPFLVPLLDKMNFCFLSSK--FLKFFKDAVASIKKKRQKGAHMDRVDFLQLMVDAQSNEGESVPEEE----------------------KHRHKELSDTEILAQSLIFIMAGYETTSTTLMFLTYNIARYPDVQRKLEEEINTLLPNKAPPT------YDALMKMEYMDMVINETLRLLPPAIRI-DRVCKK---TMEINGVTIPAGVVIVVPLFALHLNPEIWP--EPEEFQPERFSKENQKNQDPYNF---------LPFGVGPRNCIGMRFALVNIKLALTILLQNFKLETCKDTPVPLKVCTRGNLKPTKPIILNL 500          
BLAST of Cytochrome P450 vs. Ensembl Xenopus
Match: cyp3a5 (cytochrome P450 3A29-like [Source:NCBI gene;Acc:100487054])

HSP 1 Score: 209.149 bits (531), Expect = 6.377e-60
Identity = 145/503 (28.83%), Postives = 256/503 (50.89%), Query Frame = 2
Query:  152 LFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQ-FSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFN-SGISQKI-NFLKIRSTLLQIINARKKSS-EKRFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFL---QINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNT 1639
            LF +Y I GP P    G  +  R  +  E   +  +KYGKV+  +EG  P + I DP +++ ++VK+ ++NF  R+ F          K+S+  ++ ++WKR+R+ ++P F+  K+++M PL+    ++L+  +H++     E +++  +    +MDI+    F +  +   N NDPF+ + +     + F+ L +  +L         + ++++ N   +S KI NF K    +  I   R+K + E R D LQL++D++  + K + E                        K   K+L+  E++  + +F+ AGY+T+S  + ++ +++A + D Q KL  EID +              YD+++K+ Y++ VI E+LR +P    I +R+C K   T   NG  IP    I+V + ++H + ++W   +P  F PERF    Q N D Y F         LPFG GPRNCIG R AL+ +K+ L+ L+  FR+   ++T
Sbjct:   24 LFKRYGIPGPTPIPFIGTFLGNRHGLM-EFDMECFKKYGKVWGIYEGQKPLLAIVDPVIIKSIMVKECYTNFTNRRDFGLSG----PLKSSVLISKDEQWKRIRTVLSPTFTSGKLKQMFPLMNHYGELLVKNIHKKINNK-EPLDMKHIFGSYSMDIVLSTSFSVNVDSMNNPNDPFVTNARNLFTFSFFNPLFLISILC-----PFLVPLLDKMNFCFLSLKILNFFK--DAVASIKKKRQKGTHEDRVDFLQLMVDAQSNEGKSVPEEE----------------------KHGYKELSDTEILAQSLIFIMAGYETTSTTLMFLAYNIATHPDVQRKLEEEIDALLPNKAPPT------YDALMKMEYMDMVINESLRMFPPAIRI-DRVCKK---TMEINGVTIPAGVVIVVPLFALHLNPEIWP--EPEEFQPERFSKENQKNQDPYNF---------LPFGVGPRNCIGMRFALVNMKVALTILLQNFRLETCKDT 470          
BLAST of Cytochrome P450 vs. Ensembl Xenopus
Match: ndrg3 (NDRG family member 3 [Source:Xenbase;Acc:XB-GENE-5757269])

HSP 1 Score: 207.223 bits (526), Expect = 2.053e-59
Identity = 150/524 (28.63%), Postives = 254/524 (48.47%), Query Frame = 2
Query:  149 SLFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQ-FSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIF-IYMMERFNSGISQKINFLKIRSTLLQIINARKKSSEKRFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGIRER 1714
             LF +  I GP P    G  +E+R  +  +   +  +KYG+++  ++G  P + I DP +++ +LVK+ ++NF  R+ F     P E   +++  A  ++WKR+RS ++P F+  K++ M  +++   D+L+  +     K  E     DV+   +MD+I    F +  +   N ++PF++ +K  L  T F S  +   + FP ++ IF +  +  F    +Q   F+   ++  +    +K     R DLLQL++DS  T+         +SSN                     K LT  E++  + +F+FAGY+T+S A+SY+ ++LA + D Q KL  EID    +           YD ++++ YL+ VI ETLR +P       R+   S+     NG  IPK T  ++  + +  D + W   +P  F PERF + N       A   P  +LPFG GPRNCIG R AL+ +K+ ++ L+  F + P   T  P++      + P   + L    R
Sbjct:    9 GLFKKMGIPGPTPLPFIGTFLEFRKGMI-QFDIECFKKYGRMWGMYDGRQPVLAIMDPAIIKTILVKECYTNFTNRRNFGLN-GPLE---SAITVAEDEQWKRIRSVLSPTFTSGKLKEMFQIMKDYSDILVKNVQVSVDKD-EPCATKDVIGAYSMDVITSTSFSVNIDSLQNPSNPFVIHIKNLLK-TGFLSPVIIFAVIFPFLRPIFEVLNISFFPKDFTQ--FFMNAVTSFRE--KRKKGDHSGRVDLLQLMVDSGTTEGN-------DSSN-------------------QHKALTDAEIMAQSLIFIFAGYETTSTALSYLFYNLATHPDVQQKLHEEIDSFLPDKASPT------YDILMQMEYLDMVIQETLRLFP----PAGRLERVSKQNVEINGVSIPKGTVAMIPAYVLQRDPEYW--PEPEEFRPERFSKENR------ATQTPFTFLPFGDGPRNCIGLRFALLSMKVAIATLLQNFSVRPCAETLIPMEFSTIGVLQPKKPIVLKFLSR 477          
BLAST of Cytochrome P450 vs. Ensembl Mouse
Match: Cyp3a11 (cytochrome P450, family 3, subfamily a, polypeptide 11 [Source:MGI Symbol;Acc:MGI:88609])

HSP 1 Score: 248.054 bits (632), Expect = 1.260e-74
Identity = 164/541 (30.31%), Postives = 272/541 (50.28%), Query Frame = 2
Query:   98 LVAFLFTLFYVYRRRKISLFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQ-FSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGISQKINFLKIRSTLLQIINARKKSSEK-RFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGIRER 1714
            L+A    L Y Y  RK  LF +  I GP P    G ++ Y   + ++   +  +KYGK +  F+G TP + + DP+ +++VLVK+ FS F  R+ F     P      ++  ++   WKR R+ ++P F+  K++ M P+IEQ  D+L+  L ++++K  + + + DV+   +MD+I    FG+  +   N  DPF+   K  L    F  L  +++L FP +  ++    E  N  +  K +    +  + ++  +R  S +K R D LQL+++S    K                             K++ K L+  E+   + +F+FAGY+T+S  +S+ LHSLA + D Q KL  EIDE               YD+++++ YL+ V+ ETLR YP ++  + R+C K       NG YIPK + +++  +++H D   W   +P  F PERF + N          +P ++LPFG GPRNC+G R ALM +KL L+ ++  F   P + T+ PL+L     + P   + L +  R
Sbjct:   14 LLAISLVLLYRYGTRKHELFKKQGIPGPKPLPFLGTVLNYYKGL-WKFDMECYKKYGKTWGLFDGQTPLLAVTDPETIKNVLVKECFSVFTNRRDF----GPVGIMSKAISISKDDEWKRYRALLSPTFTSGKLKEMFPVIEQYGDILVKYLRQKAKKG-KPVTMKDVLGAYSMDVITSTSFGVNVDSLNNPEDPFVEKAKKLLRFDFFDPLLFSVVL-FPFLTPVY----EMLNICMFPKDSIEFFKKFVDRMKESRLDSKQKHRVDFLQLMMNSHNNSKD----------------------------KVSHKALSDMEITAQSIIFIFAGYETTSSTLSFTLHSLATHPDIQKKLQDEIDEALPNKAPPT------YDTVMEMEYLDMVLNETLRLYP-IANRLERVCKKDVEL---NGVYIPKGSTVMIPSYALHHDPQHWS--EPEEFQPERFSKENK------GSIDPYVYLPFGNGPRNCLGMRFALMNMKLALTKIMQNFSFQPCKETQIPLKLSRQGLLQPEKPIVLKVVPR 497          
BLAST of Cytochrome P450 vs. Ensembl Mouse
Match: Cyp3a13 (cytochrome P450, family 3, subfamily a, polypeptide 13 [Source:MGI Symbol;Acc:MGI:88610])

HSP 1 Score: 238.424 bits (607), Expect = 4.696e-71
Identity = 160/541 (29.57%), Postives = 270/541 (49.91%), Query Frame = 2
Query:   98 LVAFLFTLFYVYRRRKISLFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQ-FSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGISQKINFLKIRSTLLQIINARKKSSEK-RFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGIRER 1714
            L+A    L Y+Y      +F +  I GP P    G ++ Y+   F+E   +  +KYGK++  ++G  P + I DPD+++ VLVK+ +S F  R+ F     P    K ++  +  + WKR+R+ ++P F+  +++ M P+I Q  DVL+  + +   +  +   + D+    +MD+I    FG+  +   N  DPF+  +K  L    F  L +++ L FP +  +F    +  N  +  +       +++ ++   R K  EK R D LQL+++S+                          KT     K + K L+  E++  + +F+FAGY+T+S A+S+ L+ LA++ D Q KL  EID                YD+++++ YL+ V+ ETLR YP ++  + R+C         NG +IPK T +++   ++H D   W   +P  F PERF + N D        NP ++LPFG GPRNCIG R AL+ +K+ L  ++  F + P + TE PL+L     + P N + L +  R
Sbjct:   14 LLATSLVLLYLYGTHSHGIFKKLGIPGPKPLPFLGTILAYQKG-FWECDIQCHKKYGKMWGLYDGRQPVLAITDPDIIKTVLVKECYSTFTNRRRF----GPVGILKKAISISENEEWKRIRALLSPTFTSGRLKEMFPIINQFTDVLVRNMRQGLGEG-KPTSMKDIFGAYSMDVITATSFGVNIDSLNNPQDPFVEKIKKLLKFDIFDPLFLSVTL-FPFLTPVF----DALNVSLFPRDVISFFTTSVERMKENRMKEKEKQRVDFLQLMINSQ------------------------NYKT-----KESHKALSDVEIVAQSVIFIFAGYETTSSALSFALYLLAIHPDVQKKLQDEIDAALPNKAPAT------YDTLLQMEYLDMVVNETLRLYP-IAGRLERVCKTDVEI---NGLFIPKGTVVMIPTFALHKDPKYW--PEPEEFRPERFSKKNQDS------INPYMYLPFGSGPRNCIGMRFALINMKVALVRVLQNFTVQPCKETEIPLKLSKQGLLQPENPLLLKVVSR 496          
BLAST of Cytochrome P450 vs. Ensembl Mouse
Match: Cyp3a41a (cytochrome P450, family 3, subfamily a, polypeptide 41A [Source:MGI Symbol;Acc:MGI:1858451])

HSP 1 Score: 234.187 bits (596), Expect = 2.205e-69
Identity = 158/534 (29.59%), Postives = 263/534 (49.25%), Query Frame = 2
Query:  125 YVYRRRKISLFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQ-FSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGISQKINFLKIRSTLLQIINARKKSSEK-RFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGIRERKI 1720
            Y Y  R   LF +  I GP P    G ++ Y   + ++   +   KYGK +  F+G  P  VI DP+++++VLVK+ FS F  R+ F     P      ++  ++ + WKR R+ ++P F+  K++ M P+IEQ  D+L+  L +E++K  + + + DV+   ++D+I    FG+  +   N  DPF+   K  L    F  L  +++L FP +  ++    E  N  +  K +    +  + ++  +R  S +K R D LQL++++    K                             K + K L+  E+   + +F+FAGY+T+S  +S+ L+ LA + D Q KL  EIDE               YD+++++ YL+ V+ ETLR YP +   + R C K       NG YIPK + +++  +++H D   W   +P  F PERF + N          +P +++PFG GPRNCIG R A M +KL L+ ++  F   P Q T+ PL+L     + P   + L +  R +
Sbjct:   23 YRYGTRTHGLFKKQGIPGPKPLPFLGTVLNYYKGL-WKFDMECYEKYGKTWGLFDGQMPLFVITDPEMIKNVLVKECFSVFTNRREF----GPVGIMSKAISISKDEEWKRYRALLSPTFTSGKLKEMFPVIEQYGDILVKYLMQEAEKG-KPVTMKDVLGAYSIDVITSTSFGVNVDSLNNPEDPFVEKAKGILRVDFFDPLVFSVVL-FPFLTPVY----EMLNICMFPKDSIEFFKKFVNRMKESRLDSKQKHRVDFLQLMMNAHNNSKD----------------------------KDSHKALSDMEITAQSIVFIFAGYETTSSTLSFTLYCLATHPDIQKKLQEEIDETLPNKAPPT------YDTVMEMEYLDMVLNETLRLYP-IGNRLERFCKKDVEL---NGVYIPKGSTVMIPSYALHHDPQHW--PEPEEFQPERFSKENK------GSIDPYLYMPFGIGPRNCIGMRFAFMTMKLALTKVMQNFSFQPCQETQIPLKLSRQGLLQPEKPIVLKVVPRDV 499          
BLAST of Cytochrome P450 vs. Ensembl Mouse
Match: Cyp3a41b (cytochrome P450, family 3, subfamily a, polypeptide 41B [Source:MGI Symbol;Acc:MGI:3714859])

HSP 1 Score: 234.187 bits (596), Expect = 2.205e-69
Identity = 158/534 (29.59%), Postives = 263/534 (49.25%), Query Frame = 2
Query:  125 YVYRRRKISLFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQ-FSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGISQKINFLKIRSTLLQIINARKKSSEK-RFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGIRERKI 1720
            Y Y  R   LF +  I GP P    G ++ Y   + ++   +   KYGK +  F+G  P  VI DP+++++VLVK+ FS F  R+ F     P      ++  ++ + WKR R+ ++P F+  K++ M P+IEQ  D+L+  L +E++K  + + + DV+   ++D+I    FG+  +   N  DPF+   K  L    F  L  +++L FP +  ++    E  N  +  K +    +  + ++  +R  S +K R D LQL++++    K                             K + K L+  E+   + +F+FAGY+T+S  +S+ L+ LA + D Q KL  EIDE               YD+++++ YL+ V+ ETLR YP +   + R C K       NG YIPK + +++  +++H D   W   +P  F PERF + N          +P +++PFG GPRNCIG R A M +KL L+ ++  F   P Q T+ PL+L     + P   + L +  R +
Sbjct:   23 YRYGTRTHGLFKKQGIPGPKPLPFLGTVLNYYKGL-WKFDMECYEKYGKTWGLFDGQMPLFVITDPEMIKNVLVKECFSVFTNRREF----GPVGIMSKAISISKDEEWKRYRALLSPTFTSGKLKEMFPVIEQYGDILVKYLMQEAEKG-KPVTMKDVLGAYSIDVITSTSFGVNVDSLNNPEDPFVEKAKGILRVDFFDPLVFSVVL-FPFLTPVY----EMLNICMFPKDSIEFFKKFVNRMKESRLDSKQKHRVDFLQLMMNAHNNSKD----------------------------KDSHKALSDMEITAQSIVFIFAGYETTSSTLSFTLYCLATHPDIQKKLQEEIDETLPNKAPPT------YDTVMEMEYLDMVLNETLRLYP-IGNRLERFCKKDVEL---NGVYIPKGSTVMIPSYALHHDPQHW--PEPEEFQPERFSKENK------GSIDPYLYMPFGIGPRNCIGMRFAFMTMKLALTKVMQNFSFQPCQETQIPLKLSRQGLLQPEKPIVLKVVPRDV 499          
BLAST of Cytochrome P450 vs. Ensembl Mouse
Match: Cyp3a25 (cytochrome P450, family 3, subfamily a, polypeptide 25 [Source:MGI Symbol;Acc:MGI:1930638])

HSP 1 Score: 233.032 bits (593), Expect = 5.282e-69
Identity = 159/536 (29.66%), Postives = 263/536 (49.07%), Query Frame = 2
Query:  113 FTLFYVYRRRKISLFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQ-FSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGISQKINFLKIRSTLLQIINARKKSSEK-RFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGIRER 1714
              LFY+Y      LF +  I GP P  + G +  Y   + ++      +KYGK++ ++EGP P + I DP++++ VLVK+ +S F  R+ F     P    K ++  +  + WKRLR+ ++P F+  K++ M P++ Q  D+L+  L  E +K  E I + D+    +MD+I    FG+  +   N  DPF+   K  L    F    ++++L FP +  I  Y M  F+      +NF K    + ++   R  S++K R D LQL+++++       +    ES                       K L+  E+   A +F+F GYD +S ++S I++ LA + D Q KL  EID                YD+++ + YL+ V+ E+LR YP    I  R+   S+     NG +IPK T +++ ++ +H + + W   +P  F PERF + N          +P I++PFG GPRNCIG R AL+ IKL +  ++  F + P + T+ PL++       P   + L +  R
Sbjct:   19 LVLFYIYGTYSHGLFKKLGIPGPKPLPLLGTIFNYYDGM-WKFDEDCYKKYGKIWGFYEGPQPILAIMDPEIIKIVLVKECYSVFTNRRFF----GPVGFMKKAITISEDEEWKRLRTLLSPTFTSGKLKEMFPIMRQYGDILVRNLRREEEKG-EPISMKDIFGAYSMDVITGTSFGVNVDSLNNPQDPFVQKAKKILKFKIFDPFLLSIIL-FPFLTPI--YEMLNFSIFPRDSMNFFK--KFVKRMKKERLASNQKNRVDFLQLMMNTQ-------NSKGQESQ----------------------KALSDLEMAAQAVIFIFGGYDATSTSISLIMYELATHPDVQKKLQDEIDRTLPNKAPVT------YDALMDMEYLDMVVNESLRLYP----IAIRLERVSKKDVEINGVFIPKGTVVMIPIYPLHRNPEYW--PEPQEFCPERFSKENKGN------IDPYIYMPFGNGPRNCIGMRFALISIKLAVIGVLQNFTVQPCEETQIPLKISREPIFQPEKPIILKVVSR 496          
BLAST of Cytochrome P450 vs. UniProt/SwissProt
Match: sp|Q29496|CP3AO_SHEEP (Cytochrome P450 3A24 OS=Ovis aries OX=9940 GN=CYP3A24 PE=2 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 2.882e-76
Identity = 172/541 (31.79%), Postives = 279/541 (51.57%), Query Frame = 2
Query:   98 LVAFLFTLFYVYRRRKISLFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQ-FSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGISQKINFLKIRSTLLQIINARKKSSEK-RFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGIRER 1714
            L+A    L Y+Y      LF +  + GP P   FGN++ YR  V  E   +  +KYGK++  FEG  P +VI DPD+++ VLVK+ +S F  R++F     P    K ++  A  ++WKR+R+ ++P F+  K++ M P+I +  DVL+  L +E++K  +S+ + D+    +MD+I    FG+  +   N  DPF+ + K  L         ++++L FP +  IF    E  N  +  K     +  ++ +I  +R K ++K R D LQL+++S         +N+ E+                     N K L+ +E++  + +F+FAGY+T+S  +S++L+ LA + D Q KL  EID  F             YD + ++ YL+ V+ ETLR +P ++  ++R+C K    H   G  IPK T + V +  +H D  LW   +P  F PERF + N D        NP ++LPFG GPRNCIG R A+M +KL +  ++  F   P + T+ PL++     I P   + L +  R
Sbjct:   14 LLAISLVLLYLYGTYSHGLFKKLGVSGPRPLPYFGNVLSYRKGV-CEFDEECFKKYGKMWGVFEGKQPLLVITDPDVIKTVLVKECYSVFTNRRVF----GPMGIMKNAVSVAEDEQWKRIRTLLSPTFTSGKLKDMFPIIGKYGDVLVRNLRKEAEKG-KSVNMKDIFGAYSMDVITSTSFGVNIDSLGNPQDPFVENAKKLLRFNILDPFLLSVVL-FPFLVPIF----EVLNITMFPKSAVDFLTKSVKRIKESRLKDNQKPRVDFLQLMINS---------QNSKETD--------------------NHKALSDQELMAQSVIFIFAGYETTSNTLSFLLYILATHPDVQQKLQEEIDATFPNKAPPT------YDVLAQMEYLDMVVNETLRMFP-IAVRLDRLCKKDVEIH---GVSIPKGTAVTVPIFVLHRDPQLW--PEPEEFRPERFSKKNKDS------INPYVYLPFGTGPRNCIGMRFAIMNMKLAIVRVLQNFSFKPCKETQIPLKINSQGLIRPEKPIFLKVVLR 496          
BLAST of Cytochrome P450 vs. UniProt/SwissProt
Match: sp|P11707|CP3A6_RABIT (Cytochrome P450 3A6 OS=Oryctolagus cuniculus OX=9986 GN=CYP3A6 PE=2 SV=2)

HSP 1 Score: 248.054 bits (632), Expect = 7.919e-74
Identity = 169/525 (32.19%), Postives = 278/525 (52.95%), Query Frame = 2
Query:  149 SLFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQ-FSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYM-MERFNSGISQKINFLKIRSTLLQIINARKKSSEKR-FDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGIRER 1714
             LF +  I GP P    G ++EYR  + ++   +  +KYGK++  F+G  P +VI DPD+++ VLVK+ +S F  R+ F     P    K ++  +  + WKR+R+ ++P F+  K++ MLP+I Q  DVL+  L +E++K  + +++ ++    +MD+I    FG+  +   N  DPF+ +++  L  + F  L +++ L FP +  IF  + +  F   +   ++FLK  +++ +I + R K  +KR  D LQL+++S+                     + KEI ++        K L   EV+  + + +FAGY+T+S  +S+I+H LA + D Q KL  EID +    E         YD++VK+ YL+ V+ ETLR YP ++  + R+C K       NG +IPK T +++  +++H D   W   +P  F PERF + N D        NP I+ PFG GPRNC+G R ALM IKL L  L+  F     + T+ PL+L     + P   + L +  R
Sbjct:   29 GLFKKMGIPGPTPLPFIGTILEYRKGI-WDFDIECRKKYGKMWGLFDGRQPLMVITDPDMIKTVLVKECYSVFTNRRSF----GPVGFMKKAVSISEDEDWKRVRTLLSPTFTSGKLKEMLPIIAQYGDVLVKNLRQEAEKG-KPVDLKEIFGAYSMDVITGTSFGVNIDSLRNPQDPFVKNVRRLLKFSFFDPLLLSITL-FPFLTPIFEALHISMFPKDV---MDFLK--TSVEKIKDDRLKDKQKRRVDFLQLMINSQ---------------------NSKEIDSH--------KALDDIEVVAQSIIILFAGYETTSSTLSFIMHLLATHPDVQQKLQEEIDTLLPNKELAT------YDTLVKMEYLDMVVNETLRLYP-IAGRLERVCKKDVDI---NGTFIPKGTIVMMPTYALHRDPQHW--TEPDEFRPERFSKKNKDN------INPYIYHPFGAGPRNCLGMRFALMNIKLALVRLMQNFSFKLCKETQVPLKLGKQGLLQPEKPIVLKVVSR 494          
BLAST of Cytochrome P450 vs. UniProt/SwissProt
Match: sp|Q64459|CP3AB_MOUSE (Cytochrome P450 3A11 OS=Mus musculus OX=10090 GN=Cyp3a11 PE=1 SV=1)

HSP 1 Score: 248.054 bits (632), Expect = 8.815e-74
Identity = 164/541 (30.31%), Postives = 272/541 (50.28%), Query Frame = 2
Query:   98 LVAFLFTLFYVYRRRKISLFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQ-FSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGISQKINFLKIRSTLLQIINARKKSSEK-RFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGIRER 1714
            L+A    L Y Y  RK  LF +  I GP P    G ++ Y   + ++   +  +KYGK +  F+G TP + + DP+ +++VLVK+ FS F  R+ F     P      ++  ++   WKR R+ ++P F+  K++ M P+IEQ  D+L+  L ++++K  + + + DV+   +MD+I    FG+  +   N  DPF+   K  L    F  L  +++L FP +  ++    E  N  +  K +    +  + ++  +R  S +K R D LQL+++S    K                             K++ K L+  E+   + +F+FAGY+T+S  +S+ LHSLA + D Q KL  EIDE               YD+++++ YL+ V+ ETLR YP ++  + R+C K       NG YIPK + +++  +++H D   W   +P  F PERF + N          +P ++LPFG GPRNC+G R ALM +KL L+ ++  F   P + T+ PL+L     + P   + L +  R
Sbjct:   14 LLAISLVLLYRYGTRKHELFKKQGIPGPKPLPFLGTVLNYYKGL-WKFDMECYKKYGKTWGLFDGQTPLLAVTDPETIKNVLVKECFSVFTNRRDF----GPVGIMSKAISISKDDEWKRYRALLSPTFTSGKLKEMFPVIEQYGDILVKYLRQKAKKG-KPVTMKDVLGAYSMDVITSTSFGVNVDSLNNPEDPFVEKAKKLLRFDFFDPLLFSVVL-FPFLTPVY----EMLNICMFPKDSIEFFKKFVDRMKESRLDSKQKHRVDFLQLMMNSHNNSKD----------------------------KVSHKALSDMEITAQSIIFIFAGYETTSSTLSFTLHSLATHPDIQKKLQDEIDEALPNKAPPT------YDTVMEMEYLDMVLNETLRLYP-IANRLERVCKKDVEL---NGVYIPKGSTVMIPSYALHHDPQHWS--EPEEFQPERFSKENK------GSIDPYVYLPFGNGPRNCLGMRFALMNMKLALTKIMQNFSFQPCKETQIPLKLSRQGLLQPEKPIVLKVVPR 497          
BLAST of Cytochrome P450 vs. UniProt/SwissProt
Match: sp|P08684|CP3A4_HUMAN (Cytochrome P450 3A4 OS=Homo sapiens OX=9606 GN=CYP3A4 PE=1 SV=4)

HSP 1 Score: 247.284 bits (630), Expect = 1.268e-73
Identity = 166/532 (31.20%), Postives = 272/532 (51.13%), Query Frame = 2
Query:  131 YRRRKISLFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQ-FSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGI--SQKINFLKIRSTLLQIINARKKSSEK-RFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGIRER 1714
            Y      LF +  I GP P    GN++ Y    F     +  +KYGKV+ +++G  P + I DPD+++ VLVK+ +S F  R+ F     P    K+++  A  + WKRLRS ++P F+  K++ M+P+I Q  DVL+  L  E++   + + + DV    +MD+I    FG+  +   N  DPF+ + K  L         +++ + FP      I ++E  N  +   +  NFL  R ++ ++  +R + ++K R D LQL++DS+                     + KE +++        K L+  E++  + +F+FAGY+T+S  +S+I++ LA + D Q KL  EID V              YD+++++ YL+ V+ ETLR +P ++  + R+C K       NG +IPK   +++  +++H D   W   +P  F PERF + N D        +P I+ PFG GPRNCIG R ALM +KL L  ++  F   P + T+ PL+L LG  + P   V L +  R
Sbjct:   25 YGTHSHGLFKKLGIPGPTPLPFLGNILSYHKG-FCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPF----GPVGFMKSAISIAEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETG-KPVTLKDVFGAYSMDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITV-FP----FLIPILEVLNICVFPREVTNFL--RKSVKRMKESRLEDTQKHRVDFLQLMIDSQ---------------------NSKETESH--------KALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPT------YDTVLQMEYLDMVVNETLRLFP-IAMRLERVCKKDVEI---NGMFIPKGVVVMIPSYALHRDPKYW--TEPEKFLPERFSKKNKDN------IDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESR 496          
BLAST of Cytochrome P450 vs. UniProt/SwissProt
Match: sp|P20815|CP3A5_HUMAN (Cytochrome P450 3A5 OS=Homo sapiens OX=9606 GN=CYP3A5 PE=1 SV=1)

HSP 1 Score: 245.743 bits (626), Expect = 5.152e-73
Identity = 169/536 (31.53%), Postives = 269/536 (50.19%), Query Frame = 2
Query:  131 YRRRKISLFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQ-FSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGISQK--INFLKIRSTLLQIINARKKS-----SEKRFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGIRER 1714
            Y  R   LF +  I GP P  + GN++ YR  + ++   +  +KYGK++  +EG  P + I DPD+++ VLVK+ +S F  R+       P    K+++  A  + WKR+RS ++P F+  K++ M P+I Q  DVL+  L  E++K  + + + D+    +MD+I    FG+  +   N  DPF+ S K FL       L ++++L FP +  +F    E  N  +  K  INFL       + +N  KKS      + R D LQL++DS+                     + KE +++        K L+  E+   + +F+FAGY+T+S  +S+ L+ LA + D Q KL  EID V              YD++V++ YL+ V+ ETLR +P V+  + R C K       NG +IPK + +++  +++H D   W   +P  F PERF +            +P I+ PFG GPRNCIG R ALM +KL L  ++  F   P + T+ PL+L     + P   + L +  R
Sbjct:   25 YGTRTHGLFKRLGIPGPTPLPLLGNVLSYRQGL-WKFDTECYKKYGKMWGTYEGQLPVLAITDPDVIRTVLVKECYSVFTNRRSL----GPVGFMKSAISLAEDEEWKRIRSLLSPTFTSGKLKEMFPIIAQYGDVLVRNLRREAEKG-KPVTLKDIFGAYSMDVITGTSFGVNIDSLNNPQDPFVESTKKFLKFGFLDPLFLSIIL-FPFLTPVF----EALNVSLFPKDTINFLS------KSVNRMKKSRLNDKQKHRLDFLQLMIDSQ---------------------NSKETESH--------KALSDLELAAQSIIFIFAGYETTSSVLSFTLYELATHPDVQQKLQKEIDAVLPNKAPPT------YDAVVQMEYLDMVVNETLRLFP-VAIRLERTCKKDVEI---NGVFIPKGSMVVIPTYALHHDPKYW--TEPEEFRPERFSKKKDS-------IDPYIYTPFGTGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLDTQGLLQPEKPIVLKVDSR 495          
BLAST of Cytochrome P450 vs. TrEMBL
Match: K1PQG2 (Putative cytochrome P450 CYP13A5 (Fragment) OS=Crassostrea gigas OX=29159 GN=CGI_10011604 PE=3 SV=1)

HSP 1 Score: 354.755 bits (909), Expect = 1.958e-112
Identity = 202/525 (38.48%), Postives = 297/525 (56.57%), Query Frame = 2
Query:  134 RRRKISLFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQFSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKL--HEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGISQKINFLKIRSTLLQIINARKKSSEKRFDLLQLLLDSEVT-DKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNL 1699
            R+ K+ +F +  I GP PNF+FGNL+ +     ++ + +W R+YGK F YFEGPTP +V  D +LLQ V VKQF  FH RK+FP Q +PD DE   MFFARG+RW+RLRS +NPAFS +KMR M PLI   ID L+  +  H  + +  +S E+    QRLT+D I  C FG+ TN  +N +D  I + +  +  T    +   L   FP +  ++I +   F   +S    F  + S++ +II  +KK    + +LL+L+L SE   D   ID   ++             + N+    +  + LT EE++    LF+ AGY+T+S  ++YI++ ++VN +AQ +L  EIDE+F E  +        YD I K+ YL+ V  ETLR YP  ST++ R C++S      NG  IPK   +  NV SVH++++ W   D   F PERF +    E       +PL W+PFG GPR C+G RLA +  K+T+  ++ ++   PS+  E P+Q   G TI P +GVN+
Sbjct:    3 RKEKMQIFEKMGIPGPKPNFLFGNLLAFWRMPLFKKYQEWYREYGKTFGYFEGPTPVLVTADVELLQQVFVKQFKKFHARKVFPVQVDPDSDENVHMFFARGERWRRLRSIVNPAFSSTKMRTMTPLINHRIDQLLDIVDDHNVNDRSFDSYEL---FQRLTLDTIADCGFGMNTNALINNDDECIKNCRGVIRDTTKRPILFMLGFIFPALHRLWITIYN-FMHFVSFNPVFC-LESSMRKIIRNQKKQKPSKSNLLELMLTSEFNPDADEIDVGDVDQ------------RDNV----VKRRLLTNEELVAQCLLFLLAGYETTSTTLAYIMYEMSVNPEAQKRLQEEIDELFPENADNPS-----YDQIQKMEYLDMVWCETLRKYPLASTVVARQCMESCTV---NGIDIPKGMLVQANVWSVHYNQEHWV-EDTQRFIPERFTEQRKSE------RHPLAWMPFGSGPRTCVGLRLAQLEGKMTIIRMLKKYSFVPSETQEIPIQCVEGATILPKDGVNV 491          
BLAST of Cytochrome P450 vs. TrEMBL
Match: A0A210QVL0 (Cytochrome P450 3A24 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT17576 PE=3 SV=1)

HSP 1 Score: 347.821 bits (891), Expect = 1.951e-109
Identity = 200/546 (36.63%), Postives = 304/546 (55.68%), Query Frame = 2
Query:   92 ISLVAFLFTLFYVYRRRKISLFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQFSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGISQKINFLKIRSTLLQIINARKKSSEKRFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKS---EGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGIRERKI 1720
            I+LV  L   FY  RR K+ +F +  I GP P+F+FGNL+ +    FY  + +W R+YGK F YFEGPT  +V  + +LL +V VKQF  FH RK+FP Q +PD DE   MFFARG+RW+RLRS INPAFS +KMR M P+I   ID LM ++ +   ++ +  ++ DV QRLTMD I +C  G+E +   N +D ++   +  +  T    L   L   FP+   ++I + +         + +L+    + +I++ RK S E + DLL L+L+SE      I+E  +++++ +                +  + LTTEE+   + LF+ AGY+T+S  ++YI + +AVN + Q KL  EID  F +  +        Y++I ++ YL+ V  ETLR  P  ST++ R C+++   EG  L+ G  I        NV ++H++ +LWG  DP  F PERF        E     NP+ W+PFG GPR C+G RLA +  K+ +  L  ++ + PS+    PL+   G TI P +GV++ +  R I
Sbjct:    9 IALV--LLVAFYRQRREKMQVFGRMGIPGPGPHFLFGNLLSFFRKSFYIKYQEWYREYGKTFGYFEGPTAVLVTTNLELLHEVFVKQFKKFHARKVFPVQVDPDRDENVHMFFARGERWRRLRSIINPAFSTTKMRNMTPMINTRIDHLM-EVVDTYGRNRDDFDVYDVFQRLTMDTIAQCGLGLENSSLKNPDDCWLKHSRKVITDTTKRPLLFLLGFIFPKFHELWITIYKLLGYLSFNPVFWLE--KMVKEIVDRRKDSQETKVDLLHLMLNSEYDPATGIEE--LDATDKV----------------VRKRLLTTEELTAQSLLFLLAGYETTSTTLAYIFYEMAVNPEVQAKLQEEIDRYFPDQADNPS-----YEAIQRMEYLDMVWCETLRKCPLASTVVARECMENCTIEGVKLTKGMLIH------ANVWALHYNAELWG-EDPDQFVPERFTA------ERKKMRNPMAWMPFGSGPRTCVGLRLAQLQGKMAMIRLFKKYTVVPSEKLSIPLKYVEGATIIPKDGVSIRVIRRNI 513          
BLAST of Cytochrome P450 vs. TrEMBL
Match: A0A2C9K0E0 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106075045 PE=4 SV=1)

HSP 1 Score: 350.132 bits (897), Expect = 1.105e-107
Identity = 197/550 (35.82%), Postives = 309/550 (56.18%), Query Frame = 2
Query:   86 IFISLVAFLFT-----LFYVYRRRKISLFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQFSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQK-HIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGISQKINFLKIRSTLLQIINARKK-SSEKRFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGIRER 1714
            +F++L+ F F+     LFY  R+ +++ F +  I GP PNF+FGNL+E++    Y+   +W++KYG  + Y+EGPTP +V  D ++L++V VKQF+NFH RKL+P Q +PD+DE   MFFARG+RWKRLR  +NPAFS +K+R+M P + + I+ L+  + + + K   +++E++D+ +RLT+D I +C  GI+ N   N +DP +   K  +  T  +     L   FP +  ++I + +  ++       +L+ R  + ++++ R+  ++E R DL+Q +LD++             S ++   E+E    +N P  K   K +T EE++  A LF+ AGY+T+S  ++Y+   L+ N   Q +L  EI  V              YD + +L YL+ VI+ETLR YP  ST+  R C++     + N Q IP    +  N+  VH+D   WG  DP  F P RF+     +    A      W+PFGGGPR C G R AL+ +K+ +S ++  F   PS     PL LK G TI PA GV+L  R R
Sbjct:    1 MFLTLILFTFSTGLMYLFYRSRKDRMTFFQKMGIPGPEPNFLFGNLLEFQKVPLYKKHQEWKQKYGTTYGYYEGPTPVLVTSDVNILEEVFVKQFNNFHARKLWPVQVDPDKDEDVHMFFARGRRWKRLRGVVNPAFSAAKIRKMTPTVNECINHLLDVMRDTANKTSHKTVELLDIFRRLTLDTILRCEVGIDQNSLKNPDDPILNHCKGVINDTVKTPWLFLLGFLFPSLHCVWITLYKFLHNIKCNPAFWLEDR--MREVVSMRRTLTNEHRNDLMQQMLDAQFA-----------SDSVKDLENEASKISN-PYKKF-LKSMTNEEIVSHALLFLLAGYETTSTTLAYLFFELSQNPHVQQRLRLEIMAVLPRGYHTIE-----YDDLKQLTYLDYVIWETLRKYPLASTVTARQCMRD--CTVGNMQ-IPMGMLVHANLWDVHYDPTHWG-EDPQSFNPLRFMPEQRRKRHATA------WMPFGGGPRACAGIRFALLQLKMVVSKVLRDFDFYPSDKLIVPLPLKQGATILPAEGVHLSARRR 520          
BLAST of Cytochrome P450 vs. TrEMBL
Match: A0A1S3JCI6 (cytochrome P450 3A29 OS=Lingula unguis OX=7574 GN=LOC106172070 PE=3 SV=1)

HSP 1 Score: 332.798 bits (852), Expect = 3.212e-103
Identity = 193/573 (33.68%), Postives = 301/573 (52.53%), Query Frame = 2
Query:   89 FISLVAFLFTLFYVYRRRKISLFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQFSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLT--FPEIKSIFIYMMERFNSGISQKINFLKIRSTLLQIINARKKSSE-KRFDLLQLLLDSEVT-DKKMIDENAIESSNLMKFEDEKEIKTNIPMP----KMNSKQ---------------------LTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGIRERKI 1720
             I +   L  ++   R+ +   F    + GPPPN + GNL EY      E  AK  +KYGK +  FEGP P V+  D +LL++V +K+FS+FHGRKLFP Q +P++    SM  A G RWKRLR   NP FS SKM++M PLI +++   + K  EE  K  +  +I    Q LTM++I  C FG++ N   +   PF+++ + F       S+K  +++   FP ++ +F  M+      +  + +  ++R    + I  RK   + +R DLLQL++D+ +  +K+ +  +    +  + F   KE +    +     +MN  Q                     L+ EE++    +F+ AGY+T+S A+ Y  H LA+N + Q +L +EIDE   + +  N      Y++I KLPYL  V  E LR +P  +T +NR C++       NG +IP   ++  +V S+H D ++WGP DP +F PERF   N       A  +P+ WLPFG GPRNC+G R A++  K+ L+ ++  F I     TE PL+     T  P NGV + + +R+I
Sbjct:    5 LIGVTCVLLGIWIWQRKERFKYFKNMGLDGPPPNLLLGNLGEYGGGNIAEGIAKLTKKYGKTYGIFEGPVPCVITTDLELLKEVFIKRFSSFHGRKLFPVQPDPEDAHGISMVTAVGPRWKRLRMITNPTFSVSKMKQMSPLINEAVTSFL-KTCEEKAKEGKPFDIYKEYQGLTMEVIASCAFGLQINTIQDKEHPFLLAGRDFFNKLGKDSMKFYMMIPAIFPILRRLFYAMLYMAQCYMPNEPSG-RLRKFARETIQLRKSDPKYRRMDLLQLMIDATLAGNKEQVSRSNSSENGELSFGGAKEQEGTNGLAGVDGEMNGVQGTAGDVANGTGNLKTSPQKSGLSKEEIVEQCLVFIIAGYETTSTALGYCSHELALNPEVQKRLQAEIDEQLGDEDHIN------YETIQKLPYLEMVFCEALRLHPIATTFINRRCMEP---CTVNGLHIPAGLSVQADVLSIHADPEVWGPTDPAVFEPERFSPEN------KATRHPMAWLPFGAGPRNCVGMRFAILEAKIALARVLKHFTIERCAETEVPLKKVERATTVPMNGVTVKLVKREI 560          
BLAST of Cytochrome P450 vs. TrEMBL
Match: A0A2C9K0E7 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106075045 PE=4 SV=1)

HSP 1 Score: 337.806 bits (865), Expect = 3.224e-103
Identity = 189/525 (36.00%), Postives = 294/525 (56.00%), Query Frame = 2
Query:  146 ISLFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQFSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQK-HIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGISQKINFLKIRSTLLQIINARKK-SSEKRFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGIRER 1714
            ++ F +  I GP PNF+FGNL+E++    Y+   +W++KYG  + Y+EGPTP +V  D ++L++V VKQF+NFH RKL+P Q +PD+DE   MFFARG+RWKRLR  +NPAFS +K+R+M P + + I+ L+  + + + K   +++E++D+ +RLT+D I +C  GI+ N   N +DP +   K  +  T  +     L   FP +  ++I + +  ++       +L+ R  + ++++ R+  ++E R DL+Q +LD++             S ++   E+E    +N P  K   K +T EE++  A LF+ AGY+T+S  ++Y+   L+ N   Q +L  EI  V              YD + +L YL+ VI+ETLR YP  ST+  R C++     + N Q IP    +  N+  VH+D   WG  DP  F P RF+     +    A      W+PFGGGPR C G R AL+ +K+ +S ++  F   PS     PL LK G TI PA GV+L  R R
Sbjct:    1 MTFFQKMGIPGPEPNFLFGNLLEFQKVPLYKKHQEWKQKYGTTYGYYEGPTPVLVTSDVNILEEVFVKQFNNFHARKLWPVQVDPDKDEDVHMFFARGRRWKRLRGVVNPAFSAAKIRKMTPTVNECINHLLDVMRDTANKTSHKTVELLDIFRRLTLDTILRCEVGIDQNSLKNPDDPILNHCKGVINDTVKTPWLFLLGFLFPSLHCVWITLYKFLHNIKCNPAFWLEDR--MREVVSMRRTLTNEHRNDLMQQMLDAQFA-----------SDSVKDLENEASKISN-PYKKF-LKSMTNEEIVSHALLFLLAGYETTSTTLAYLFFELSQNPHVQQRLRLEIMAVLPRGYHTIE-----YDDLKQLTYLDYVIWETLRKYPLASTVTARQCMRD--CTVGNMQ-IPMGMLVHANLWDVHYDPTHWG-EDPQSFNPLRFMPEQRRKRHATA------WMPFGGGPRACAGIRFALLQLKMVVSKVLRDFDFYPSDKLIVPLPLKQGATILPAEGVHLSARRR 495          
BLAST of Cytochrome P450 vs. Ensembl Cavefish
Match: ENSAMXT00000056570.1 (cytochrome P450 3A56-like [Source:NCBI gene;Acc:103031560])

HSP 1 Score: 226.098 bits (575), Expect = 1.788e-66
Identity = 153/525 (29.14%), Postives = 270/525 (51.43%), Query Frame = 2
Query:  152 LFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQ-FSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGI--SQKINFLKIRSTLLQIINARK-KSSEKRFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGIRER 1714
             F    I GP P  +FGNL+EYR   F+    +  RKYGK++ +FEG    + I D  +++ +LVK+ ++ F  R+ F      + +   ++F  + + WKR+R+ ++P+F+  +++ M  +I+   + L+  L E+S K+ E + + +V    +MD+I    F ++ +   N +DPF+ ++K  L    FS L + L   FP      I ++E+    I  +   +F  +  +L +I   RK K+ + R D+LQL++DS+   ++  +E        MK                  K LT  E++  + +F+FAGY+TSS  +S+  +++A N +   KL  EID+ F             YD+++ + YL+A + E++R +P V+  + R+C   + T   NG  IP+ T+I++ V  +H D + W   DP  F PERF + N +        +P +++PFG GPRNCIG R A + +KL +  ++ +F +      + PL+L     + P + + L    R
Sbjct:   32 FFVNLGIPGPKPLPVFGNLLEYRKG-FHVFDMECYRKYGKIWGFFEGRDRVLCIVDKSIVKSILVKECYTYFTNRRDFGL----NGELYDALFITKDEDWKRIRNHLSPSFTSGRLKEMFGIIQTHANTLVKNL-EKSSKNTEGVAVKEVFGAYSMDVITSTAFSVDIDSMNNPDDPFVTNIKKLLDFDVFSPLFL-LAGLFP----FLIPLLEKMKFSIFPAAVADFFFV--SLKKIKAERKAKNHKSRVDILQLMVDSQTEGEQQGEE--------MK------------------KGLTDHEILSQSMIFIFAGYETSSSTLSFFFYNIATNPETMKKLQQEIDQTFPNNAPVQ------YDAVMNMEYLDAALNESMRLFPSVAR-LERVC---KETIEINGLTIPQGTSIMIPVFPLHRDPEYW--PDPSTFNPERFTKGNKEN------IDPYVYMPFGSGPRNCIGMRFAQLAMKLAIVEILQRFNVINPDPDQVPLKLGTNIFLAPKDPIKLKFPPR 499          
BLAST of Cytochrome P450 vs. Ensembl Cavefish
Match: ENSAMXT00000012911.2 (cytochrome P450 3A56-like [Source:NCBI gene;Acc:103031560])

HSP 1 Score: 218.009 bits (554), Expect = 2.007e-63
Identity = 150/518 (28.96%), Postives = 269/518 (51.93%), Query Frame = 2
Query:  155 FSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQ-FSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFN-SGISQKINFLKIRSTLLQIINARK-KSSEKRFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNL 1699
            F +  I GP P  +FG ++EYR   F+    +  RKYGK++  F+G  P + I D  +++ +LVK+ ++ F  R+        + +   ++F  + + WKR+R+ ++P+F+  +++ M  +++   + L+  L E+S+K+ E I + DV    +MD+I    F ++ +   N  DPF+ ++K  L   +F S    + + FP      + ++E+   S  SQ ++   + S L +I   R+ K+ + R D+LQL++DS+  D +  +E        MK                  K L+  E++  +  F+FAGY+TSS  +S+  +++A N +   KL  EID+ F      N      YD+++ + YL A + E++R +P V+  + R+C   + T   NG  IP+ T+I++ V  +H D + W   DP  F PERF + N +        +P +++PFG GPRNCIG R AL+ +KL +  ++ +F +      + PL+L +   + P   + L
Sbjct:   33 FVKLGIPGPKPLPLFGTMLEYRKG-FHAFDMECYRKYGKIWGIFDGREPVLSIADQTIVKSILVKECYTYFTNRR----DVGLNGELYDALFVTKDEDWKRIRNHLSPSFTSGRLKEMFGIMKTHTNTLVKNL-EKSRKN-EGIAVKDVFGAYSMDVITSTAFSVDIDSMNNPKDPFVTNIKKMLD-IDFLSPIFIVAMVFP----FALPLLEKMKISFFSQSVSDFFLGS-LKKIKTEREAKNHKSRVDILQLMVDSQTEDDQQGEE--------MK------------------KGLSDHEILSQSMSFIFAGYETSSSTLSFFFYNIATNPETMKKLQREIDQTFPNKTPVN------YDAVMNMEYLEAALNESMRLFPVVAR-LERVC---KETIEINGLTIPQGTSIMIPVFPLHRDPEYWS--DPSTFNPERFTKGNKEN------VDPYVYMPFGSGPRNCIGMRFALLAMKLAIVEILQRFDVINPDPNQVPLKLGIHPFLSPKYPIKL 493          
BLAST of Cytochrome P450 vs. Ensembl Cavefish
Match: tbxas1 (thromboxane A synthase 1 (platelet) [Source:ZFIN;Acc:ZDB-GENE-030131-8805])

HSP 1 Score: 216.468 bits (550), Expect = 3.556e-63
Identity = 157/539 (29.13%), Postives = 258/539 (47.87%), Query Frame = 2
Query:  149 SLFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQFSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGISQKINFLKIRSTLLQIINARKK--SSEKRFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEK--------EIKTNIP-----MPK--MNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGIRER 1714
            S+  +  I  P P   FGN++ +R   F++       +YG+V  Y+ G  P VV+ DPD+L+ V+VK+F  F  R        P  +   S+   R +RWKR+RS + P+FS +KM+ M+PLI  + + L+  L    + + ES E  D+ +                +C L    PF++   +F+                 E+   FI                    S + +II  R +   +++R D LQL+LD   + + +    ++E+ +++   DE+        E   N P      PK     + +T +E++G A LF+ AGY+TSS  +++  + LA+N D Q KL  E+D+ F      +      Y ++ +L YL+ V+ E LR YP       R     E   + NGQ++PK   + ++   +H D   W   +P  F PERF        E  A  +P ++LPFG GPR+C+G RLA + I++ L ++  +F +   ++T+ PLQLK  TT+ P NG+ + I +R
Sbjct:   15 SVLQRCGIRHPKPIPFFGNMMLFRHG-FFDAHRDLINQYGRVCGYYLGRRPVVVVADPDMLRQVMVKEFQKFPNRMKLRAATKPMTE---SVLMLRNERWKRVRSILTPSFSAAKMKEMVPLINTATETLLNNL----KSYAESGESFDIHR---------------YDCTLAF--PFLIRPLSFIIPNKSRD----------EMNGFFI--------------------SCIQKIIKQRDELPPNQRRRDFLQLMLDVRSSKECV----SLENFDVVNHADEQAEEQPQVAEEAANGPGSSGDAPKRPQQKRMMTEDEIVGQAFLFLLAGYETSSNTLAFACYLLAINPDCQEKLQREVDDFFTRHGSAD------YTNVQELKYLDMVVCEALRLYP----PGFRFARDVEEDCVINGQFLPKGATLDISAGFLHHDPQYWP--EPEKFIPERFTP------EAKASRHPFVYLPFGAGPRSCVGMRLAQLEIRMALVNIFKKFNVVACEDTKVPLQLKSSTTLGPKNGIFVKITKR 476          
BLAST of Cytochrome P450 vs. Ensembl Cavefish
Match: cyp3a65 (cytochrome P450 3A30-like [Source:NCBI gene;Acc:103031034])

HSP 1 Score: 210.69 bits (535), Expect = 8.407e-61
Identity = 147/535 (27.48%), Postives = 268/535 (50.09%), Query Frame = 2
Query:  149 SLFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQ-FSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGISQKINF-------LKIRSTLLQIINARKKSSE--KRFDLLQLLLDSEVTDK-KMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGIRERKI 1720
              F +  + GP P    G ++EY+   F     +  +KYGKV+  ++   P + I D ++L+ +L+K+ +S F  R+ F     P  D   ++       WKR+RS ++P+F+  +++ M  +++     L+  L + S++  E+ +I ++    +MD++    F ++ +   N +DPF+ ++K  L     + L +A+ L FP            F + + +K+NF       +      L+ I +++ SS+  KR D LQL++DS+ ++K +  D+ AI                           LT  E++  + +F+FAGY+T+S  +S+  +++A N +   KL  EID+ F             YD+++ + YL+A + E+LR YP  +  + R+C K   T   N   IP++T ++  V  +H D + W   +P  F PERF + N +        +P +++PFG GPRNCIG R AL+ IKL +  ++ +F +  S+ T+ PL+L +   + P + + L    RK+
Sbjct:   31 GFFQRIGVPGPKPLPFIGTMLEYKQG-FQNFDLECFKKYGKVWGIYDARQPVLCIMDREILKTILIKECYSLFTNRRNFRLN-GPLYD---AVSIIEDDDWKRIRSVLSPSFTSGRLKEMFGIMKTHSHTLVQNLGKTSKRG-EAADIKEIFGAYSMDVVTSTAFSVDIDSLNNPDDPFVTNIKKMLKFDFLNPLFVAVAL-FP------------FIAPVLEKMNFCFFPPAVMDFFYAALKKIKSQRVSSDNKKRVDFLQLMIDSQKSEKVEHHDKGAIHG-------------------------LTDHEILSQSMIFIFAGYETTSSTLSFFFYNIATNPETMKKLQQEIDQTFPNESLIQ------YDAVMNMDYLDAALSESLRLYPPAAR-LERVCKK---TVEINRLTIPQNTVVLAPVFPLHRDPEYWP--EPDTFKPERFTKGNKEN------IDPFVYMPFGSGPRNCIGMRFALVTIKLAIVEILQRFDVILSEETKVPLELGISGLLAPKDPIKLKFIPRKV 503          
BLAST of Cytochrome P450 vs. Ensembl Cavefish
Match: ENSAMXT00000055169.1 (cytochrome P450 3A30-like [Source:NCBI gene;Acc:103030124])

HSP 1 Score: 204.912 bits (520), Expect = 1.523e-58
Identity = 154/528 (29.17%), Postives = 267/528 (50.57%), Query Frame = 2
Query:   95 SLVAFLFTLFYVYRRRKISLFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQ-FSNFHGRKLFPFQKNPDEDEKASMFFARG------KRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGISQKINFLKIRSTLLQIINARKKSSEKRFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQL 1657
            SLV  + TL Y+Y       F +  I GP P   FG  + Y +  FY+   +  +KYGKV+  F+G  P +++ D ++++ ++VK  +S F  R+        + ++  +  FA G      ++WKR+R++++P F+  K++ + P+ E+  D  +  L + S      +++ DV    +MD++    F ++ +   N +DPF   +K F   + FS L + L+L           ++ +    +  K +     ++L ++ +     + KR D +QL++  +++D +       ESS+     +E+ IK            LT  E++  + +F+  GY+T+S  ++++L++LA N D  NKL  EIDE+F             YD+++KL YL  VI E++R +P  +  + R+C K   T   NG  IPKDT + +  + +H D  LW    P  F PERF   N          +P +++PFG GPRNC+G R ALMI+KL +  L+  F +   + T+ PLQL
Sbjct:   12 SLVVLVITLLYIYGVWPYGFFKKLGIPGPKPWPFFGTFLSY-TKGFYKFDTECYKKYGKVWGIFDGRLPILMVSDYEMIKSIMVKDCYSVFTNRR--------ETNKDLAGPFADGISIVKDEKWKRIRASVSPFFTSGKLKEIFPIAEKYGDRFIENLKKRSPDG--PVKVKDVFAPFSMDVVASASFSVDIDSINNPDDPFGAHIKKFFNFSFFSPLFLFLVLFPSAAG-----ILGKMGFSMFAKSDMEFFYTSLKKLKDQHNNMNHKRVDFMQLMIQGQISDHQA------ESSS-----EEQPIKG-----------LTDHEILSQSFIFMLGGYETTSTTLTFLLYNLATNPDCLNKLMKEIDEMFPHGAPVT------YDALMKLEYLEMVINESMRLFP-TAPRLERVCKK---TVELNGITIPKDTLVTIPAYVLHRDPQLW--ESPEEFRPERFSPENN--------IDPYLFMPFGLGPRNCVGMRFALMIMKLVVVKLLQNFNVETCKETQIPLQL 481          
BLAST of Cytochrome P450 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004192.1 (pep scaffold:Pmarinus_7.0:GL501190:14217:30704:1 gene:ENSPMAG00000003752.1 transcript:ENSPMAT00000004192.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 189.889 bits (481), Expect = 8.806e-54
Identity = 151/538 (28.07%), Postives = 260/538 (48.33%), Query Frame = 2
Query:   86 IFISLVAFLFTLFYVYRRRKISLFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQ-FSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMD------VMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGISQKINFLKIRSTLLQIINARKKS---SEKRFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGT 1669
            + ++L AF+ +  Y+    +I  F +  + GP P  + G    Y    F E  A+  RKYG+V+  ++G  P +++ D ++L+ +LVK    +F  R+ F     P +D    +  A  + WKR+R+ + PAFS  K+++M PLI++  +VL+  LHE  Q   + +++ D      ++  L  +      FG     ++  +DP   +LK ++    FS L  A++L FP      I  +ER    +  K         + Q+ N R+K     + R D LQ ++++++++          +SN                    ++ LT  E+   A LF+ AGYD +S +++++ + LA N D Q K+  EID +  + +  +      Y+++ ++ YL+ V+ ETLR Y   S+  +R+C K   T + N   IPK   + V +  +H+D   W   +PH F PERF +      E     +P  +LPFG GPRNCIG R ALM +K+ +  ++ ++       T  P Q    T
Sbjct:   12 LVLTLAAFILSAIYLLWPYQI--FKKMGVPGPTPFPLVGTFHHYLKG-FREFDAESFRKYGRVWGIYDGRVPVLMVTDTNMLKQILVKDCLESFTNRRKFGLS-GPIKD---VLLIAEDEHWKRIRNVLTPAFSGGKIKQMCPLIQRCAEVLVQNLHEPCQLE-QPVDLKDEKFGSGILDHLEFE---GEGFGEIVKQKVFPHDPVPKALK-YIFLCEFSPL-FAVILFFP----FLISPLERLGVTLFDKKAIHFFHKIVQQMKNKRQKGLNDMQGRVDFLQQMVNAQLSEN---------TSN-------------------GNEDLTDGELESQAVLFLMAGYDNTSTSITFLAYCLACNPDVQTKVQQEIDTILPDGKLPD------YETLKQMEYLDMVVCETLRMYS-SSSRTDRVCKK---TTVVNDLVIPKGVVVTVPLWVLHYDPQYW--DEPHEFRPERFTK------EAKEARDPYCYLPFGHGPRNCIGMRFALMSVKIAVCRILQRYSFQTCSETTIPPQFNKNT 486          
BLAST of Cytochrome P450 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010515.1 (pep scaffold:Pmarinus_7.0:GL494623:61763:74387:-1 gene:ENSPMAG00000009504.1 transcript:ENSPMAT00000010515.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 182.956 bits (463), Expect = 2.678e-51
Identity = 158/567 (27.87%), Postives = 261/567 (46.03%), Query Frame = 2
Query:   77 VMFIFISLVAFLF---TLFYVYRRRKISLFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQ----FSNFHGRKL-FPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGG----TNFSSLKMALLLT--------FPEIKSIFIYMMERFNSGISQKINFLKIRSTLLQIINARKKSSEKRFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGIRERK 1717
            + FI    +  LF    + + YR     +F +  + GP P    G  + Y    F E      +KYG+++  ++G  P +V+ D  +L+ VLVK     F+N     L  PF        K +M  A  ++WKR+R+ ++P FS  K+++M PLI +  D L+  L E+ Q    S +++D+ +             +  +C+L ++ P   SL A +G     T+ +S +M L  T        FPE+     ++   F    +       +R + + I    KK+++ R D LQL++D +++  K +   A   S+                     K LT  E+   A LF+ AGY+T+S A++++ + LA N D Q K+  EID         +      Y+ + ++ YL+ V+ ETLR YP  S   +R+C K   T + N   IPK   + V +  +H+D   W   +P  F PERF +      E     +P  +LPFG GPRNCIG R ALM +K+ +  ++ ++       T  P +L     +   N + + + ERK
Sbjct:    4 ITFILPCKITDLFYPSAMLWPYR-----IFKKMGVPGPTPLPFLGTFLHYHQG-FKEFDQNSFKKYGRIWGTYDGRLPLLVVADTSILKTVLVKDSLEFFTNRRNIGLNGPF--------KEAMSIANDEKWKRIRNVLSPTFSGGKIKQMCPLIVRCADSLVKNLREKCQ----SGKLVDLKE-------------LHVSCKLRISLP--KSLCALIGKYGNFTSDTSRQMVLCFTGINLTTPIFPELVPPLEFLGLSFFPKKASSFFTTIVRQSDVNI----KKNNKGRVDFLQLMVDVQLS--KSMQNGANPHSD---------------------KYLTDSELEAQAILFLLAGYETTSTAITFVAYCLACNPDVQTKVQQEIDRFLPNDTLPS------YEILKQMEYLDMVVSETLRMYPPTSRT-DRVCKK---TTVVNDLVIPKGVVVTVPLWVLHYDPQYW--DEPEEFRPERFSK------EAKEARDPYCYLPFGQGPRNCIGMRFALMSMKIVVCRILQRYSFHACNETTIPPKLTKNPFLQLENPLLVQVSERK 492          
BLAST of Cytochrome P450 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010493.1 (pep scaffold:Pmarinus_7.0:GL494623:34025:53335:-1 gene:ENSPMAG00000009498.1 transcript:ENSPMAT00000010493.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 182.57 bits (462), Expect = 4.075e-51
Identity = 147/554 (26.53%), Postives = 264/554 (47.65%), Query Frame = 2
Query:   77 VMFIFISLVAFLFT-LFYVYRRRKISLFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQFSNF--HGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGIS---QKIN-FLKIRSTLLQIINARKKSSEKRFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGIRERK 1717
            V+++  S +   F+ L + YR     +F +  + GP P  +FG  + Y S  F     +  ++YG+V+  ++G  P +++ D ++L+ +LVK    F  + RK+       +E     +     ++WKR+R+ ++P FS  K+++M PLI +  DVL+  LHE+ Q   +S+++        ++      + I          P ++S    +    ++  + +L   FP    +F YM      G+S   +KI  F K      +   +   S++ R D LQL++D+++++      N                         + K LT  E+   A LF+ AG++T+S A++++ + LA N D Q K+  EIDE   + +  +      Y+ + ++ YL+ V+ ET+R YP  +  ++R+C +   T   +   IPKD  I V+   +H+D   W   +P+ F PERF +      E     +P  +LPFG GPRNCIG R ALM +K+ +  ++ ++       T  P +L  G+ +     + L + ERK
Sbjct:   11 VLYLLDSKINVSFSYLLWPYR-----IFKKMGVPGPTPLPLFGTFLHY-SKGFRAFDEESFQRYGRVWGIYDGRLPVLMVADTNMLKQILVKDCLEFFTNHRKI-----GLNELFGEGLSTVDDEQWKRIRNILSPTFSSGKIKQMYPLILRCADVLVKNLHEKCQSG-KSVDLKQGNGEWRLETNRVTAYKIFIALVKRPPPPLLLSRSKMININIYNVQRFSLSALFPVFVPLFEYM------GLSLFPKKICIFFKNIVQQFKTDISMNYSTKGRVDFLQLMVDAQLSETVQNGANP-----------------------HSEKYLTDSELEAQAILFLLAGFETTSTAITFVAYCLACNPDVQTKVQQEIDEFLPDDKAPS------YEILNEMEYLDMVVSETMRMYPPAAR-LDRVCKR---TTTVDNLVIPKDVVITVSTWVLHYDPQHW--EEPNEFRPERFTK------EAKEARDPYCYLPFGQGPRNCIGMRFALMSVKIAVCRILQRYSFQMCSETTIPPKLAKGSILQTEKPLLLKVSERK 505          
BLAST of Cytochrome P450 vs. Ensembl Sea Lamprey
Match: cyp4t8 (cytochrome P450, family 4, subfamily T, polypeptide 8 [Source:ZFIN;Acc:ZDB-GENE-031219-3])

HSP 1 Score: 132.109 bits (331), Expect = 3.584e-33
Identity = 102/414 (24.64%), Postives = 180/414 (43.48%), Query Frame = 2
Query:  437 GKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMM----ERFNS--GISQKI--NFLKIRSTLLQIINARKKSSEKR-FDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPL 1651
            G +W R R  + P F    ++  + +I QS   ++ K    ++K   ++E+   +  L +  I KC F  E NCQ    + ++ ++       +      AL        + ++Y +     RF    G + K   + ++ R   L++   + K+ +KR  D L +LL S   D                                  + L+ EE+       +FAG+DT++  +S++LH+LA N   Q     E   V     +        +D I  LPY   VI E+LR YP V +I+ ++   ++   L +G  +P    + V++  +H +++ W   DP +F P RF Q N       A  +P  ++PF  GPRNCI +  AL  +++T++ ++ +FRI  +     PL
Sbjct:  127 GPKWFRNRRLLTPGFHYEILKPYIAIIGQSTASMLDKWERLTEKQ-PTLEVFGDISLLMLHSILKCAFSYEGNCQTEAGNSYVRAVYELTDLVHRRFRNFAL-------HNKWVYYLTPAGRRFQKAKGHAHKHTEDVIRRRRETLKLEAQQDKTQQKRNLDFLDILLSSRDAD---------------------------------GQSLSDEEIRTEVDTIMFAGHDTTASGLSWVLHALASNPHHQEVCRDEAARVLAGRSQPE------WDDISNLPYTTMVIKESLRLYPPVPSIIRKL---TQPLKLPHGHVLPAGMRVCVSIFCIHRNEEFWK--DPEVFDPLRFSQENS------AHRHPYAFIPFSAGPRNCIDQNFALNELRVTVAMILSRFRIHSASPPAWPL 482          
BLAST of Cytochrome P450 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000063.1 (pep scaffold:Pmarinus_7.0:GL478178:2662:7225:1 gene:ENSPMAG00000000058.1 transcript:ENSPMAT00000000063.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 115.546 bits (288), Expect = 4.655e-29
Identity = 84/286 (29.37%), Postives = 130/286 (45.45%), Query Frame = 2
Query:  866 RKKSSEKRFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERF---LQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGIRER 1714
            RK     R D LQ ++D++++D  M +   I                 IP      K LT  E++  A +F+ AGY+T+++ ++YI ++LAV+ D Q+KL  EID                Y   + LP+   V+ E+LR YP    +     +  E      G  +PK T I + V  +H   + W   DP  F PERF    +   D+Y          +LPFG GPRNCIG R AL+ +K+ +  L+ +F       T+ P ++ +   + P   + L   ER
Sbjct:   39 RKGEHTDRVDFLQTMVDAQISDSVMDEHGGI-----------------IPY-----KALTDSEILSQAMVFLLAGYETTAVTLTYIAYNLAVHVDVQDKLLEEIDATLPPEAP--------YCYRILLPH---VVSESLRLYPPAGRLERIAKMDVE----LGGIPVPKGTVIGIPVFVIHRHSEHWD--DPTAFRPERFSKEAREQRDQY---------CYLPFGAGPRNCIGMRFALINVKIAIVSLLRRFTFVTCPETKIPAEIGIRGLLEPKEPIILKFAER 276          
BLAST of Cytochrome P450 vs. Ensembl Yeast
Match: DIT2 (N-formyltyrosine oxidase; sporulation-specific microsomal enzyme involved in the production of N,N-bisformyl dityrosine required for spore wall maturation, homologous to cytochrome P-450s; SWAT-GFP and mCherry fusion proteins localize to the endoplasmic reticulum and vacuole respectively [Source:SGD;Acc:S000002810])

HSP 1 Score: 71.633 bits (174), Expect = 1.195e-13
Identity = 108/489 (22.09%), Postives = 192/489 (39.26%), Query Frame = 2
Query:  260 KYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQ--FSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPA---FSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPF---IVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGISQKINFLKIRSTLLQIINARKKSSEKRFDLLQLLL---DSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLA-VNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERF-LQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPAN 1687
            KYG V  +F G   N+++   + L  +   +  F+    +K  P+          ++  A G  W+  R+ +      F D+        I ++  +L T +     +   SI +  + QR+ +D I +   G +     +  + F   ++ +K          +     LTFP                      FL +       I +RKK+ +      +LL+     E+ +    ++    +S+L++  + + I         + KQLT   VI      + AG++   +  +  L+ LA  + + Q KL  E++ +                 +  LP LNA ++E +R YP +STI+NR   K+    L     IPK   +  N      D   WG      F PER+   I      +    N      F GG R C+G++LAL  ++++L+ ++ QFR   S + E   +L     +CP N
Sbjct:   65 KYGAVKFFF-GSRWNILVSRSEYLAQIFKDEDTFAKSGNQKKIPYSALAAYTGD-NVISAYGAVWRNYRNAVTNGLQHFDDAP-------IFKNAKILCTLIKNRLLEGQTSIPMGPLSQRMALDNISQVALGFDFGALTHEKNAFHEHLIRIK--------KQIFHPFFLTFP----------------------FLDVLP-----IPSRKKAFKDVVSFRELLVKRVQDELVNNYKFEQTTFAASDLIRAHNNEII---------DYKQLTDNIVI-----ILVAGHENPQLLFNSSLYLLAKYSNEWQEKLRKEVNGITDP------------KGLADLPLLNAFLFEVVRMYPPLSTIINRCTTKT--CKLGAEIVIPKGVYVGYNNFGTSHDPKTWGTTADD-FKPERWGSDIETIRKNWRMAKNRCAVTGFHGGRRACLGEKLALTEMRISLAEMLKQFRW--SLDPEWEEKLTPAGPLCPLN 478          
BLAST of Cytochrome P450 vs. Ensembl Yeast
Match: ERG11 (Lanosterol 14-alpha-demethylase; catalyzes C-14 demethylation of lanosterol to form 4,4''-dimethyl cholesta-8,14,24-triene-3-beta-ol in ergosterol biosynthesis pathway; transcriptionally down-regulated when ergosterol is in excess; member of cytochrome P450 family; associated and coordinately regulated with the P450 reductase Ncp1p; human CYP51A1 functionally complements the lethality of the erg11 null mutation [Source:SGD;Acc:S000001049])

HSP 1 Score: 60.4622 bits (145), Expect = 3.880e-10
Identity = 103/481 (21.41%), Postives = 195/481 (40.54%), Query Frame = 2
Query:  233 YELFAKWERKYGKVFVY-FEGPTPNVVIGDPDLLQDVLVKQFSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSI-----DVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYM-MERFNS-GISQKINFLKIRSTLLQIINARKKSSEKRFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQY-IPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQIN------GDE--YEFVAPTNPLI--WLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFR 1618
            YE F + ++KYG +F +   G    V +G P   + V   + ++      +     P    K  ++     R    +  +  A +    +  +PLI + +     D    +L+E +     +I++M     +T+    + + G E   +L+               T+F+ L   L   F  I  +F  + +E +     +QK     I  T + +I  R+K             ++++ D+ +ID       +LMK    K           +  ++T +E+       +  G  TS+   ++IL  LA   D Q +L  E   V    +++       YD + ++P LN  I ETLR +  + ++  ++    +  H+ N  Y IP   +++V+    H  +D + P + H F   R+ + +      G+E  Y F A +  +   +LPFGGG   CIG+  A   + + +S  I   +
Sbjct:   77 YEFFEECQKKYGDIFSFVLLGRVMTVYLG-PKGHEFVFNAKLADVSAEAAYAHLTTPVFG-KGVIYDCPNSRLMEQKKFVKGALTKEAFKSYVPLIAEEVYKYFRDSKNFRLNERTTG---TIDVMVTQPEMTIFTASRSLLGKEMRAKLD---------------TDFAYLYSDLDKGFTPINFVFPNLPLEHYRKRDHAQK----AISGTYMSLIKERRK-------------NNDIQDRDLID-------SLMKNSTYK-----------DGVKMTDQEIANLLIGVLMGGQHTSAATSAWILLHLAERPDVQQELYEEQMRVLDGGKKELT-----YDLLQEMPLLNQTIKETLRMHHPLHSLFRKVM---KDMHVPNTSYVIPAGYHVLVSPGYTHL-RDEYFP-NAHQFNIHRWNKDSASSYSVGEEVDYGFGAISKGVSSPYLPFGGGRHRCIGEHFAYCQLGVLMSIFIRTLK 492          
BLAST of Cytochrome P450 vs. Ensembl Yeast
Match: ERG5 (C-22 sterol desaturase; a cytochrome P450 enzyme that catalyzes the formation of the C-22(23) double bond in the sterol side chain in ergosterol biosynthesis; may be a target of azole antifungal drugs [Source:SGD;Acc:S000004617])

HSP 1 Score: 56.225 bits (134), Expect = 8.623e-9
Identity = 63/234 (26.92%), Postives = 107/234 (45.73%), Query Frame = 2
Query: 1022 KMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRI-TPSQNTENPL--QLKLGTTICPANGVNLGIRER 1714
            ++  ++ T +E+      F+FA  D SS    ++   +A   D   K+  E   V        LN     D I K+ Y N VI ETLR+ P V  +M    +K +   +S     PK   +I  ++    D +++   +P  F PER+++  G +    A      WL FG GP  C+G+   +    +T + L+ +F + T   +T  PL  ++K+  TI P + + L  ++R
Sbjct:  315 RIYHREFTNKEISEAVFTFLFASQDASSSLACWLFQIVADRPDVLAKIREEQLAVRNNDMSTELNL----DLIEKMKYTNMVIKETLRYRPPV--LMVPYVVK-KNFPVSPNYTAPKGAMLIPTLYPALHDPEVY--ENPDEFIPERWVE--GSK----ASEAKKNWLVFGCGPHVCLGQTYVM----ITFAALLGKFALYTDFHHTVTPLSEKIKVFATIFPKDDLLLTFKKR 529          
BLAST of Cytochrome P450 vs. Ensembl Nematostella
Match: EDO46449 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ80])

HSP 1 Score: 255.758 bits (652), Expect = 1.135e-78
Identity = 161/497 (32.39%), Postives = 269/497 (54.12%), Query Frame = 2
Query:  242 FAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQFSNFHGR-KLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPE-IKSIFIYMMERFNSGISQKINFLKIRSTLLQIINARK-KSSEKRFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYP--FVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGIRERK 1717
            FA++ R YG+V+  +   +P +VI DPD+L++VLVK+F +FH R   FP  +  D    + MFFA G+ W R+R+T++P FS  KM+ +LPL+  S D++M+KL + ++K  E   +  + Q LTMD I + VFGIE++ Q N +DP  V+ ++ L  + F  +  A++   P+ IK +F  +   F S   + +   +      ++I A+K + +  R D+L L+L++      MID+                            K++T  E+I    +F+ AGY+ ++ A+++I ++LA N D Q KL  EID V+ + ++        YD + +L YL+ V+ ETLR YP   ++  + + C+         G+   K   I+++V+S+H D +LW   +P  F PERF        E     NP  +LPF  GPRNC+G R +LM +KL L+ ++ ++    +QNT+ P  LK G+ +     + LG++ R+
Sbjct:   27 FAEYSRTYGRVYGLYLFGSPTIVINDPDILKEVLVKEFHSFHDRPAFFPMPEPFD----SMMFFAEGETWHRVRTTVSPIFSAHKMKMVLPLMNNSCDIMMSKLQQAAEKG-EPFNMYRMGQSLTMDFILRIVFGIESSVQHNYDDPAFVAARSALEASTFQKIAGAVVGMMPKPIKKMFSRV---FFSHTKELVEMTE------KVIAAKKTQENSTRKDILDLMLEA------MIDDET------------------------KKKRMTEAEIIAQCLIFMIAGYEGTNSALTFICYNLATNPDIQEKLQQEIDSVWTDADQVLS-----YDILNELSYLDMVVSETLRMYPPGMLTRAVTQDCV-------IQGRRFRKGNAILMDVYSLHHDPELWP--EPERFNPERFTA------EAKQSRNPCAYLPFSAGPRNCVGMRFSLMELKLALTRILKKYSFAVTQNTKIPPTLKAGSALTCGGEMMLGVKARE 459          
BLAST of Cytochrome P450 vs. Ensembl Nematostella
Match: EDO36023 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJV6])

HSP 1 Score: 239.195 bits (609), Expect = 7.654e-72
Identity = 162/522 (31.03%), Postives = 264/522 (50.57%), Query Frame = 2
Query:  167 NILGPPPNFIFGNL-IEYRSTVFYELFAK--WERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQFSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGISQKI--NFLKIRSTLLQIINARKKS-SEKRFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGIRER 1714
             I GP P    GNL I Y     ++ +A+    + YG++  Y+ G    +++ DP++ + +LVK+F  F  R +    + P  D+  ++   +   W+RLR TI P FS  K++++LPLI +S  +L+ KL E   K  +S++++    + TM+ I    FGI+   Q N ND F+ + +   GG    SL   L + FP ++ I   M+++   G   +   + + I     QII  R+++ S+ R DLL++LL +E TD     +N                            +L+ +E++     F+ AGY+T+S  M++  + LA+N D Q++L  EIDEV   + +        YD+++ + YL  V+ E LR YP       R C +S      NGQ+ PK   +++ V ++H D ++W   +P  F PERF        E     +P   LPFGGGPRNCIG R AL+  K+ L +++  +R+     TE P+QL+   TI P +G+ L I +R
Sbjct:   44 GIPGPKPWPFIGNLPILYEKK--HDTYAQEYLVKTYGRLCGYYMGTRAAILVADPEMAKQILVKEFDKFVNRPIVQSAQTPPTDK--TLLSLQDDDWRRLRHTITPTFSAVKLKQVLPLINESCRILVEKLGEAC-KDGKSVDVLRSYGKFTMETIVTTAFGIDCQTQTNPNDQFVPNAQRLFGG---QSLFRMLAVLFPYLQPIVSLMVKQLGLGKQTETGKSAMFIVDAARQIIKHRRETGSQGRKDLLEILLSAETTDDDGRRKN----------------------------KLSDDEIVAQCFTFILAGYETTSNTMAFTSYLLALNPDKQDRLIEEIDEVAATVGDNFD-----YDTVLGMEYLEMVVQEALRLYP-PGFRFGRTCNQS---CTINGQFFPKGCIVLIPVFAMHRDPEIW--PEPEKFQPERFTA------EAKQARHPYAHLPFGGGPRNCIGMRFALLEAKMALVYILRYYRLERCPETEVPVQLQGTITISPKHGIYLKITKR 512          
BLAST of Cytochrome P450 vs. Ensembl Nematostella
Match: EDO30263 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1A1])

HSP 1 Score: 220.32 bits (560), Expect = 8.309e-65
Identity = 160/515 (31.07%), Postives = 258/515 (50.10%), Query Frame = 2
Query:  167 NILGPPPNFIFGNLIEY-RSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQFSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEI-KSIFIYMMERFNSGISQKINFLKIRSTLLQIINARKKSSEKRFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGI 1705
            NI GP P    GNL +  R    +    +  ++YGKVF +  G TP +V+GDP++L+ V+VK+F NF  R  F   ++   +    MF A   +WKR+RST+ P F+  K+R+M P I +S D LM K+ + +    ES++I+ +  ++T+++I    FGI++  Q N N+ F    K       F  L+M L+L F  +   IF +++   N+ +   I+  K      +I++ R   +  R D + L+L +   D                                 S++L+  E+I  +  F+ AG++TSS A+S   + LA+N + Q +L  EI      +  +  +    ++    L YL+ V+ E LR +P V T MNR C ++    + NG  IP   ++ +  +S+H D D W   +P  F PERF    G   E     +P  ++PFG GPRNCIG R AL  +KL L  ++ +++   S +T+ PL L  G T+ P +G+ L I
Sbjct:   43 NIPGPTPLPYIGNLRDIQRLGGIHVAPVRLMQEYGKVFAWSVGRTPAIVVGDPEILKHVMVKEFQNFRNR--FLLFRDTRSEMLHGMFSATDDKWKRIRSTLTPTFTSGKLRQMNPKIRESCDTLMDKIGKVADTG-ESVDILGMFCQMTLEVILSTAFGIDSEVQKNPNNTFSDKAKEIFKSPTF--LRMFLMLPFASVFFKIFRFLIH--NNNMKYFIDLSK------EILSKRHDKTFNRKDFVDLMLSAVNPD--------------------------------GSRKLSDPEIIAQSVTFLLAGHETSSNALSATAYYLALNPEVQERLRLEI-----RMAAETNSDKSPHELANDLEYLDCVVNEVLRLHPPVHT-MNRECAQA---CVINGITIPAGMDVTIPFYSLHHDPDAWP--EPDKFDPERF---RGPAKE---SRHPFQFIPFGAGPRNCIGMRFALNEVKLVLFQILSKYKFVRSPDTQVPLVLIPGATLIPRDGIYLRI 495          
BLAST of Cytochrome P450 vs. Ensembl Nematostella
Match: EDO36004 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJV2])

HSP 1 Score: 218.394 bits (555), Expect = 3.594e-64
Identity = 153/547 (27.97%), Postives = 269/547 (49.18%), Query Frame = 2
Query:  149 SLFSQYNILGPPPNFIFGNL-IEYRSTVFYELFAK--WERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQFSNFHGRK----LFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGISQKI--NFLKIRSTLLQIINARKKSSEK----------------RFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGIRER 1714
            S      I GP P    GNL I ++    ++ +A+    + YG++  Y+ G   ++++ DP++ Q +LVK+F  F  R     L P   +    +K ++   +   W+RLR  + P FS  K+++++PLI +S  +L+ +L +   K  +S+++     + TM+ I    FGI+   Q N ND F+ + + + G  +  ++   L + FP ++ I   M+ R   G   +I  + + I     QII  R+++  K                + DLL++LL +E TD                 +D K              +L+ +E++     F+ AG+  +S  M++  + LA+N D Q++L  EID+V   + +        YD+++ + YL+ V+ E LR YP     + R C +S      NGQ+ PK   +++ V+++H D ++W   +P  F PERF        E     +P  +LPFG GPRNCIG R AL+ +K+ L +++  +R+     TE PLQL+   ++ P +G++L I +R
Sbjct:    5 SFLKNLGIPGPKPWPFIGNLPILFKKK--HDTYAQEYLVKTYGRLCGYYRGTRASILVADPEMAQQILVKEFDKFVNRGVSEGLLPLSSHIPPTDK-NLISLQDDDWRRLRHFVTPTFSAVKIKQVVPLISESCRILVEQLGQAC-KDGKSVDVCRTYVKFTMETIVSTAFGIDCQTQTNPNDQFLSNAQRYFGKPSPFTI---LAVLFPYLQPIISVMVRRLGLGRQTEIGKSVMFIVDAARQIIKHRRETGSKGVKYLHFPQGEPSGPRKKDLLEILLSAETTD-----------------DDGK-----------RKNKLSDDEIVAQCFTFILAGFQNTSNTMAFTSYLLALNPDKQDRLIEEIDDVAATVGDNFD-----YDTVLGMEYLDMVVQEALRLYP-PGFRLGRTCNQSCTI---NGQFFPKGCLVMIPVYAIHRDPEIW--PEPEKFQPERFTA------EAKQARHPYAYLPFGEGPRNCIGMRFALLKVKMALVYILRHYRLERCPETEVPLQLQGFISMSPKHGMHLRITKR 499          
BLAST of Cytochrome P450 vs. Ensembl Nematostella
Match: EDO33558 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRX7])

HSP 1 Score: 216.853 bits (551), Expect = 9.627e-64
Identity = 149/465 (32.04%), Postives = 239/465 (51.40%), Query Frame = 2
Query:  242 FAKWERKYGKVFVYF-EGPTPNVVIGDPDLLQDVLVKQFSNFHGRKLFPFQKNPDEDEKASMFFARGK--RWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGISQKINFLKIRSTLLQI--INARKKSSEKRFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYP--FVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQF 1615
            F ++ +KYG+++  F  G  P+V++GDPD++++++VK+FS+F  R + PF            F  R K  +W R+R++++PAFS  KM+ M+PLI  S DVL+ KL + +     S  +    Q LTMD I K  FGI +  Q N +DP   + +  +  +    + + L+   P  K IF +        I    + +KI + ++++  +N  K++     D+L L+L +        +EN                          SK+L+  EV+  + +F+ AGY+T+++ +S++ +SLA N D Q KL  EID V+ E ++        YD++  LPYL+ VI ETLR YP  FV++   R C +     +  G    K  +I ++ +S+H D + W   DP  F PERF +      E     +P  +LPFG GP NCIG R A M IKL L  ++ +F
Sbjct:   74 FQEYYKKYGRLYAMFLVGKKPSVIVGDPDIVKNIMVKEFSSFQDRPVEPFNS----------FMTRAKYDKWHRIRTSLSPAFSAHKMKLMVPLINSSCDVLINKLTKIADSG-TSFFVHKFHQGLTMDTILKTAFGIHSEAQTNYDDPAFTAARKSMSTSPARRVMLFLIFLMPFRKYIFRWFPSLL---IGNFDDIMKITTKMIEVKKVNPHKEAK----DMLDLMLSAAA------NEN-------------------------TSKKLSDMEVLAQSLIFLIAGYETTNITLSFVAYSLATNPDVQEKLQREIDSVWTEEDQMPS-----YDTVHNLPYLDMVISETLRLYPPGFVAS---RECTQD---CVIKGYRFRKGLSIFIDAYSMHHDPEFWT--DPERFDPERFSR------ECKQSRDPYSYLPFGHGPHNCIGMRFAQMEIKLALVRVLRKF 470          
BLAST of Cytochrome P450 vs. Ensembl Medaka
Match: tbxas1 (thromboxane A synthase 1 [Source:NCBI gene;Acc:101158441])

HSP 1 Score: 255.758 bits (652), Expect = 3.502e-77
Identity = 173/548 (31.57%), Postives = 274/548 (50.00%), Query Frame = 2
Query:  125 YVYRRRKISLFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQFSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRL---TMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERF--NSGISQKINFLKIRSTLLQIINARKKS--SEKRFDLLQLLLDSEVTDKKMIDENAIESSN----------LMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGIRERK 1717
            Y Y     S+ S+Y I  P P   FGNL  +R   F++      + +G+V  Y+ G  P VVI DPDLL+ V+VK FS+F  R    F   P  D    +   + +RW+R+RS + P+FS +KM+ M+PLI    +VLM  L      H ES +  D+ +     TMD+I    F  + + Q   +DPF+   + F   + F  + M   + FP +    +  + RF  N    +  NF      + +II  R++    ++R D LQL+LD+  T K+    +  ++SN              + E        + +   K +T +EV+G A +F+ AGY+T+S  + +  + LAV+ + Q+K+  E+D+ F   E  +      Y +I +L Y++ V+ ETLR YP       R   + E   + NG  +PK   + +    +H+D + W   +P  F PERF        E  A  +P ++LPFG GPRNC+G RLA + IK+ L+HL   F +     T+ PL+LK  +T+ P NG+ + I +R+
Sbjct:   33 YWYSVYPFSVLSRYGIKHPKPVPFFGNLFLFREG-FFKPLNDLIKTHGRVCGYYLGRKPVVVIADPDLLRQVMVKDFSSFPNRMTLRFATKPMVD---CLLALKDERWRRVRSILTPSFSAAKMKEMVPLINTVTEVLMKNL----TTHAESGQAFDIHRCFGFFTMDVIASVAFATQVDSQNKPDDPFVHHAQMFFTFSFFRPM-MMFFIAFPSL----MAPVARFIPNKRRDEMSNFFI--HNIQKIIKQREEQPPDQRRRDFLQLMLDAR-TAKECASLDQFDTSNHGDETLTNPKAASSDQESSRSEESALRRPQKKMMTEDEVVGQAFIFLLAGYETTSSTLGFTCYLLAVHPECQHKVQQEVDQFFSRHESPD------YTNIQELKYMDMVVSETLRLYP----PGFRFAREVEEDCVVNGVRLPKGATLEIPAGFLHYDPEYWS--EPEKFIPERFTA------EAKASRHPFVYLPFGSGPRNCVGMRLAQLEIKMALAHLFRSFSVVACSETKVPLELKSSSTLGPKNGIFVKITKRE 546          
BLAST of Cytochrome P450 vs. Ensembl Medaka
Match: cyp3a (cytochrome P450, family 3, subfamily A [Source:NCBI gene;Acc:101155406])

HSP 1 Score: 218.009 bits (554), Expect = 1.380e-63
Identity = 157/543 (28.91%), Postives = 267/543 (49.17%), Query Frame = 2
Query:   98 LVAFLFTLFYVYRRRKISLFSQYNILGPPPNFIFGNLIEYRS--TVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQ-FSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGISQKINFLKIRSTLLQIINARKKSSEK-RFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGIRER 1714
            LVAF+ TL  VY       F +  I GP P   FG ++ YR    +F E   +  +KYGK +  ++G  P + I DP  ++ VLVK+ +S F  R+ F     P  D   S+F A   +WKR+RS ++P+F+  +++ M  +++     L+  + +++ K  E + + D     +MD++    F ++ +   N +DPF+ ++K  L   +F +    L+  FP +  I    ME+          F    S L +I +  K + +K R D LQL++DS+  ++  + +                            K L+  E++  A +F+FAGY+T+S +++++ ++LA N +   KL  EID  F             Y  ++++ YL++V+ E+LR YP    I  R+   ++ T   NG  IPKD  ++V    +  D +LW   +P  F PERF + N + ++      P  ++PFG GPRNCIG R AL+ +KL L  ++ Q+  +  + TE P +L +   I P   + L +  R
Sbjct:   15 LVAFI-TLLLVYAYWPYGTFKRLGIPGPKPVPFFGTMLAYRKGFPIFDE---ECRKKYGKTWGIYDGRQPVLCITDPATIKAVLVKECYSLFTNRRNFHLN-GPMYD---SVFNAEDDQWKRIRSVLSPSFTSGRLKEMFDIMKHHSANLVNSMKKKADKD-EPLNLKDHFGPYSMDVVTSTAFSVDIDSLNNPSDPFVTNIKKMLK-FDFLNPLFLLVAFFPFLGPI----MEKMELSFFPASAFDFFYSALQKIKSDHKNNKQKSRIDFLQLMIDSQKNNQNGLQD----------------------------KGLSDHEILSQAMIFIFAGYETTSSSLTFLAYNLATNPEVMKKLQKEIDATFPNKAPIQ------YAPLLEMEYLDSVVNESLRLYP----IAARLERVAKATVEVNGLVIPKDMVVMVPTWPIQRDPELWP--EPEKFKPERFSKENKETFD------PYTYMPFGAGPRNCIGMRFALVSMKLALVEILQQYSFSVCKETEIPFELDIQGLIAPKRPIFLKLVPR 497          
BLAST of Cytochrome P450 vs. Ensembl Medaka
Match: cyp3a40 (cytochrome P450 3A40 [Source:NCBI gene;Acc:100125817])

HSP 1 Score: 217.624 bits (553), Expect = 2.421e-63
Identity = 155/544 (28.49%), Postives = 270/544 (49.63%), Query Frame = 2
Query:   98 LVAFLFTLFYVYRRRKISLFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQ-FSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGI--SQKINFL--KIRSTLLQIINARKKSSEKRFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGIRER 1714
            LVAF+ TL  VY       F +  I GP P   FG ++ YR   F+    +  +KYGK +  ++G  P + I DP  ++ VLVK+ +S F  R+ F     P  D   ++  A   +WKR+RS ++P+F+  +++ M  +++     L+  + ++  K  E +E+ +     +MD++    F ++ +   N +DPF+ ++K  L     + L +A+   FP +  I    +E+F   +  S  ++F    +R       N ++KS   R D LQL++DS+  ++  + +                            K L+  E++  A +F+FAGY+T+S +++++ ++LA N +   KL  EID  F             Y  ++++ YL+ V+ E+LR YP    I  R+   ++ T   NG  IPKD  ++V    +H D +LW   +P  F PERF + N D ++      P  ++PFG GPRNCIG R AL+++KL +  ++  +  +  + TE P +LK+G  + P   + L +  R
Sbjct:   15 LVAFI-TLLLVYAYWPYGTFKRLGIPGPKPVPFFGTMLAYRKG-FFNFDEECRKKYGKTWGIYDGRQPVLCITDPATIKAVLVKECYSLFTNRRNFRLN-GPLYD---AVSIAEDDQWKRIRSVLSPSFTSGRLKEMFDIMKHHSANLIQSMKKKVDKD-EPLEMKEYFGPYSMDVVTSTAFSVDIDSLNNPSDPFVTNIKKMLKFDFLNPLFLAVAF-FPFLGPI----LEKFEFSLFPSSVMDFFFAALRKIKANHENNKQKS---RIDFLQLMIDSQKNNQNGLQD----------------------------KGLSDHEILSQAMIFIFAGYETTSSSLTFLAYNLATNPEVMKKLQKEIDATFPNKAPVQ------YVPLMEMEYLDCVVNESLRLYP----IAARLERVAKATVEVNGLVIPKDMVVMVPTWPLHRDPELW--PEPEKFKPERFSKENKDTFD------PYTYMPFGAGPRNCIGMRFALVMMKLAVVEILQTYDFSVCKETEFPFELKMG-FLAPKRPIQLKLTPR 496          
BLAST of Cytochrome P450 vs. Ensembl Medaka
Match: cyp3a40 (cytochrome P450 3A40 [Source:NCBI gene;Acc:100125817])

HSP 1 Score: 215.312 bits (547), Expect = 1.515e-62
Identity = 152/544 (27.94%), Postives = 268/544 (49.26%), Query Frame = 2
Query:   98 LVAFLFTLFYVYRRRKISLFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQ-FSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGI--SQKINFL--KIRSTLLQIINARKKSSEKRFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGIRER 1714
            LVAF+ TL  VY       F +  I GP P   FG ++ YR   F+    +  +KYGK +  ++G  P + I DP  ++ VLVK+ +S F  R+ F     P  D   ++  A   +WKR+RS ++P+F+  +++ M  +++     L+  + ++  K  E +E+ +     +MD++    F ++ +   N +DPF+ ++K  L     + L +A+   FP +  I    +E+F   +  S  ++F    +R       N ++KS   R D LQL++DS+  ++  + +                            K L+  E++  A +F+FAGY+T+S +++++ ++LA N +   KL  EID  F             Y  ++++ YL+ V+ E+LR YP    I  R+   ++ T   NG  IPKD  ++V    +H D +LW   +P  F PERF + N D ++      P  ++PFG GPRNCIG R AL+++KL +  ++  +  +  + TE P ++ +   + P   + L +  R
Sbjct:   15 LVAFI-TLLLVYAYWPYGTFKRLGIPGPKPVPFFGTMLAYRKG-FFNFDEECRKKYGKTWGIYDGRQPVLCITDPATIKAVLVKECYSLFTNRRNFRLN-GPLYD---AVSIAEDDQWKRIRSVLSPSFTSGRLKEMFDIMKHHSANLIQSMKKKVDKD-EPLEMKEYFGPYSMDVVTSTAFSVDIDSLNNPSDPFVTNIKKMLKFDFLNPLFLAVAF-FPFLGPI----LEKFEFSLFPSSVMDFFFAALRKIKANHENNKQKS---RIDFLQLMIDSQKNNQNGLQD----------------------------KGLSDHEILSQAMIFIFAGYETTSSSLTFLAYNLATNPEVMKKLQKEIDATFPNKAPVQ------YVPLMEMEYLDCVVNESLRLYP----IAARLERVAKATVEVNGLVIPKDMVVMVPTWPLHRDPELW--PEPEKFKPERFSKENKDTFD------PYTYMPFGAGPRNCIGMRFALVMMKLAVVEILQTYDFSVCKETEVPFEMDVQGFLAPKRPIQLKLTPR 497          
BLAST of Cytochrome P450 vs. Ensembl Medaka
Match: ENSORLT00000004982.2 (cytochrome P450 3A30 [Source:NCBI gene;Acc:101157802])

HSP 1 Score: 209.149 bits (531), Expect = 4.262e-60
Identity = 150/522 (28.74%), Postives = 260/522 (49.81%), Query Frame = 2
Query:   95 SLVAFLFTLFYVYRRRKISLFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQ-FSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIF-IYMMERFNSGISQKINFLKIRSTLLQIINARKKSSEKRFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQ 1654
            +L+A +FT+  ++      +F    I GP P    GNL++ +   F+E   + + KYG V+  FEG  P +++ DP++++ V+VK+ +S F  R+ F     P  +  AS   A+ ++WKR+RS+++P F+  +++++  ++ +  D L+ KL E      ++I+I   +   T+D++    F ++ +C  N +DP  V  +     T F+ L   L    P    +  ++ +E   S      N       +  + +  K     R D LQ+L++SE+ D                     EIK +   P   SK LT  E++  A  F+  GYDT+S A+SYI + LA N DA + L  EID   ++    +      Y+ +  L YL+ VI E+LR YP V+  ++R C   + T  + G  +P+   + + V+ +H D   W    P +F PERF + N  E       NP  ++PFG GPRNC+G R A++++K+ +  L+ ++ +   + T  P+Q
Sbjct:   28 TLLALIFTILLLFGIWPFRIFQNMGISGPMPMPYVGNLLQ-QGKGFFEFDHECQTKYGDVWGVFEGRQPILMVADPEIIKTVMVKECYSAFTNRRNFFEGDGPLTEAVAS---AKDEKWKRIRSSLSPCFTSGRLKQVFSIVSRYADRLVEKLGETYLN--KAIDIRQFVAPYTLDVVASASFSVDPDCINNPDDPINVQAQK---ATRFNFLPTILQSIIPFGGRLLKLFKIETLPSA-----NVEFFIDIIRNLKDQHKTGKMNRPDFLQVLIESEMPDA--------------------EIKNSQQQP---SKGLTETEILSQALGFIVGGYDTTSTALSYIFYCLATNTDAMHTLQKEIDSNLQKNSSIS------YEDLNGLEYLDQVINESLRLYP-VAPRLDREC---KMTVETQGFTVPEGMIVGIPVYLLHKDPRFWS--SPELFRPERFSKENEGEL------NPYAYMPFGLGPRNCVGMRFAVLMMKMIIVRLLQRYSVETCKYTLIPMQ 494          
BLAST of Cytochrome P450 vs. Planmine SMEST
Match: SMESG000060680.1 (SMESG000060680.1)

HSP 1 Score: 1094.34 bits (2829), Expect = 0.000e+0
Identity = 544/547 (99.45%), Postives = 545/547 (99.63%), Query Frame = 2
Query:   80 MFIFISLVAFLFTLFYVYRRRKISLFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQFSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGISQKINFLKIRSTLLQIINARKKSSEKRFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGIRERKI 1720
            MFIFISLV FLFTLFYVYRRRKISLFSQYNI GPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQFSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSI+VLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGISQKINFLKIRSTLLQIINARKKSSEKRFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFKELEEKNLNSLEFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGIRERKI
Sbjct:    1 MFIFISLVVFLFTLFYVYRRRKISLFSQYNIRGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQFSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSINVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGISQKINFLKIRSTLLQIINARKKSSEKRFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFKELEEKNLNSLEFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGIRERKI 547          
BLAST of Cytochrome P450 vs. Planmine SMEST
Match: SMESG000060689.1 (SMESG000060689.1)

HSP 1 Score: 689.108 bits (1777), Expect = 0.000e+0
Identity = 329/557 (59.07%), Postives = 425/557 (76.30%), Query Frame = 2
Query:   80 MFIFISLVAFLFTLFYVYRRRKISLFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQFSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGISQKINFLKIRSTLLQIINARKKSSEKRFDLLQLLLDSEVTDKKMIDE------------NAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGIRER 1714
            M IF+SL+    +LFY YRRR+ + F++YNI GPPPNF+FGNLIEYR+  FYEL  KW++++GKVFVYFEGPTPNVVIGDPDLLQ+V+VKQFSNFHGRKLFP QKNPDEDEK SMF ARGKRWKRLR+TINPAFSD+KMRRM P++++SI   + KL+E   K  + I I + +QRLTMDIICKC FG++T+CQ N+N PFIVSLK FL   N S+LK A++LT  EIK + +Y++E FN    Q++  +KIRSTL+Q+I AR+K SEKRFDLLQ+L+D+EV   K++DE            N  ES    +  DE+  +      K  SK LTTEEVI  A LF+FAGY+TSS A+S+ILHSL+V  D Q+KL  EI  + +++E+K++ S E YD++ +LPYLNA+IYETLRFYPF ST+++RMCLKSEGTHLSNG YIP+ T +I NV ++H+DKD+W   DPH F PERFLQ NG E EF+ P NP  WLPFG GPRNCIG+R A+M+I+ TL   +++F+++ ++ TENPL+LK+G TI P NGVN+ +++R
Sbjct:    1 MLIFVSLLLTFLSLFYFYRRRRFASFAKYNIPGPPPNFLFGNLIEYRNNTFYELLIKWQKEFGKVFVYFEGPTPNVVIGDPDLLQEVMVKQFSNFHGRKLFPMQKNPDEDEKVSMFLARGKRWKRLRTTINPAFSDAKMRRMFPMVDESIASFVNKLNERGDKKFDCINIQEYLQRLTMDIICKCAFGVDTDCQTNINHPFIVSLKKFLKEMNLSTLKAAVVLTLAEIKPVLVYLLEAFNQRPGQRVELMKIRSTLVQVIEARRKCSEKRFDLLQMLIDAEVPGTKILDEDNLCPMNDNTSLNQAESQTDEEKTDEEITEQTSSNQKKTSKPLTTEEVIAQANLFLFAGYETSSTALSFILHSLSVYPDVQDKLFQEISRLHEKIEDKSIGSRELYDALGRLPYLNALIYETLRFYPFASTVIHRMCLKSEGTHLSNGLYIPQGTFVIPNVFAIHYDKDIWTSVDPHTFSPERFLQSNGTELEFIGPPNPFAWLPFGAGPRNCIGQRFAMMVIRATLCQFVYRFQVSSTEKTENPLKLKVGATISPINGVNIVLKKR 557          
BLAST of Cytochrome P450 vs. Planmine SMEST
Match: SMESG000013786.1 (SMESG000013786.1)

HSP 1 Score: 218.009 bits (554), Expect = 1.691e-63
Identity = 154/546 (28.21%), Postives = 269/546 (49.27%), Query Frame = 2
Query:   98 LVAFLFT-LFYVYRRRKISLFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQFSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGISQKINFLKIRSTLLQIINARKKSSEKRFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYI--PKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERF----LQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGIRER 1714
            L+AF+   L Y + ++  +L  +    GPPP    GNL++ +   F+       +KYGK++  + G +P  V+GD +LL+ +++K+F  F  R    F+   D      +    GK W+R+R+ I P F+  K+R+M PLI   I++L  ++          I+I +    LTMD+I + +FG++ + Q N    F+++ K     + F+S  +  LL FP++  +F  ++ ++     +   F      +   I+ R KS++K  D L L++ +     K   EN  ESS L                 M+SK L+ +E++  + +F+ AGY+T++  ++++ + LA N DAQ  L +EI E      E         D+++ +P L+A++ E+LR  P  +  ++R+C +      S+   +   K   I + +++VH D  +W   DP  F   RF     + NG +Y F         +PFG GPRNC+G R AL+ +K  +  ++  F I P Q T   L  K+   + P + + L I +R
Sbjct:   15 LLAFVVVYLIYKFGKQNQNLHVKLGHNGPPPLPFLGNLLDVQKMGFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKEFKCFTDRMELAFRSKRDHKMLTDL---NGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPPN--TPIDIKEFFGALTMDVIARTMFGLQIDSQTNPKSQFVINAKKLFTFSFFNSFVIIFLL-FPKLGILFRKILPKWEFFGKESFQFF--IDNMQMAIDERAKSTDKYNDFLALMMKAH----KKETENDSESSKL-----------------MDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIPN------DTLMTMPILDAIVCESLRICP-PAVRVDRVCTQDVTLETSDKTKVCFKKGDIIAIPIYAVHSDPSIW--PDPEKFDYHRFDPDHKKTNG-QYSF---------MPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLEKLTFKISVLLGPISPILLKIVKR 512          
BLAST of Cytochrome P450 vs. Planmine SMEST
Match: SMESG000013783.1 (SMESG000013783.1)

HSP 1 Score: 217.238 bits (552), Expect = 2.982e-63
Identity = 154/545 (28.26%), Postives = 272/545 (49.91%), Query Frame = 2
Query:   98 LVAFLFT-LFYVYRRRKISLFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQFSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGISQKINFLKIRSTLLQIINARKKSSEKRFDLLQLLLDSEVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYI--PKDTNIIVNVHSVHFDKDLW-GPH--DPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGIRER 1714
            L+AF+   L Y + ++  +L  +    GPPP    GNL++ +   F+       +KYGK++  + G +P  V+GD +LL+ +++K+F  F  R    F+    +     +   +GK W+R+R+ I P F+  K+R+M PLI   I++L  ++          I+I +    LTMD+I + +FG++ + Q N N+ F+++ K     + F+S  + + L FP++  +F  ++ ++     +   F      +   I+ R KS++K  D L L+        K   EN  ESS L                 M+SK L+ +E++  + +F+ AGY+T++  ++++ + LA N DAQ  L +EI E      E         D+++ +P L+A++ E+LR  P  +  ++R+C +      S+   +   K   I + +++VH D  +W  P   D H F P+R  + NG +Y F         +PFG GPRNC+G R AL+ +K  +  ++  F I P Q T   L  K+   + P + + L I +R
Sbjct:   15 LLAFVVVYLIYKFGKQNQNLHVKLGHNGPPPLPFLGNLLDVQKMGFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKEFKCFTDRMELAFR---SKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPPD--TPIDIKEFFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSLFNSF-VIIFLMFPKLGILFRKILPKWEFFGKESFQFF--IDNMQMAIDERAKSTDKYNDFLALM-----KAHKKETENDSESSKL-----------------MDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIAN------DTLMTMPILDAIVCESLRICP-PAVRVDRVCTQDVTLETSDKTKVCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDR-KKTNG-QYSF---------MPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLEKLTFKISGLLSPISPILLKIVKR 511          
BLAST of Cytochrome P450 vs. Planmine SMEST
Match: SMESG000013752.1 (SMESG000013752.1)

HSP 1 Score: 214.927 bits (546), Expect = 2.002e-62
Identity = 160/545 (29.36%), Postives = 275/545 (50.46%), Query Frame = 2
Query:   98 LVAFLFTLFYVYR--RRKISLFSQYNILGPPPNFIFGNLIEYRSTVFYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQFSNFHGRKLFPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSIDVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDPFIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGISQKINFLKIRSTLLQIINARKKSSEKRFDLLQLLLDS--EVTDKKMIDENAIESSNLMKFEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILHSLAVNYDAQNKLTSEIDEVFXXXXXXXXXXXXFYDSIVKLPYLNAVIYETLRFYPFVSTIMNRMCLKSEGTHLSNGQYI--PKDTNIIVNVHSVHFDKDLWGPHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMIIKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGIRER 1714
            L+     +F +Y+    K +L  +    GPPP   FGN  +      YEL      KYGK++ ++ G  P  ++ D +LL+ +L+K    F  R       N    +K  +   +GK W+R+R+ ++P F+  K+R+M PL++  ID+L  +L    +   + I++ DV   LTMD+I + +FG+  + Q N N+PFI++ K     + F+ + + L+L FPEI  IF      +     Q +NF    S L + ++ RKKS E+  D L  ++ +  EV D                  D ++++       ++S+ LT  E+I  + LF+ AGY+T++ +++Y+ + LA N +AQ ++  EI +VF   EE +      Y+ I  LP+L A I E+LR  P  S + +R+C +      S+ + I   K     V ++++H D ++W   +P+ F   RF      + E     +   ++PFG GPRNC+G R A++ +K+ L +L+ QF + P   T + ++ K      P   + L I +R
Sbjct:   10 LLLCFVVIFLIYKLGTLKQNLHKKLGHQGPPPLPFFGNFFDIIRHGLYELDIINRDKYGKIYPFYFGGIPISIVSDEELLKQILIKDAKCFTDR--LDIGSNGKIGQKM-LIILKGKSWERVRNLVSPTFTSGKLRKMSPLMKDCIDLLDKRLAGIPEN--DPIDVKDVFGALTMDMIARTMFGMHIDSQTNPNNPFIINAKKLFKFSLFNPM-LILILFFPEITPIFRKFFPNWEFLGRQTMNFF--VSNLNKAMDERKKSPEQYNDFLTEMMKAHKEVND-----------------SDPEQLEI------LDSRSLTNSEIIAQSFLFLLAGYETTATSLTYVAYFLAKNPEAQQEVYREIIKVFGTDEEIS------YEKISNLPFLEAAINESLRICPPASRV-DRVCTEDVVLVTSDNKQINAKKGDVFTVPIYAIHMDPEIW--PEPYKFDLSRF------DNESKKTRSIYSFMPFGMGPRNCVGMRFAVLEMKMALVNLLKQFELVPCAETLDVIKFKKTAFGGPVKPIILKIVKR 508          
The following BLAST results are available for this feature:
BLAST of Cytochrome P450 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CYP3A42.640e-7431.20cytochrome P450 family 3 subfamily A member 4 [Sou... [more]
CYP3A51.073e-7331.53cytochrome P450 family 3 subfamily A member 5 [Sou... [more]
CYP3A74.097e-7130.71cytochrome P450 family 3 subfamily A member 7 [Sou... [more]
CYP3A41.970e-6929.80cytochrome P450 family 3 subfamily A member 4 [Sou... [more]
CYP3A71.020e-6830.34cytochrome P450 family 3 subfamily A member 7 [Sou... [more]
back to top
BLAST of Cytochrome P450 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp-13A127.354e-6829.64CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
cyp-13A41.010e-6730.87Putative cytochrome P450 CYP13A4 [Source:UniProtK... [more]
cyp-13A102.043e-6728.03Putative cytochrome P450 CYP13A10 [Source:UniProt... [more]
cyp-13A82.247e-6629.94Putative cytochrome P450 CYP13A8 [Source:UniProtK... [more]
cyp-13A25.071e-6628.44Putative cytochrome P450 CYP13A2 [Source:UniProtK... [more]
back to top
BLAST of Cytochrome P450 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cyp6a21.006e-5529.89gene:FBgn0000473 transcript:FBtr0086133[more]
Cyp6a137.803e-5528.65gene:FBgn0033304 transcript:FBtr0088690[more]
Cyp6a231.316e-5326.68gene:FBgn0033978 transcript:FBtr0087452[more]
Cyp6a84.829e-5327.65gene:FBgn0013772 transcript:FBtr0087455[more]
Cyp6w11.046e-5127.81gene:FBgn0033065 transcript:FBtr0085987[more]
back to top
BLAST of Cytochrome P450 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbxas13.772e-7332.05thromboxane A synthase 1 (platelet) [Source:ZFIN;A... [more]
cyp3c32.009e-6329.39cytochrome P450, family 3, subfamily c, polypeptid... [more]
cyp3a656.057e-6027.41cytochrome P450, family 3, subfamily A, polypeptid... [more]
cyp3c37.080e-5628.07cytochrome P450, family 3, subfamily c, polypeptid... [more]
cyp3c31.844e-5528.12cytochrome P450, family 3, subfamily c, polypeptid... [more]
back to top
BLAST of Cytochrome P450 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp3a51.847e-6128.88cytochrome P450 3A29-like [Source:NCBI gene;Acc:10... [more]
cyp3a52.300e-6128.57cytochrome P450 3A29-like [Source:NCBI gene;Acc:10... [more]
ENSXETT00000012846.12.371e-6028.38cytochrome P450 3A8-like [Source:NCBI gene;Acc:100... [more]
cyp3a56.377e-6028.83cytochrome P450 3A29-like [Source:NCBI gene;Acc:10... [more]
ndrg32.053e-5928.63NDRG family member 3 [Source:Xenbase;Acc:XB-GENE-5... [more]
back to top
BLAST of Cytochrome P450 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cyp3a111.260e-7430.31cytochrome P450, family 3, subfamily a, polypeptid... [more]
Cyp3a134.696e-7129.57cytochrome P450, family 3, subfamily a, polypeptid... [more]
Cyp3a41a2.205e-6929.59cytochrome P450, family 3, subfamily a, polypeptid... [more]
Cyp3a41b2.205e-6929.59cytochrome P450, family 3, subfamily a, polypeptid... [more]
Cyp3a255.282e-6929.66cytochrome P450, family 3, subfamily a, polypeptid... [more]
back to top
BLAST of Cytochrome P450 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q29496|CP3AO_SHEEP2.882e-7631.79Cytochrome P450 3A24 OS=Ovis aries OX=9940 GN=CYP3... [more]
sp|P11707|CP3A6_RABIT7.919e-7432.19Cytochrome P450 3A6 OS=Oryctolagus cuniculus OX=99... [more]
sp|Q64459|CP3AB_MOUSE8.815e-7430.31Cytochrome P450 3A11 OS=Mus musculus OX=10090 GN=C... [more]
sp|P08684|CP3A4_HUMAN1.268e-7331.20Cytochrome P450 3A4 OS=Homo sapiens OX=9606 GN=CYP... [more]
sp|P20815|CP3A5_HUMAN5.152e-7331.53Cytochrome P450 3A5 OS=Homo sapiens OX=9606 GN=CYP... [more]
back to top
BLAST of Cytochrome P450 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1PQG21.958e-11238.48Putative cytochrome P450 CYP13A5 (Fragment) OS=Cra... [more]
A0A210QVL01.951e-10936.63Cytochrome P450 3A24 OS=Mizuhopecten yessoensis OX... [more]
A0A2C9K0E01.105e-10735.82Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A1S3JCI63.212e-10333.68cytochrome P450 3A29 OS=Lingula unguis OX=7574 GN=... [more]
A0A2C9K0E73.224e-10336.00Uncharacterized protein OS=Biomphalaria glabrata O... [more]
back to top
BLAST of Cytochrome P450 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000056570.11.788e-6629.14cytochrome P450 3A56-like [Source:NCBI gene;Acc:10... [more]
ENSAMXT00000012911.22.007e-6328.96cytochrome P450 3A56-like [Source:NCBI gene;Acc:10... [more]
tbxas13.556e-6329.13thromboxane A synthase 1 (platelet) [Source:ZFIN;A... [more]
cyp3a658.407e-6127.48cytochrome P450 3A30-like [Source:NCBI gene;Acc:10... [more]
ENSAMXT00000055169.11.523e-5829.17cytochrome P450 3A30-like [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Cytochrome P450 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004192.18.806e-5428.07pep scaffold:Pmarinus_7.0:GL501190:14217:30704:1 g... [more]
ENSPMAT00000010515.12.678e-5127.87pep scaffold:Pmarinus_7.0:GL494623:61763:74387:-1 ... [more]
ENSPMAT00000010493.14.075e-5126.53pep scaffold:Pmarinus_7.0:GL494623:34025:53335:-1 ... [more]
cyp4t83.584e-3324.64cytochrome P450, family 4, subfamily T, polypeptid... [more]
ENSPMAT00000000063.14.655e-2929.37pep scaffold:Pmarinus_7.0:GL478178:2662:7225:1 gen... [more]
back to top
BLAST of Cytochrome P450 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
DIT21.195e-1322.09N-formyltyrosine oxidase; sporulation-specific mic... [more]
ERG113.880e-1021.41Lanosterol 14-alpha-demethylase; catalyzes C-14 de... [more]
ERG58.623e-926.92C-22 sterol desaturase; a cytochrome P450 enzyme t... [more]
back to top
BLAST of Cytochrome P450 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO464491.135e-7832.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO360237.654e-7231.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302638.309e-6531.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO360043.594e-6427.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO335589.627e-6432.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cytochrome P450 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbxas13.502e-7731.57thromboxane A synthase 1 [Source:NCBI gene;Acc:101... [more]
cyp3a1.380e-6328.91cytochrome P450, family 3, subfamily A [Source:NCB... [more]
cyp3a402.421e-6328.49cytochrome P450 3A40 [Source:NCBI gene;Acc:1001258... [more]
cyp3a401.515e-6227.94cytochrome P450 3A40 [Source:NCBI gene;Acc:1001258... [more]
ENSORLT00000004982.24.262e-6028.74cytochrome P450 3A30 [Source:NCBI gene;Acc:1011578... [more]
back to top
BLAST of Cytochrome P450 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000060680.10.000e+099.45SMESG000060680.1[more]
SMESG000060689.10.000e+059.07SMESG000060689.1[more]
SMESG000013786.11.691e-6328.21SMESG000013786.1[more]
SMESG000013783.12.982e-6328.26SMESG000013783.1[more]
SMESG000013752.12.002e-6229.36SMESG000013752.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016464 ID=SMED30016464|Name=Cytochrome P450|organism=Schmidtea mediterranea sexual|type=transcript|length=1796bp
AAATGTATACTTGTTTTATTTGAGTTTATTCATATTTTGAAACAGAAAAT
AAATTATATTCATTAAAGCAAATTGAGTCATGTTTATTTTTATTTCTCTG
GTCGCATTTCTTTTTACTCTATTCTATGTTTATCGCCGAAGAAAGATTTC
ATTATTTAGTCAATATAACATTCTAGGCCCTCCTCCGAATTTTATTTTCG
GAAATTTGATTGAATACAGGAGCACTGTTTTCTATGAGCTCTTTGCTAAA
TGGGAAAGAAAATATGGAAAGGTTTTTGTTTACTTCGAAGGACCCACTCC
GAATGTTGTGATTGGAGATCCGGACTTACTTCAGGACGTGTTGGTGAAGC
AGTTCAGTAATTTTCATGGAAGAAAATTATTTCCTTTTCAAAAGAATCCC
GATGAAGATGAAAAGGCAAGTATGTTTTTTGCAAGAGGGAAGCGTTGGAA
GCGACTAAGATCCACCATTAATCCAGCCTTTTCTGACTCTAAAATGCGTC
GTATGCTACCTCTTATAGAACAATCAATTGATGTTCTTATGACAAAACTT
CATGAAGAATCCCAGAAACATATCGAGAGCATAGAAATTATGGACGTAAT
GCAAAGGTTAACAATGGACATTATTTGCAAATGCGTGTTTGGTATTGAAA
CCAACTGCCAGCTAAATGTTAATGATCCATTCATTGTTTCTCTGAAAGCT
TTTCTTGGGGGAACCAATTTTTCATCCCTCAAAATGGCACTGCTTCTCAC
ATTTCCAGAAATAAAGTCAATTTTTATATATATGATGGAAAGATTTAACA
GCGGAATATCTCAGAAAATTAATTTTCTTAAAATTCGGTCCACATTATTG
CAGATAATCAACGCTCGCAAAAAATCCTCTGAAAAACGTTTTGATCTATT
ACAACTGCTTTTAGATTCTGAAGTAACCGATAAAAAAATGATTGATGAGA
ATGCAATCGAAAGTAGTAACCTAATGAAATTTGAAGACGAAAAGGAAATC
AAAACCAATATCCCAATGCCAAAGATGAATTCTAAGCAATTAACCACGGA
AGAAGTTATTGGAACGGCAACTTTGTTTGTGTTTGCGGGATATGATACAA
GTTCAATGGCTATGTCCTACATTCTACATTCTTTAGCTGTAAACTATGAT
GCCCAAAATAAACTGACTTCGGAAATTGATGAGGTTTTTAAAGAACTCGA
AGAGAAAAATTTAAATTCATTAGAATTTTATGACAGTATTGTCAAATTGC
CATACCTTAATGCTGTCATTTATGAAACTCTCCGATTCTACCCTTTTGTG
TCGACAATCATGAACAGAATGTGTCTGAAATCTGAAGGAACGCATTTATC
TAACGGTCAGTATATTCCGAAAGACACGAATATCATAGTAAATGTGCATT
CTGTTCATTTTGATAAGGACCTTTGGGGTCCTCATGACCCTCACATTTTT
TATCCGGAAAGATTTTTGCAAATCAATGGTGATGAATATGAATTTGTTGC
TCCAACTAATCCTTTGATTTGGCTACCTTTTGGAGGAGGACCGAGAAATT
GCATTGGAAAGAGACTGGCTTTAATGATTATAAAATTGACATTAAGTCAT
TTAATTCACCAATTTCGCATCACTCCTTCTCAAAACACTGAGAATCCACT
GCAACTTAAACTCGGTACAACCATTTGCCCTGCTAACGGAGTTAATTTAG
GAATTAGAGAAAGAAAAATTTGAAGGCTTCGCTTCATATGCTGGTGAACA
TTATAGCAAAACTTTACTTTAGTGATCTATTTTAATGAAATAGATC
back to top

protein sequence of SMED30016464-orf-1

>SMED30016464-orf-1 ID=SMED30016464-orf-1|Name=SMED30016464-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=548bp
MFIFISLVAFLFTLFYVYRRRKISLFSQYNILGPPPNFIFGNLIEYRSTV
FYELFAKWERKYGKVFVYFEGPTPNVVIGDPDLLQDVLVKQFSNFHGRKL
FPFQKNPDEDEKASMFFARGKRWKRLRSTINPAFSDSKMRRMLPLIEQSI
DVLMTKLHEESQKHIESIEIMDVMQRLTMDIICKCVFGIETNCQLNVNDP
FIVSLKAFLGGTNFSSLKMALLLTFPEIKSIFIYMMERFNSGISQKINFL
KIRSTLLQIINARKKSSEKRFDLLQLLLDSEVTDKKMIDENAIESSNLMK
FEDEKEIKTNIPMPKMNSKQLTTEEVIGTATLFVFAGYDTSSMAMSYILH
SLAVNYDAQNKLTSEIDEVFKELEEKNLNSLEFYDSIVKLPYLNAVIYET
LRFYPFVSTIMNRMCLKSEGTHLSNGQYIPKDTNIIVNVHSVHFDKDLWG
PHDPHIFYPERFLQINGDEYEFVAPTNPLIWLPFGGGPRNCIGKRLALMI
IKLTLSHLIHQFRITPSQNTENPLQLKLGTTICPANGVNLGIRERKI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR036396Cyt_P450_sf
IPR001128Cyt_P450
IPR002401Cyt_P450_E_grp-I
IPR017972Cyt_P450_CS
Vocabulary: molecular function
TermDefinition
GO:0020037heme binding
GO:0016705oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0005506iron ion binding
GO:0004497monooxygenase activity
GO:0016491oxidoreductase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 359..379
NoneNo IPR availablePANTHERPTHR24302:SF15coord: 7..535
NoneNo IPR availablePANTHERPTHR24302FAMILY NOT NAMEDcoord: 7..535
NoneNo IPR availableTMHMMTMhelixcoord: 2..19
IPR001128Cytochrome P450PRINTSPR00385P450coord: 336..353
score: 34.46
coord: 395..406
score: 48.7
coord: 482..491
score: 62.73
coord: 491..502
score: 41.95
IPR001128Cytochrome P450PFAMPF00067p450coord: 32..527
e-value: 5.2E-91
score: 305.7
IPR002401Cytochrome P450, E-class, group IPRINTSPR00463EP450Icoord: 481..491
score: 50.98
coord: 394..412
score: 31.77
coord: 345..371
score: 24.3
coord: 491..514
score: 31.46
coord: 59..78
score: 35.41
coord: 325..342
score: 27.02
coord: 83..104
score: 24.38
IPR036396Cytochrome P450 superfamilyGENE3DG3DSA:1.10.630.10coord: 14..547
e-value: 5.6E-129
score: 432.8
IPR036396Cytochrome P450 superfamilySUPERFAMILYSSF48264Cytochrome P450coord: 33..545
IPR017972Cytochrome P450, conserved sitePROSITEPS00086CYTOCHROME_P450coord: 484..493