SMED30016458

Overview
NameSMED30016458
Smed IDSMED30016458
Length (bp)4980
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30016458 (SMED30016458) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30016458 (SMED30016458) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30016458 (SMED30016458) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30016458 (SMED30016458) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016458

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30016458SMESG000074522.1 SmedASXL_011968SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30016458SMESG000074522.1 SMESG000074521.1 SmedASXL_015333SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30016458SMESG000074522.1 SMESG000074521.1 dd_Smed_v4_1967_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30016458SMESG000074522.1 SMESG000074521.1 dd_Smed_v4_1967_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30016458SMESG000074521.1 Contig22528newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30016458SMESG000074521.1 Contig22528uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
pigment cellSMED30016458SMESG000074522.1 SMESG000074521.1 dd_Smed_v6_1967_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30016458SMESG000074522.1 SMESG000074521.1 dd_Smed_v6_1967_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
glial cellSMED30016458SMESG000074522.1 SMESG000074521.1 dd_Smed_v6_1967_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30016458 vs. Ensembl Human
Match: TLL1 (tolloid like 1 [Source:HGNC Symbol;Acc:HGNC:11843])

HSP 1 Score: 82.4185 bits (202), Expect = 1.265e-15
Identity = 55/175 (31.43%), Postives = 81/175 (46.29%), Query Frame = -1
Query: 4390 RSKRAVVVKSADQWPDGVIPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQ-NCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSF 4911
            R  RA   ++   WP GVIPY I  N F   + +  + A+  W   TCV F ++R  + +++  T     C S VG      Q +++    C            ++G+ +HELGH IG  HEH R  RD+++ I+ ENIQ      F K    +       +D  SIMHY   +F
Sbjct:  144 RVPRAATSRTERIWPGGVIPYVIGGN-FTGSQRAMFKQAMRHWEKHTCVTF-IERSDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGK-NCD-----------KFGIVVHELGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFLKMEPGEVNSLGERYDFDSIMHYARNTF 304          
BLAST of SMED30016458 vs. Ensembl Human
Match: TLL1 (tolloid like 1 [Source:HGNC Symbol;Acc:HGNC:11843])

HSP 1 Score: 83.9593 bits (206), Expect = 2.137e-15
Identity = 55/175 (31.43%), Postives = 81/175 (46.29%), Query Frame = -1
Query: 4390 RSKRAVVVKSADQWPDGVIPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQ-NCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSF 4911
            R  RA   ++   WP GVIPY I  N F   + +  + A+  W   TCV F ++R  + +++  T     C S VG      Q +++    C            ++G+ +HELGH IG  HEH R  RD+++ I+ ENIQ      F K    +       +D  SIMHY   +F
Sbjct:  144 RVPRAATSRTERIWPGGVIPYVIGGN-FTGSQRAMFKQAMRHWEKHTCVTF-IERSDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGK-NCD-----------KFGIVVHELGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFLKMEPGEVNSLGERYDFDSIMHYARNTF 304          
BLAST of SMED30016458 vs. Ensembl Human
Match: TLL1 (tolloid like 1 [Source:HGNC Symbol;Acc:HGNC:11843])

HSP 1 Score: 83.9593 bits (206), Expect = 2.181e-15
Identity = 55/175 (31.43%), Postives = 81/175 (46.29%), Query Frame = -1
Query: 4390 RSKRAVVVKSADQWPDGVIPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQ-NCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSF 4911
            R  RA   ++   WP GVIPY I  N F   + +  + A+  W   TCV F ++R  + +++  T     C S VG      Q +++    C            ++G+ +HELGH IG  HEH R  RD+++ I+ ENIQ      F K    +       +D  SIMHY   +F
Sbjct:  144 RVPRAATSRTERIWPGGVIPYVIGGN-FTGSQRAMFKQAMRHWEKHTCVTF-IERSDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGK-NCD-----------KFGIVVHELGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFLKMEPGEVNSLGERYDFDSIMHYARNTF 304          
BLAST of SMED30016458 vs. Ensembl Human
Match: TLL2 (tolloid like 2 [Source:HGNC Symbol;Acc:HGNC:11844])

HSP 1 Score: 82.4185 bits (202), Expect = 5.435e-15
Identity = 53/177 (29.94%), Postives = 81/177 (45.76%), Query Frame = -1
Query: 4390 TTRSKRAVVVKSADQWPDGVIPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQ-NCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSF 4917
            + R +RA   ++   WP GVIPY I  N F   + +  + A+  W   TCV F ++R  + +++  +     C S VG      Q +++    C            ++G+  HELGH +G  HEH R  RD ++ I+ ENIQ      F K    +       +D  SIMHY   +F
Sbjct:  144 SPRVRRATTSRTERIWPGGVIPYVIGGN-FTGSQRAIFKQAMRHWEKHTCVTF-IERTDEESFIVFSYRTCGCCSYVGRRGGGPQAISIGK-NCD-----------KFGIVAHELGHVVGFWHEHTRPDRDQHVTIIRENIQPGQEYNFLKMEAGEVSSLGETYDFDSIMHYARNTF 306          
BLAST of SMED30016458 vs. Ensembl Human
Match: BMP1 (bone morphogenetic protein 1 [Source:HGNC Symbol;Acc:HGNC:1067])

HSP 1 Score: 82.0333 bits (201), Expect = 5.910e-15
Identity = 53/170 (31.18%), Postives = 74/170 (43.53%), Query Frame = -1
Query: 4390 AVVVKSADQWPDGVIPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQNCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSF 4899
            A   +    WPDGVIP+ I  N F   + +  + A+  W   TCV F  + + D   V       C S VG      Q +++    C            ++G+ +HELGH +G  HEH R  RD ++ IV ENIQ      F K    +       +D  SIMHY   +F
Sbjct:  121 AATSRPERVWPDGVIPFVIGGN-FTGSQRAVFRQAMRHWEKHTCVTFLERTDEDSYIVFTYRPCGCCSYVGRRGGGPQAISIGK-NCD-----------KFGIVVHELGHVVGFWHEHTRPDRDRHVSIVRENIQPGQEYNFLKMEPQEVESLGETYDFDSIMHYARNTF 277          
BLAST of SMED30016458 vs. Ensembl Celegans
Match: tyr-3 (Putative tyrosinase-like protein tyr-3 [Source:UniProtKB/Swiss-Prot;Acc:Q19673])

HSP 1 Score: 105.916 bits (263), Expect = 8.103e-23
Identity = 76/217 (35.02%), Postives = 101/217 (46.54%), Query Frame = -1
Query: 2194 INKNSECDKWSQMGECSKNPNYMLVNCAKSCNYCKFNKDLQKNCVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSCDSERE--CLNTHNDAECSKWSSMGECTKNPKYMLVNCAXXXXXXXXXNTDKGTCSNINSDKECENWSKRGECAKNPKYMLINCAKSCNSCESATQLPTACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVC 2838
             N+N  C  WS  GEC KNP YM V C  SC  C  N ++ + C + H  + C  WS+ GEC KNP +M  NC  SC+ C   R   C         S  ++M   T N               +++  D   C   N D+ C  W++RG+C  NP YM   C  SC  C     +   C + H    +C  W+ +GEC KN  +M ENC +SCN C
Sbjct:  473 FNENECCGPWSAKGECQKNPVYMNVWCKASCRQCTPNYNINEECSDRH--TNCAMWSRSGECNKNPLWMSENCRSSCQKCGRSRAATCGGGGGADSISNPTTMPPATNN-------------GQQNTPCDSPMC--YNEDQCCPIWAQRGQCRSNPGYMTCQCKVSCGVCR-PNYVYGPCADYHY---DCAAWARRGECLKN-KWMPENCRRSCNTC 667          

HSP 2 Score: 103.605 bits (257), Expect = 5.371e-22
Identity = 72/200 (36.00%), Postives = 100/200 (50.00%), Query Frame = -1
Query: 2584 CDKWSKLGECQKNPNYMLLNCAKSCNNCDLIPSDGKDCFNIYRNDKCEKWSNAGECSKNPKFMLENCAKSCNNCKTSQQ----------NDSNCV-------NINKNSECDK------------WSQMGECSKNPNYMLVNCAKSCNYCKFNKDLQKNCVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSCDSERE 3096
            C  WS  GECQKNP YM + C  SC  C    +  ++C +  R+  C  WS +GEC+KNP +M ENC  SC  C  S+           + SN         N  +N+ CD             W+Q G+C  NP YM   C  SC  C+ N  +   C + H D  C +W++RGEC KN K+M  NC +SC +C ++++
Sbjct:  479 CGPWSAKGECQKNPVYMNVWCKASCRQCTPNYNINEECSD--RHTNCAMWSRSGECNKNPLWMSENCRSSCQKCGRSRAATCGGGGGADSISNPTTMPPATNNGQQNTPCDSPMCYNEDQCCPIWAQRGQCRSNPGYMTCQCKVSCGVCRPNY-VYGPCADYHYD--CAAWARRGECLKN-KWMPENCRRSCNTCVNQQQ 672          

HSP 3 Score: 82.0333 bits (201), Expect = 2.177e-15
Identity = 66/208 (31.73%), Postives = 84/208 (40.38%), Query Frame = -1
Query: 1387 CKAWKDLGECFKNPVFMLSKCSQTCGSCDMEKNPVVVETCKNIDSNENCNTWQTAGECEKNPNYMLVNCAKACKTCQKDDAKNVEKKCDDVYSDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTCDQLKNNQTMCQNAYNDAICTKWKNMGECTKNPNFMLIQCKESCGKCEKLPKNTNCINLDNDKNCEKWAGENECTKNSKYMLERC 2010
            C  W   GEC KNPV+M   C  +C  C    N  + E C   D + NC  W  +GEC KNP +M  NC  +C+ C +  A                    A+ +    ++       +    CD       MC N   D  C  W   G+C  NP +M  QCK SCG C   P        D   +C  WA   EC KN K+M E C
Sbjct:  479 CGPWSAKGECQKNPVYMNVWCKASCRQCTPNYN--INEECS--DRHTNCAMWSRSGECNKNPLWMSENCRSSCQKCGRSRAATCGGGG------------GADSISNPTTMPPATNNGQQNTPCDS-----PMCYN--EDQCCPIWAQRGQCRSNPGYMTCQCKVSCGVCR--PNYVYGPCADYHYDCAAWARRGECLKN-KWMPENC 660          

HSP 4 Score: 81.6481 bits (200), Expect = 3.368e-15
Identity = 68/206 (33.01%), Postives = 94/206 (45.63%), Query Frame = -1
Query:   16 FYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSCQNLKFSLKVKCQNILTKEKCLKLKKAGECEKNSKQMAELCAYTCHKCNLSFVKP------MEINQNPTKMRSSK------FKCDNRA---GDFQCSYWARQKQCELNASYMRLFCQKSCGACLMEKPGQV--SCVDKFATMKCFSWSMRGECDRNGKWMTENCAKSCLVCQN 582
            F  N+ C  W+  G+C+ N  +M + C  SC  C    +++  +C +  T   C    ++GEC KN   M+E C  +C KC  S           +   NPT M  +         CD+      D  C  WA++ QC  N  YM   C+ SCG C   +P  V   C D      C +W+ RGEC +N KWM ENC +SC  C N
Sbjct:  473 FNENECCGPWSAKGECQKNPVYMNVWCKASCRQC-TPNYNINEECSDRHT--NCAMWSRSGECNKNPLWMSENCRSSCQKCGRSRAATCGGGGGADSISNPTTMPPATNNGQQNTPCDSPMCYNEDQCCPIWAQRGQCRSNPGYMTCQCKVSCGVC---RPNYVYGPCADYH--YDCAAWARRGECLKN-KWMPENCRRSCNTCVN 669          

HSP 5 Score: 75.0998 bits (183), Expect = 3.465e-13
Identity = 64/203 (31.53%), Postives = 85/203 (41.87%), Query Frame = -1
Query:  340 CDKWAAEGECLKNSKFMIQLCLKSCGRCYDLKNLKVNRTNSDGCENKYGDWSCEAWKQVGECERNPIFMNDQCSKSCGTCFKSTAT---------STSGPLRMSSVCKNFYSNKLCDE------------WTKNGDCKSNSDFMRINCARSCNSCQ-NLKFSLKVKCQNILTKEKCLKLKKAGECEKNSKQMAELCAYTCHKC 882
            C  W+A+GEC KN  +M   C  SC +C    N  +N   SD   N      C  W + GEC +NP++M++ C  SC  C +S A          S S P  M     N   N  CD             W + G C+SN  +M   C  SC  C+ N  +     C +      C    + GEC KN K M E C  +C+ C
Sbjct:  479 CGPWSAKGECQKNPVYMNVWCKASCRQC--TPNYNINEECSDRHTN------CAMWSRSGECNKNPLWMSENCRSSCQKCGRSRAATCGGGGGADSISNPTTMPPATNNGQQNTPCDSPMCYNEDQCCPIWAQRGQCRSNPGYMTCQCKVSCGVCRPNYVYG---PCADY--HYDCAAWARRGECLKN-KWMPENCRRSCNTC 667          

HSP 6 Score: 74.3294 bits (181), Expect = 5.543e-13
Identity = 62/207 (29.95%), Postives = 86/207 (41.55%), Query Frame = -1
Query: 2842 CEEFKSKGECTKNPDFMFIQCAKSCSKCKETKPGNDSLCKNIEKDNNCEQLKIRGECLRNVSYMRVNCAKTCFNC------------------NASVVDKPCVNSYMDSECDK------------WSKLGECQKNPNYMLLNCAKSCNNCDLIPSDGKDCFNIYRNDKCEKWSNAGECSKNPKFMLENCAKSCNNCKTSQQNDSNCV 3372
            C  + +KGEC KNP +M + C  SC +C      N+      ++  NC      GEC +N  +M  NC  +C  C                  N + +     N   ++ CD             W++ G+C+ NP YM   C  SC  C   P+        Y  D C  W+  GEC KN K+M ENC +SCN C   QQ  + C 
Sbjct:  479 CGPWSAKGECQKNPVYMNVWCKASCRQCTPNYNINEECS---DRHTNCAMWSRSGECNKNPLWMSENCRSSCQKCGRSRAATCGGGGGADSISNPTTMPPATNNGQQNTPCDSPMCYNEDQCCPIWAQRGQCRSNPGYMTCQCKVSCGVCR--PNYVYGPCADYHYD-CAAWARRGECLKN-KWMPENCRRSCNTCVNQQQLAARCA 678          

HSP 7 Score: 70.8626 bits (172), Expect = 6.316e-12
Identity = 69/244 (28.28%), Postives = 102/244 (41.80%), Query Frame = -1
Query:  406 FENKTCLNLYKDDTCDLWKKAGYCHIYPKFMLSHCLKSCGQCSE----YSECKNLYNNIVCDKWAAEGECLKNSKFMIQLCLKSCGRCYDLK------------------------NLKVNRT-NSDGCENKYGDWSCEAWKQVGECERNPIFMNDQCSKSCGTCFKSTATSTSGPLRMSSVCKNFYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSCQNLKFSLKVKCQNILTKEKCLKLKK 1050
            F   +C N  +++ C  W   G C   P +M   C  SC QC+       EC + + N  C  W+  GEC KN  +M + C  SC +C   +                        N + N   +S  C N+  D  C  W Q G+C  NP +M  QC  SCG C          P  +   C +++ +  C  W + G+C  N  +M  NC RSCN+C N +  L  +C   + +   L+L +
Sbjct:  467 FFQTSCFN--ENECCGPWSAKGECQKNPVYMNVWCKASCRQCTPNYNINEECSDRHTN--CAMWSRSGECNKNPLWMSENCRSSCQKCGRSRAATCGGGGGADSISNPTTMPPATNNGQQNTPCDSPMCYNE--DQCCPIWAQRGQCRSNPGYMTCQCKVSCGVC---------RPNYVYGPCADYHYD--CAAWARRGECLKNK-WMPENCRRSCNTCVNQQ-QLAARCATRIVRSAFLELIR 691          

HSP 8 Score: 70.4774 bits (171), Expect = 9.352e-12
Identity = 61/208 (29.33%), Postives = 88/208 (42.31%), Query Frame = -1
Query: 2704 CEQLKIRGECLRNVSYMRVNCAKTCFNCNASV-VDKPCVNSYMDSECDKWSKLGECQKNPNYMLLNCAKSCNNC--------------DLI-----------------PSDGKDCFNIYRNDKCEKWSNAGECSKNPKFMLENCAKSCNNCKTSQQNDSNCVNINKNSECDKWSQMGECSKNPNYMLVNCAKSCNYCKFNKDLQKNCV 3231
            C     +GEC +N  YM V C  +C  C  +  +++ C + +  + C  WS+ GEC KNP +M  NC  SC  C              D I                 P D   C+N   +  C  W+  G+C  NP +M   C  SC  C+ +      C + +   +C  W++ GEC KN  +M  NC +SCN C   + L   C 
Sbjct:  479 CGPWSAKGECQKNPVYMNVWCKASCRQCTPNYNINEECSDRH--TNCAMWSRSGECNKNPLWMSENCRSSCQKCGRSRAATCGGGGGADSISNPTTMPPATNNGQQNTPCDSPMCYN--EDQCCPIWAQRGQCRSNPGYMTCQCKVSCGVCRPNYVYGP-CADYHY--DCAAWARRGECLKN-KWMPENCRRSCNTCVNQQQLAARCA 678          

HSP 9 Score: 70.0922 bits (170), Expect = 1.063e-11
Identity = 56/197 (28.43%), Postives = 75/197 (38.07%), Query Frame = -1
Query: 1639 CESWKQAGECLNNEKYMKVQCGKSCGRCNAKTYV--DCKDIYQEDSCKAWKDLGECFKNPVFMLSKCSQTCGSC--------------DMEKNPVVVETCKN-------------IDSNENCNTWQTAGECEKNPNYMLVNCAKACKTCQKDDAKNVEKKCDDVYSDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTC 2142
            C  W   GEC  N  YM V C  SC +C     +  +C D  +  +C  W   GEC KNP++M   C  +C  C              D   NP  +    N              + ++ C  W   G+C  NP YM   C  +C  C+ +    V   C D + D  C  W   G C K    M   C ++C TC
Sbjct:  479 CGPWSAKGECQKNPVYMNVWCKASCRQCTPNYNINEECSD--RHTNCAMWSRSGECNKNPLWMSENCRSSCQKCGRSRAATCGGGGGADSISNPTTMPPATNNGQQNTPCDSPMCYNEDQCCPIWAQRGQCRSNPGYMTCQCKVSCGVCRPN---YVYGPCADYHYD--CAAWARRGECLKNKW-MPENCRRSCNTC 667          

HSP 10 Score: 67.0106 bits (162), Expect = 1.072e-10
Identity = 59/207 (28.50%), Postives = 79/207 (38.16%), Query Frame = -1
Query: 3514 EKCFKHRNRFVIPIKECKNLEKNETCDAWEKRGECKKNPRYMKFNCKQSCGLCDKSTTTLAPKIECKNIYGDDKCNLWEAVGDCQNNKLFMELNCAKACGKCGTXXXXXXXXXXXXXXXD-----------------------VYEENSCLSWADANECTKNPNFMHKMCKKSCKLCITKEPEKCTNQYDNLSCYVWSQTGECESNR 4065
            E C K R +F     +     +NE C  W  +GEC+KNP YM   CK SC  C   T       EC + + +  C +W   G+C  N L+M  NC  +C KCG             D                            E+  C  WA   +C  NP +M   CK SC +C           Y +  C  W++ GEC  N+
Sbjct:  458 ETCLKIRLKFF----QTSCFNENECCGPWSAKGECQKNPVYMNVWCKASCRQC---TPNYNINEECSDRHTN--CAMWSRSGECNKNPLWMSENCRSSCQKCGRSRAATCGGGGGADSISNPTTMPPATNNGQQNTPCDSPMCYNEDQCCPIWAQRGQCRSNPGYMTCQCKVSCGVCRPNYVYGPCADY-HYDCAAWARRGECLKNK 654          

HSP 11 Score: 63.1586 bits (152), Expect = 1.395e-9
Identity = 57/214 (26.64%), Postives = 86/214 (40.19%), Query Frame = -1
Query: 3592 CIEQQKKGHCELRNKYMSFNCRKTCEKCFKHRNRFVIPIKECKNLEKNETCDAWEKRGECKKNPRYMKFNCKQSCGLCDKS----------------TTTLAPKI---------ECKNIYGDDK-CNLWEAVGDCQNNKLFMELNCAKACGKCGTXXXXXXXXXXXXXXXDVYE-----ENSCLSWADANECTKNPNFMHKMCKKSCKLCITKE 4140
            C     KG C+    YM+  C+ +C +C  + N      +EC +   N  C  W + GEC KNP +M  NC+ SC  C +S                 TT+ P           +    Y +D+ C +W   G C++N  +M   C  +CG C                  VY         C +WA   EC KN  +M + C++SC  C+ ++
Sbjct:  479 CGPWSAKGECQKNPVYMNVWCKASCRQCTPNYNI----NEECSDRHTN--CAMWSRSGECNKNPLWMSENCRSSCQKCGRSRAATCGGGGGADSISNPTTMPPATNNGQQNTPCDSPMCYNEDQCCPIWAQRGQCRSNPGYMTCQCKVSCGVC--------------RPNYVYGPCADYHYDCAAWARRGECLKN-KWMPENCRRSCNTCVNQQ 671          

HSP 12 Score: 62.003 bits (149), Expect = 3.715e-9
Identity = 64/198 (32.32%), Postives = 96/198 (48.48%), Query Frame = -1
Query: 3148 CLSWADANECTKNPNFMHKMCKKSCKLCITKE--PEKCTNQYDNLSCYVWSQTGECESNRKYMEXXXXXXXXXXXXXKMQT-------------TTTPSLS---VITMPSNETLCQNKYGDKYCEEFKSKGECTKNPDFMFIQCAKSCSKCKETKPGNDSLCKNIEKDNNCEQLKIRGECLRNVSYMRVNCAKTCFNC 3687
            C  W+   EC KNP +M+  CK SC+ C       E+C++++ N  C +WS++GEC  N  +M +NC+ SC+ CG S+  T             TT P  +       P +  +C N+  D+ C  +  +G+C  NP +M  QC  SC  C+         C +   D  C     RGECL+N  +M  NC ++C  C
Sbjct:  479 CGPWSAKGECQKNPVYMNVWCKASCRQCTPNYNINEECSDRHTN--CAMWSRSGECNKNPLWMSENCRSSCQKCGRSRAATCGGGGGADSISNPTTMPPATNNGQQNTPCDSPMCYNE--DQCCPIWAQRGQCRSNPGYMTCQCKVSCGVCRPNYVYGP--CADYHYD--CAAWARRGECLKN-KWMPENCRRSCNTC 667          

HSP 13 Score: 57.7658 bits (138), Expect = 6.119e-8
Identity = 52/184 (28.26%), Postives = 79/184 (42.93%), Query Frame = -1
Query: 3760 YIDQYCQCH----TPESFESRRCQDKNDESWCIEQQKKGHCELRNKYMSFNCRKTCEKCFKHR--------------NRFVIPIKECKNLEKNETCDA------------WEKRGECKKNPRYMKFNCKQSCGLCDKSTTTLAPKIECKNIYGDDKCNLWEAVGDCQNNKLFMELNCAKACGKC 4221
            Y++ +C+      TP    +  C D++    C    + G C     +MS NCR +C+KC + R              N   +P     N ++N  CD+            W +RG+C+ NP YM   CK SCG+C +      P   C + + D  C  W   G+C  NK +M  NC ++C  C
Sbjct:  494 YMNVWCKASCRQCTPNYNINEECSDRHTN--CAMWSRSGECNKNPLWMSENCRSSCQKCGRSRAATCGGGGGADSISNPTTMP-PATNNGQQNTPCDSPMCYNEDQCCPIWAQRGQCRSNPGYMTCQCKVSCGVC-RPNYVYGP---CADYHYD--CAAWARRGECLKNK-WMPENCRRSCNTC 667          

HSP 14 Score: 54.299 bits (129), Expect = 7.036e-7
Identity = 67/226 (29.65%), Postives = 96/226 (42.48%), Query Frame = -1
Query:  925 ESCGKCEKLPKNTNCINLDNDKNCEKWAGENECTKNSKYMLERCFKXXXXXXXXXSAKTPSEVCSNLANDTDCESWSKAGHCEKNVSYMLKFCAKSCKACNRL----------------ITTSLPSIN------------CVNKLNDSTCETLKILGQCEKNSIFMIEKCGKSCGSCRPAKEKTFENKTCLNLYKDDTCDLWKKAGYCHIYPKFMLSHCLKSCGQC 1518
            E+C K       T+C N   ++ C  W+ + EC KN  YM   C  SC  C+ + +    +E CS+    T+C  WS++G C KN  +M + C  SC+ C R                  TT  P+ N            C N+  D  C      GQC  N  +M  +C  SCG CRP     +    C + + D  C  W + G C +  K+M  +C +SC  C
Sbjct:  458 ETCLKIRLKFFQTSCFN--ENECCGPWSAKGECQKNPVYMNVWCKASCRQCTPNYNI---NEECSD--RHTNCAMWSRSGECNKNPLWMSENCRSSCQKCGRSRAATCGGGGGADSISNPTTMPPATNNGQQNTPCDSPMCYNE--DQCCPIWAQRGQCRSNPGYMTCQCKVSCGVCRP----NYVYGPCADYHYD--CAAWARRGEC-LKNKWMPENCRRSCNTC 667          
BLAST of SMED30016458 vs. Ensembl Celegans
Match: tyr-4 (TYRosinase [Source:UniProtKB/TrEMBL;Acc:O01497])

HSP 1 Score: 105.145 bits (261), Expect = 1.754e-22
Identity = 73/191 (38.22%), Postives = 93/191 (48.69%), Query Frame = -1
Query: 2584 CDKWSKLGECQKNPNYMLLNCAKSCNNCDLIPSDGKDCFNIYRNDKCEKWSNAGECSKNPKFMLENCAKSCNNCKTS--------------------QQNDSNCVNINKNSECDKWSQMGECSKNPNYMLVNCAKSCNYCKFNKDLQKNCVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSCDSERE 3096
            C  W+  GEC +N  YM   C  SC  C        DC +  R+ +C  WS +GEC+KN  +M ENC KSCN C  S                    QQ D++    N+N  C  W  MGEC KN  YM  NC  SC +C        +CV+ H+   C  W++ GECQKNP +M  NC  SC SC ++ E
Sbjct:  465 CASWAASGECSRNTAYMNEWCKASCGVCKPKYRLADDCTD--RHTQCSSWSRSGECTKNQLWMTENCRKSCNKCGRSRAQECGGGGTTVTTTTPAPAQQCDNSDGCFNENVCCAVWGLMGECRKNTRYMACNCRVSCGHCYPEDYNYGSCVDYHR--SCAGWARVGECQKNP-WMAENCRSSCNSCYTQSE 650          

HSP 2 Score: 101.293 bits (251), Expect = 2.555e-21
Identity = 73/202 (36.14%), Postives = 99/202 (49.01%), Query Frame = -1
Query: 2305 INKNSECDKWSQMGECSKNPNYMLVNCAKSCNYCKFNKDLQKNCVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSCDSER--------------------ECLNTHN----DAECSKWSSMGECTKNPKYMLVNCAXXXXXXXXXNTDKGTCSNINSDKECENWSKRGECAKNPKYMLINCAKSCNSCESATQLPTAC 2838
             N+N  C  W+  GECS+N  YM   C  SC  CK    L  +C + H  ++C SWS+ GEC KN  +M  NC KSC  C   R                    +C N+      +  C+ W  MGEC KN +YM  NC  SC  C   + + G+C  ++  + C  W++ GEC KNP +M  NC  SCNSC + ++L   C
Sbjct:  459 FNENQCCASWAASGECSRNTAYMNEWCKASCGVCKPKYRLADDCTDRH--TQCSSWSRSGECTKNQLWMTENCRKSCNKCGRSRAQECGGGGTTVTTTTPAPAQQCDNSDGCFNENVCCAVWGLMGECRKNTRYMACNCRVSCGHCYPEDYNYGSC--VDYHRSCAGWARVGECQKNP-WMAENCRSSCNSCYTQSELRRMC 655          

HSP 3 Score: 92.4337 bits (228), Expect = 1.733e-18
Identity = 68/193 (35.23%), Postives = 89/193 (46.11%), Query Frame = -1
Query: 1927 INSDKECENWSKRGECAKNPKYMLINCAKSCNSCESATQLPTACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVCKFNN-----------------ETKGCRNLDP----NSDCESWKQAGECLNNEKYMKVQCGKSCGRCNAK--TYVDCKDIYQEDSCKAWKDLGECFKNPVFMLSKCSQTCGSC 2436
             N ++ C +W+  GEC++N  YM   C  SC  C+   +L   CT+ H    +C  WS  GEC+KN  +M ENC KSCN C  +                    + C N D     N  C  W   GEC  N +YM   C  SCG C  +   Y  C D ++  SC  W  +GEC KNP +M   C  +C SC
Sbjct:  459 FNENQCCASWAASGECSRNTAYMNEWCKASCGVCKPKYRLADDCTDRHT---QCSSWSRSGECTKNQLWMTENCRKSCNKCGRSRAQECGGGGTTVTTTTPAPAQQCDNSDGCFNENVCCAVWGLMGECRKNTRYMACNCRVSCGHCYPEDYNYGSCVDYHR--SCAGWARVGECQKNP-WMAENCRSSCNSC 645          

HSP 4 Score: 90.5077 bits (223), Expect = 6.094e-18
Identity = 66/199 (33.17%), Postives = 92/199 (46.23%), Query Frame = -1
Query: 2698 CEQLKIRGECLRNVSYMRVNCAKTCFNCNASV-VDKPCVNSYMDSECDKWSKLGECQKNPNYMLLNCAKSCNNCD----------------LIPSDGKDCFN----IYRNDKCEKWSNAGECSKNPKFMLENCAKSCNNCKTSQQNDSNCVNINKNSECDKWSQMGECSKNPNYMLVNCAKSCNYCKFNKDLQKNCVNT 3231
            C      GEC RN +YM   C  +C  C     +   C + +  ++C  WS+ GEC KN  +M  NC KSCN C                   P+  + C N       N  C  W   GEC KN ++M  NC  SC +C     N  +CV+ +++  C  W+++GEC KNP +M  NC  SCN C    +L++ C  T
Sbjct:  465 CASWAASGECSRNTAYMNEWCKASCGVCKPKYRLADDCTDRH--TQCSSWSRSGECTKNQLWMTENCRKSCNKCGRSRAQECGGGGTTVTTTTPAPAQQCDNSDGCFNENVCCAVWGLMGECRKNTRYMACNCRVSCGHCYPEDYNYGSCVDYHRS--CAGWARVGECQKNP-WMAENCRSSCNSCYTQSELRRMCGTT 658          

HSP 5 Score: 82.8037 bits (203), Expect = 1.371e-15
Identity = 63/192 (32.81%), Postives = 81/192 (42.19%), Query Frame = -1
Query: 2173 CESWSKRGECQKNPKYMLVNCAKSCKSCDSERECLN--THNDAECSKWSSMGECTKNPKYMLVNC----------------AXXXXXXXXXNTDKGTCSN----INSDKECENWSKRGECAKNPKYMLINCAKSCNSCESATQLPTACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVCKFNNETK 2682
            C SW+  GEC +N  YM   C  SC  C  +    +  T    +CS WS  GECTKN  +M  NC                        ++      C N     N +  C  W   GEC KN +YM  NC  SC  C        +C + H++   C  W+  GEC KNP +M ENC  SCN C   +E +
Sbjct:  465 CASWAASGECSRNTAYMNEWCKASCGVCKPKYRLADDCTDRHTQCSSWSRSGECTKNQLWMTENCRKSCNKCGRSRAQECGGGGTTVTTTTPAPAQQCDNSDGCFNENVCCAVWGLMGECRKNTRYMACNCRVSCGHCYPEDYNYGSCVDYHRS---CAGWARVGECQKNP-WMAENCRSSCNSCYTQSELR 652          

HSP 6 Score: 78.9518 bits (193), Expect = 1.948e-14
Identity = 65/193 (33.68%), Postives = 87/193 (45.08%), Query Frame = -1
Query:   22 FYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSCQNLKFSLKVKCQNILTKEKCLKLKKAGECEKNSKQMAELCAYTCHKCNLSFVK--PMEINQNPTKMRSSKFKCDNRAGDFQ----CSYWARQKQCELNASYMRLFCQKSCGACLMEKPGQVSCVDKFATMKCFSWSMRGECDRNGKWMTENCAKSCLVC 582
            F  N+ C  W  +G+C  N+ +M   C  SC  C+  K+ L   C +  T+  C    ++GEC KN   M E C  +C+KC  S  +          T   +   +CDN  G F     C+ W    +C  N  YM   C+ SCG C  E     SCVD   +  C  W+  GEC +N  WM ENC  SC  C
Sbjct:  459 FNENQCCASWAASGECSRNTAYMNEWCKASCGVCKP-KYRLADDCTDRHTQ--CSSWSRSGECTKNQLWMTENCRKSCNKCGRSRAQECGGGGTTVTTTTPAPAQQCDNSDGCFNENVCCAVWGLMGECRKNTRYMACNCRVSCGHCYPEDYNYGSCVDYHRS--CAGWARVGECQKN-PWMAENCRSSCNSC 645          

HSP 7 Score: 74.7146 bits (182), Expect = 3.915e-13
Identity = 59/192 (30.73%), Postives = 82/192 (42.71%), Query Frame = -1
Query: 2860 CEEFKSKGECTKNPDFMFIQCAKSCSKCKETKPGNDSLCKNIEKDNNCEQLKIRGECLRNVSYMRVNCAKTCFNCNASVVDK------------PCVNSYMDSE---------CDKWSKLGECQKNPNYMLLNCAKSCNNCDLIPSDGKDCFNIYRNDKCEKWSNAGECSKNPKFMLENCAKSCNNCKTSQQ 3372
            C  + + GEC++N  +M   C  SC  CK      D      ++   C      GEC +N  +M  NC K+C  C  S   +            P      D+          C  W  +GEC+KN  YM  NC  SC +C     +   C + +R+  C  W+  GEC KNP +M ENC  SCN+C T  +
Sbjct:  465 CASWAASGECSRNTAYMNEWCKASCGVCKPKYRLADDC---TDRHTQCSSWSRSGECTKNQLWMTENCRKSCNKCGRSRAQECGGGGTTVTTTTPAPAQQCDNSDGCFNENVCCAVWGLMGECRKNTRYMACNCRVSCGHCYPEDYNYGSCVDYHRS--CAGWARVGECQKNP-WMAENCRSSCNSCYTQSE 650          

HSP 8 Score: 73.1738 bits (178), Expect = 1.291e-12
Identity = 55/188 (29.26%), Postives = 81/188 (43.09%), Query Frame = -1
Query: 1501 CKAWKDLGECFKNPVFMLSKCSQTCGSCDMEKNPVVVETCKNIDSNENCNTWQTAGECEKNPNYMLVNCAKACKTCQKDDAKN--------------VEKKCDD----VYSDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTCDQLKNNQTMCQNAYNDAICTKWKNMGECTKNPNFMLIQCKESCGKC 2010
            C +W   GEC +N  +M   C  +CG C  +    + + C   D +  C++W  +GEC KN  +M  NC K+C  C +  A+                 ++CD+       +V C  W   G C K +  M   C  +CG C     N   C + +    C  W  +GEC KNP +M   C+ SC  C
Sbjct:  465 CASWAASGECSRNTAYMNEWCKASCGVCKPKYR--LADDC--TDRHTQCSSWSRSGECTKNQLWMTENCRKSCNKCGRSRAQECGGGGTTVTTTTPAPAQQCDNSDGCFNENVCCAVWGLMGECRKNTRYMACNCRVSCGHCYPEDYNYGSCVDYHRS--CAGWARVGECQKNP-WMAENCRSSCNSC 645          

HSP 9 Score: 73.1738 bits (178), Expect = 1.370e-12
Identity = 62/196 (31.63%), Postives = 90/196 (45.92%), Query Frame = -1
Query:  340 CDKWAAEGECLKNSKFMIQLCLKSCGRCYDLKNLKVNRTNSDGCENKYGDWSCEAWKQVGECERNPIFMNDQCSKSCGTCFKSTA-----------TSTSGPLRMSSVCKN----FYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSCQNLKFSLKVKCQNILTKEKCLKLKKAGECEKNSKQMAELCAYTCHKC 882
            C  WAA GEC +N+ +M + C  SCG C     L      +D C +++    C +W + GEC +N ++M + C KSC  C +S A           T+T  P +    C N    F  N  C  W   G+C+ N+ +M  NC  SC  C    ++    C  +     C    + GEC+KN   MAE C  +C+ C
Sbjct:  465 CASWAASGECSRNTAYMNEWCKASCGVCKPKYRL------ADDCTDRHTQ--CSSWSRSGECTKNQLWMTENCRKSCNKCGRSRAQECGGGGTTVTTTTPAPAQQ---CDNSDGCFNENVCCAVWGLMGECRKNTRYMACNCRVSCGHCYPEDYNYG-SC--VDYHRSCAGWARVGECQKN-PWMAENCRSSCNSC 645          

HSP 10 Score: 70.4774 bits (171), Expect = 7.918e-12
Identity = 63/209 (30.14%), Postives = 92/209 (44.02%), Query Frame = -1
Query:  898 CEKWAGENECTKNSKYMLERCFKXXXXXXXXXSAKTPSEVCS---NLAND-----TDCESWSKAGHCEKNVSYMLKFCAKSCKACNR-------------LITTSLPSINCVNK---LNDST-CETLKILGQCEKNSIFMIEKCGKSCGSCRPAKEKTFENKTCLNLYKDDTCDLWKKAGYCHIYPKFMLSHCLKSCGQCSEYSECKNL 1449
            C  WA   EC++N+ YM E C             K    VC     LA+D     T C SWS++G C KN  +M + C KSC  C R               TT  P+  C N     N++  C    ++G+C KN+ +M   C  SCG C P   + +   +C++ ++  +C  W + G C   P +M  +C  SC  C   SE + +
Sbjct:  465 CASWAASGECSRNTAYMNEWC-------------KASCGVCKPKYRLADDCTDRHTQCSSWSRSGECTKNQLWMTENCRKSCNKCGRSRAQECGGGGTTVTTTTPAPAQQCDNSDGCFNENVCCAVWGLMGECRKNTRYMACNCRVSCGHCYP---EDYNYGSCVDYHR--SCAGWARVGECQKNP-WMAENCRSSCNSCYTQSELRRM 654          

HSP 11 Score: 67.781 bits (164), Expect = 6.483e-11
Identity = 58/200 (29.00%), Postives = 84/200 (42.00%), Query Frame = -1
Query:  778 CESWSKAGHCEKNVSYMLKFCAKSCKACNRLITTSLPSINCVNKLND--STCETLKILGQCEKNSIFMIEKCGKSCGSC------------------RPAKEKTFENK-TCLNLYKDDTCDLWKKAGYCHIYPKFMLSHCLKSCGQCSE----YSECKNLYNNIVCDKWAAEGECLKNSKFMIQLCLKSCGRCYDLKNLK 1302
            C SW+ +G C +N +YM ++C  SC  C        P     +   D  + C +    G+C KN ++M E C KSC  C                   PA  +  +N   C N  ++  C +W   G C    ++M  +C  SCG C      Y  C + + +  C  WA  GEC KN  +M + C  SC  CY    L+
Sbjct:  465 CASWAASGECSRNTAYMNEWCKASCGVCK-------PKYRLADDCTDRHTQCSSWSRSGECTKNQLWMTENCRKSCNKCGRSRAQECGGGGTTVTTTTPAPAQQCDNSDGCFN--ENVCCAVWGLMGECRKNTRYMACNCRVSCGHCYPEDYNYGSCVDYHRS--CAGWARVGECQKN-PWMAENCRSSCNSCYTQSELR 652          

HSP 12 Score: 60.8474 bits (146), Expect = 8.925e-9
Identity = 51/177 (28.81%), Postives = 77/177 (43.50%), Query Frame = -1
Query: 3754 GYIDQYCQCH----TPESFESRRCQDKNDESWCIEQQKKGHCELRNKYMSFNCRKTCEKCFKHRNR------------FVIPIKECKN----LEKNETCDAWEKRGECKKNPRYMKFNCKQSCGLCDKSTTTLAPKIECKNIYGDDKCNLWEAVGDCQNNKLFMELNCAKACGKCGT 4224
             Y++++C+       P+   +  C D++ +  C    + G C     +M+ NCRK+C KC + R +               P ++C N      +N  C  W   GEC+KN RYM  NC+ SCG C            C + +    C  W  VG+CQ N  +M  NC  +C  C T
Sbjct:  479 AYMNEWCKASCGVCKPKYRLADDCTDRHTQ--CSSWSRSGECTKNQLWMTENCRKSCNKCGRSRAQECGGGGTTVTTTTPAPAQQCDNSDGCFNENVCCAVWGLMGECRKNTRYMACNCRVSCGHCYPEDYNYG---SCVDYH--RSCAGWARVGECQKNP-WMAENCRSSCNSCYT 647          

HSP 13 Score: 58.5362 bits (140), Expect = 4.682e-8
Identity = 57/189 (30.16%), Postives = 78/189 (41.27%), Query Frame = -1
Query: 1072 CTKWKNMGECTKNPNFMLIQCKESCGKCE-KLPKNTNCINLDNDKNCEKWAGENECTKNSKYMLERCFKX-------------XXXXXXXXSAKTPSEVCSN----LANDTDCESWSKAGHCEKNVSYMLKFCAKSCKACNRLITTSLPSINCVNKLNDSTCETLKILGQCEKNSIFMIEKCGKSCGSC 1584
            C  W   GEC++N  +M   CK SCG C+ K     +C   D    C  W+   ECTKN  +M E C KS                 + +++   P++ C N       +  C  W   G C KN  YM   C  SC  C           +CV+     +C     +G+C+KN  +M E C  SC SC
Sbjct:  465 CASWAASGECSRNTAYMNEWCKASCGVCKPKYRLADDCT--DRHTQCSSWSRSGECTKNQLWMTENCRKSCNKCGRSRAQECGGGGTTVTTTTPAPAQQCDNSDGCFNENVCCAVWGLMGECRKNTRYMACNCRVSCGHC---YPEDYNYGSCVDY--HRSCAGWARVGECQKNP-WMAENCRSSCNSC 645          

HSP 14 Score: 51.6026 bits (122), Expect = 5.312e-6
Identity = 56/193 (29.02%), Postives = 87/193 (45.08%), Query Frame = -1
Query: 3148 YEENSC-LSWADANECTKNPNFMHKMCKKSCKLCITKE--PEKCTNQYDNLSCYVWSQTGECESNRKYM-EXXXXXXXXXXXXXKMQTTTTPSLSVITMPSNETLCQNKYG----DKYCEEFKSKGECTKNPDFMFIQCAKSCSKCKETKPGNDSLCKNIEKDNNCEQLKIRGECLRNVSYMRVNCAKTCFNC 3702
            + EN C  SWA + EC++N  +M++ CK SC +C  K    + CT+++    C  WS++GEC  N+ +M E   K   K       +     +    T P+    C N  G    +  C  +   GEC KN  +M   C  SC  C    P + +    ++   +C      GEC +N  +M  NC  +C +C
Sbjct:  459 FNENQCCASWAASGECSRNTAYMNEWCKASCGVCKPKYRLADDCTDRHTQ--CSSWSRSGECTKNQLWMTENCRKSCNKCGRSRAQECGGGGTTVTTTTPAPAQQCDNSDGCFNENVCCAVWGLMGECRKNTRYMACNCRVSCGHC---YPEDYNYGSCVDYHRSCAGWARVGECQKN-PWMAENCRSSCNSC 645          
BLAST of SMED30016458 vs. Ensembl Celegans
Match: nas-13 (Zinc metalloproteinase nas-13 [Source:UniProtKB/Swiss-Prot;Acc:Q20191])

HSP 1 Score: 100.138 bits (248), Expect = 1.526e-21
Identity = 94/376 (25.00%), Postives = 159/376 (42.29%), Query Frame = -1
Query: 3907 GTTRSKRAVVVKSADQWPDGVIPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQNCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSFINEKGEPSIQVINESMIHLLLEVHEK-DLSFLDAKVVNLYYKC---------------ADRCFQNVTCSAGGYIDQYCQCHTPESFESRR------------------CQDKNDESWCIEQQKKGHCELR--NKYMSFNCRKTCEKCFKHRNRFVIPIKECKNLEKNETCDAWEKRGECKKN--PRYMKFNCKQSCGLC 4920
            G    +R  V ++  +W    IPY I     +    S + +AI  +  +TC+ F  K   D +++ I     CYS+VG     +Q V+L   GC            + G+ +HEL HA+G  HE  R+ RD+Y+KI   N++A   D F K + +        +D  S+MHY P +F ++ G+P+I+ I ++     +E+ ++   S  D   +N+ Y C                    + VT + G  + +  +  +    +  R                  C+D+  +  C    + GHCE R   ++M+ NC  +C KC     R  +    C++      C+ W   G C +     YM+  C +SC  C
Sbjct:  103 GIFGVQRNAVRQTYLKWEQARIPYTISSQY-SSYSRSKIAEAIEEYRKKTCIDFSPKSAGDLDYIHIVPDDGCYSLVGR-IGGKQPVSLGD-GCI-----------QKGIIIHELMHAVGFFHEQSRADRDEYVKINWSNVEAGLQDQFDKYSLNMIDHLGTKYDYGSVMHYAPTAF-SKNGKPTIEPIEKN-----VEIGQRAGFSENDIYKINMLYNCPTFTATTLAPENTKRVKSITKKVTSATGSPLSKKGEIGSSIGDKGDRGDNSVLSSLISIHSGLGKCEDRRKD--CEFLARAGHCESRFSIRFMTENCANSCGKCIAEEKRKEV----CEDART--WCERWANSGMCNQTVFKDYMRQKCAKSCNFC 450          
BLAST of SMED30016458 vs. Ensembl Celegans
Match: hch-1 (Zinc metalloproteinase nas-34 [Source:UniProtKB/Swiss-Prot;Acc:Q21059])

HSP 1 Score: 100.523 bits (249), Expect = 3.609e-21
Identity = 76/263 (28.90%), Postives = 118/263 (44.87%), Query Frame = -1
Query: 4165 RSKRAVVVKSADQWPDGVIPYYIDRNAFNEEEVSSLQDAINTWNFETCVHF-RL---KRESDRNWVKITGGQNCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSFINEKG------EPSIQVINESMIHLLLEVHEKDLSFLDAKVVNLYYKCADRCFQNVTCSAGGYID----QYCQCHTPESFESRRC 4911
            R KR++    +++W    +PYYID ++      +++   +  W  ETC  F RL      S +N ++   G  CYS +G      Q+V++   GC  +           G   HE+GHA+G  HE  R  RDDY+ I+ +NIQ   +  F K + S  +D+ + +D  S+MHY   +F +  G      +P+ Q      +           SF D K +N  Y C   C   + C  GGYI+      C+C  P  F  + C
Sbjct:  121 RGKRSMTSFLSERW-SFPVPYYIDTSS--GVNTNAVLAGVAKWEQETCARFTRLNSYSSSSRQNALRFISGNGCYSNIGKVSRFPQDVSIGW-GCTSL-----------GTVCHEIGHALGFYHEQARYDRDDYVSILTQNIQDMYLSQFTKQSASSMVDYGVGYDYGSVMHYDQAAFSSTGGNTIATRDPNFQATIGQRVA---------PSFADVKRINFAY-CNSTCSNYLDCQNGGYINPNDCNNCKC--PPGFGGQLC 356          
BLAST of SMED30016458 vs. Ensembl Celegans
Match: nas-33 (Zinc metalloproteinase nas-33 [Source:UniProtKB/Swiss-Prot;Acc:P55114])

HSP 1 Score: 100.523 bits (249), Expect = 4.334e-21
Identity = 74/293 (25.26%), Postives = 127/293 (43.34%), Query Frame = -1
Query: 4060 IPY-YIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQNCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSFINEKGEPSIQVINESMIHLLLEVHEKDLSFLDAKVVNLYYKCADRCFQNVTCSAGGYIDQY--CQCHTPESFESRRCQ------------------------DKNDESWCIEQQKKGHCELRNKYMSFNCRKTCEK 4857
            IPY ++D +   + +++   + +  +   TC+ F L      +++  + G+ CYS VG      QE+++   GC  +           G+  HE+GHA+G  HE  R  RD Y++I  +N        F K + S+  ++ +P+D  S+MHYGP SF       +++ ++ + I+ +    E   SFLD K++N  + C++ C   + C  GGY D     QC  P   E   C+                          +D  W I     G+      Y+ + C   CE+
Sbjct:  206 IPYRFLDTDGNWQSQIT---NGLRHYERNTCIRFSLN-GGGSDYLVFSKGEGCYSSVGR-LGGPQEISIGD-GCETL-----------GIITHEVGHALGFWHEQARPERDSYVRINRQNAINGLEGQFDKRSWSEVNEYSLPYDYGSVMHYGPKSFSKSSTMNTVEPVDPAFINTIGNRVEP--SFLDLKLLNTAF-CSNICTNRINCQHGGYADPNNCGQCTCPTGLEGTYCERLQTSNCGVELPRADYSWRNISYSGSSDCYWRIVSANGGNVRFELTYVMYRCSPVCEE 478          
BLAST of SMED30016458 vs. Ensembl Fly
Match: CG5715 (gene:FBgn0039180 transcript:FBtr0084634)

HSP 1 Score: 118.242 bits (295), Expect = 1.550e-28
Identity = 68/223 (30.49%), Postives = 118/223 (52.91%), Query Frame = -1
Query: 4264 FHDGTTRSKRAVVVKSADQWPDGVIPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQN-CYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSFINEKGEPSIQVINESMIHLLLEVHEKDLSFLDAKVVNLYYKC 4929
            + D      R  ++  + +WP GV+PY I +  F  +E+ ++  A   ++ +TCV F+  R ++++++ I  G++ C+S +G      QEVNL SP C           R YG  +HEL HA+G  HE  R  RD Y++++++NI+ E +  F+K++      F + +D  S+MHY P SF    G+P+++ +  +     +    K  S  D + +N  YKC
Sbjct:   86 YRDARFNGTRNGILALSSRWPGGVVPYEI-KGPFTSQELGNINHAFKEYHTKTCVRFK-PRTTEKDYISIGSGKSGCWSSIGR-LGGRQEVNLQSPNCL----------RTYGTPIHELMHALGFFHEQNRHERDSYVRVMKDNIKPEMMVNFEKSSSRTQYGFGVEYDYGSVMHYSPTSF-TRNGQPTLKALRATSDASQMG-QRKGFSAGDVRKINAMYKC 293          
BLAST of SMED30016458 vs. Ensembl Fly
Match: CG6763 (gene:FBgn0039069 transcript:FBtr0084378)

HSP 1 Score: 108.227 bits (269), Expect = 1.161e-24
Identity = 65/175 (37.14%), Postives = 103/175 (58.86%), Query Frame = -1
Query: 4363 ADQWPDGVIPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITG-GQNCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSF-INEKGEPSI 4881
            + +WP+GV+PY I R  FN  +++++++AI  ++  TC+ F +KR S+R+++ I G    C+S VG     +QEVNL SPGC              G  +HEL HA+G  HE  R  RD Y+ I   N+Q+  ++ F+K  +++   F +P+D  S+MHY   +F IN  G+P+I
Sbjct:  114 SSRWPNGVVPYEI-RGNFNARDMATIENAIGEYHRRTCIRF-VKRSSERDYISIRGDNSGCWSSVGR-VGGKQEVNLQSPGCLS----------RPGTAMHELMHALGFLHEQNRMERDGYVAIQYNNVQSSAMNNFEKAARTEA--FGVPYDYGSVMHYSKNAFSIN--GQPTI 271          
BLAST of SMED30016458 vs. Ensembl Fly
Match: CG6763 (gene:FBgn0039069 transcript:FBtr0334497)

HSP 1 Score: 108.227 bits (269), Expect = 1.161e-24
Identity = 65/175 (37.14%), Postives = 103/175 (58.86%), Query Frame = -1
Query: 4363 ADQWPDGVIPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITG-GQNCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSF-INEKGEPSI 4881
            + +WP+GV+PY I R  FN  +++++++AI  ++  TC+ F +KR S+R+++ I G    C+S VG     +QEVNL SPGC              G  +HEL HA+G  HE  R  RD Y+ I   N+Q+  ++ F+K  +++   F +P+D  S+MHY   +F IN  G+P+I
Sbjct:  114 SSRWPNGVVPYEI-RGNFNARDMATIENAIGEYHRRTCIRF-VKRSSERDYISIRGDNSGCWSSVGR-VGGKQEVNLQSPGCLS----------RPGTAMHELMHALGFLHEQNRMERDGYVAIQYNNVQSSAMNNFEKAARTEA--FGVPYDYGSVMHYSKNAFSIN--GQPTI 271          
BLAST of SMED30016458 vs. Ensembl Fly
Match: CG6696 (gene:FBgn0030947 transcript:FBtr0074611)

HSP 1 Score: 93.9745 bits (232), Expect = 4.730e-20
Identity = 54/175 (30.86%), Postives = 92/175 (52.57%), Query Frame = -1
Query: 4351 WPDGVIPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGG-QNCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSFINEKGEPSIQVIN 4872
            WP+  +P+YID   FN  +   +  A   ++  TC+ FR   + D++W+ I G    C+S VG      Q +NL +P C             +G+ +HEL HA+G  H+   + RD+Y+KI  ENI   +   F K  ++   +F + +D QS+MHY   +F ++ G+ +I+ ++
Sbjct:  105 WPEAAVPFYIDPQDFNANQTMVILKAFKEYHDRTCIRFRPYEQGDKHWLLIKGNYSGCWSSVGRRS-GGQVLNLNTPKCV-----------THGVVVHELLHALGFYHQQSATERDEYVKINWENILDGHAHNFNKYARTHITNFGVEYDYQSVMHYSSRAF-SKNGKATIEPLD 266          
BLAST of SMED30016458 vs. Ensembl Fly
Match: CG15255 (gene:FBgn0028950 transcript:FBtr0080785)

HSP 1 Score: 86.6557 bits (213), Expect = 3.979e-18
Identity = 64/218 (29.36%), Postives = 102/218 (46.79%), Query Frame = -1
Query: 4264 RAVVVKSADQWPDGVIPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITG-GQNCYSIVGMDYFAEQEVNL----ASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSFINEKGEPSIQVINESMIHLLLEVHEKDLSFLDAKVVNLYYKC 4902
            R  ++ +  +WP  V+ Y I  + F+     ++Q  I+T    TC+ FR   + D+ ++ +T     CY+ VG    A QE+NL       GC              G  LHE  HA+G  H+   SIRDD++ ++ ENI       F+K   +   DF++ +D  S +HY P +F +  GE +I  ++ S +          LS  D   +N+ YKC
Sbjct:   58 RNGLINTEKRWPGNVVVYRISDD-FDTAHKKAIQTGIDTLELHTCLRFREATDEDKAYLTVTAKSGGCYTAVGYQ-GAPQEMNLEIYPLGEGCFRP-----------GTILHEFMHALGFYHQQSSSIRDDFINVIYENIVPGKEFNFQKYADTVVTDFEVGYDYDSCLHYRPGAF-SINGEDTIVPLDSSAVI----GQRVGLSSKDIDKINIMYKC 257          
BLAST of SMED30016458 vs. Ensembl Zebrafish
Match: tll1 (tolloid-like 1 [Source:NCBI gene;Acc:474335])

HSP 1 Score: 92.8189 bits (229), Expect = 2.636e-18
Identity = 58/175 (33.14%), Postives = 81/175 (46.29%), Query Frame = -1
Query: 4390 TRSKRAVVVKSADQWPDGVIPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQNCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSF 4914
            +R  RA   ++   WP GVIPY I  N F   + + L+ A+  W  +TCV F  K + +   V       C S VG      Q +++    C            ++G+ +HELGH IG  HEH R  RDD++ I+ +NIQ      F K    D      P+D  SIMHY   +F
Sbjct:  152 SRVPRAATSRAEKIWPGGVIPYVIGGN-FTGSQRAMLKQAMRHWEKQTCVTFIEKTDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGK-NCD-----------KFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRDNIQPGQEYNFIKMEPGDVNSLGEPYDFDSIMHYARNTF 313          
BLAST of SMED30016458 vs. Ensembl Zebrafish
Match: tll1 (tolloid-like 1 [Source:NCBI gene;Acc:474335])

HSP 1 Score: 92.8189 bits (229), Expect = 2.636e-18
Identity = 58/175 (33.14%), Postives = 81/175 (46.29%), Query Frame = -1
Query: 4390 TRSKRAVVVKSADQWPDGVIPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQNCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSF 4914
            +R  RA   ++   WP GVIPY I  N F   + + L+ A+  W  +TCV F  K + +   V       C S VG      Q +++    C            ++G+ +HELGH IG  HEH R  RDD++ I+ +NIQ      F K    D      P+D  SIMHY   +F
Sbjct:  152 SRVPRAATSRAEKIWPGGVIPYVIGGN-FTGSQRAMLKQAMRHWEKQTCVTFIEKTDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGK-NCD-----------KFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRDNIQPGQEYNFIKMEPGDVNSLGEPYDFDSIMHYARNTF 313          
BLAST of SMED30016458 vs. Ensembl Zebrafish
Match: tll1 (tolloid-like 1 [Source:NCBI gene;Acc:474335])

HSP 1 Score: 92.8189 bits (229), Expect = 2.636e-18
Identity = 58/175 (33.14%), Postives = 81/175 (46.29%), Query Frame = -1
Query: 4390 TRSKRAVVVKSADQWPDGVIPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQNCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSF 4914
            +R  RA   ++   WP GVIPY I  N F   + + L+ A+  W  +TCV F  K + +   V       C S VG      Q +++    C            ++G+ +HELGH IG  HEH R  RDD++ I+ +NIQ      F K    D      P+D  SIMHY   +F
Sbjct:  152 SRVPRAATSRAEKIWPGGVIPYVIGGN-FTGSQRAMLKQAMRHWEKQTCVTFIEKTDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGK-NCD-----------KFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRDNIQPGQEYNFIKMEPGDVNSLGEPYDFDSIMHYARNTF 313          
BLAST of SMED30016458 vs. Ensembl Zebrafish
Match: c6ast3 (six-cysteine containing astacin protease 3 [Source:ZFIN;Acc:ZDB-GENE-050320-99])

HSP 1 Score: 85.5001 bits (210), Expect = 1.407e-17
Identity = 62/197 (31.47%), Postives = 106/197 (53.81%), Query Frame = -1
Query: 4306 WP---DGVI--PYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQNCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKN-NKSDTLDFDMPFDLQSIMHYGPLSFINEKGEPSIQVI--NESMIHLLLEVHEKDL 4872
            WP   DG I  PY I  N ++  E+  +Q  ++++++ TC+ F   R ++R+++ I     CYS VG   +A Q V+LA  GC +           +    HEL HA+G +HE  R+ RD++++++ ENI    +D  K N NK +TL+   P+D  S+M Y   +F ++ G P++  I  N + +    E+ + D+
Sbjct:   69 WPKYSDGKIYVPYVI-ANHYSSRELEIIQRGLDSFSYSTCIRF-FPRGNERDYISIESRSGCYSYVGRQGYA-QTVSLARSGCLY-----------HSTVQHELLHALGFNHEQTRNDRDNHIQVIWENI----LDDMKYNFNKINTLNQGTPYDYSSVMQYERYAF-SKNGLPTMIPIPNNNAALGTSTEMSQNDI 246          
BLAST of SMED30016458 vs. Ensembl Zebrafish
Match: c6ast3 (six-cysteine containing astacin protease 3 [Source:ZFIN;Acc:ZDB-GENE-050320-99])

HSP 1 Score: 85.5001 bits (210), Expect = 1.407e-17
Identity = 62/197 (31.47%), Postives = 106/197 (53.81%), Query Frame = -1
Query: 4306 WP---DGVI--PYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQNCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKN-NKSDTLDFDMPFDLQSIMHYGPLSFINEKGEPSIQVI--NESMIHLLLEVHEKDL 4872
            WP   DG I  PY I  N ++  E+  +Q  ++++++ TC+ F   R ++R+++ I     CYS VG   +A Q V+LA  GC +           +    HEL HA+G +HE  R+ RD++++++ ENI    +D  K N NK +TL+   P+D  S+M Y   +F ++ G P++  I  N + +    E+ + D+
Sbjct:   69 WPKYSDGKIYVPYVI-ANHYSSRELEIIQRGLDSFSYSTCIRF-FPRGNERDYISIESRSGCYSYVGRQGYA-QTVSLARSGCLY-----------HSTVQHELLHALGFNHEQTRNDRDNHIQVIWENI----LDDMKYNFNKINTLNQGTPYDYSSVMQYERYAF-SKNGLPTMIPIPNNNAALGTSTEMSQNDI 246          
BLAST of SMED30016458 vs. Ensembl Xenopus
Match: ENSXETT00000006820.1 (astacin-like metalloendopeptidase [Source:NCBI gene;Acc:100496122])

HSP 1 Score: 94.3597 bits (233), Expect = 3.964e-19
Identity = 66/209 (31.58%), Postives = 103/209 (49.28%), Query Frame = -1
Query: 4261 WPDGV-----IPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQNCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSFINEKGEPSIQVINESMIHLLLEVHEKDLSFLDAKVVNLYYKCA 4872
            WP        +PY +    +N ++ +++  A+  ++  TC+ F +   ++R+++ I     C+S +G      Q+++L   GC              G+  HEL HA+G  HEH RS RD Y+KI   NIQ E  D F   NK+DT +  M +D  S+MHYG  S+  +   P+IQ I   +I +        LS LDA  +N  Y C+
Sbjct:   88 WPKSANGLVNVPYTLAAE-YNVQDRATIAAAMLEFSTLTCIRF-VPHTNERDFLNIISDSGCWSFLGRAGGGGQDLSLQRGGCL-----------SNGIIQHELNHALGFVHEHTRSDRDSYVKIFWNNIQPEYKDSF---NKTDTDNQGMEYDYGSVMHYGRNSYSIDYQLPTIQPIPNGLIPI---GQRYGLSSLDAAKINRLYNCS 277          
BLAST of SMED30016458 vs. Ensembl Xenopus
Match: ENSXETT00000006778.1 (astacin-like metalloendopeptidase [Source:NCBI gene;Acc:100496122])

HSP 1 Score: 94.3597 bits (233), Expect = 4.241e-19
Identity = 66/209 (31.58%), Postives = 103/209 (49.28%), Query Frame = -1
Query: 4261 WPDGV-----IPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQNCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSFINEKGEPSIQVINESMIHLLLEVHEKDLSFLDAKVVNLYYKCA 4872
            WP        +PY +    +N ++ +++  A+  ++  TC+ F +   ++R+++ I     C+S +G      Q+++L   GC              G+  HEL HA+G  HEH RS RD Y+KI   NIQ E  D F   NK+DT +  M +D  S+MHYG  S+  +   P+IQ I   +I +        LS LDA  +N  Y C+
Sbjct:   88 WPKSANGLVNVPYTLAAE-YNVQDRATIAAAMLEFSTLTCIRF-VPHTNERDFLNIISDSGCWSFLGRAGGGGQDLSLQRGGCL-----------SNGIIQHELNHALGFVHEHTRSDRDSYVKIFWNNIQPEYKDSF---NKTDTDNQGMEYDYGSVMHYGRNSYSIDYQLPTIQPIPNGLIPI---GQRYGLSSLDAAKINRLYNCS 277          
BLAST of SMED30016458 vs. Ensembl Xenopus
Match: astl2c (astacin-like metallo-endopeptidase 2 gene c [Source:NCBI gene;Acc:594901])

HSP 1 Score: 90.5077 bits (223), Expect = 6.656e-18
Identity = 67/221 (30.32%), Postives = 112/221 (50.68%), Query Frame = -1
Query: 4225 WP---DGVI--PYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQNCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSFINEKGEPSIQVINESMIHLLLEVHEKDLSFLDAKVVNLYYKCADRCFQNVTCSAG 4872
            WP   +G++  PY I  + +++ E S +  A+  +   TCV F  + + D +++ I     C+S +G++  A+Q V+L   GC +           YG+  HEL H +G  HEH RS RD+Y+ I  + I  +N+  F   +K DT +  + +D  S+MHY   S+ N  G+ +I  I  + + +        LS LD   +N  Y+C D C +  T ++G
Sbjct:   80 WPKDSNGIVNVPYTISSD-YSQNEASLIMAAMQEFATLTCVQFIPQTDED-DYIAIQPLDGCWSYIGVNGGAQQ-VSLGKGGCIY-----------YGVIQHELNHVLGFVHEHSRSDRDNYVHINYQYISPDNIAFF---DKKDTDNLGLEYDYSSVMHYPGYSYSNTTGKNTIVPIPNANVPI---GQRYGLSTLDVSKINRLYQC-DVCSKLFTNASG 279          
BLAST of SMED30016458 vs. Ensembl Xenopus
Match: astl2c (astacin-like metallo-endopeptidase 2 gene c [Source:NCBI gene;Acc:594901])

HSP 1 Score: 90.5077 bits (223), Expect = 7.117e-18
Identity = 67/221 (30.32%), Postives = 112/221 (50.68%), Query Frame = -1
Query: 4225 WP---DGVI--PYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQNCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSFINEKGEPSIQVINESMIHLLLEVHEKDLSFLDAKVVNLYYKCADRCFQNVTCSAG 4872
            WP   +G++  PY I  + +++ E S +  A+  +   TCV F  + + D +++ I     C+S +G++  A+Q V+L   GC +           YG+  HEL H +G  HEH RS RD+Y+ I  + I  +N+  F   +K DT +  + +D  S+MHY   S+ N  G+ +I  I  + + +        LS LD   +N  Y+C D C +  T ++G
Sbjct:   78 WPKDSNGIVNVPYTISSD-YSQNEASLIMAAMQEFATLTCVQFIPQTDED-DYIAIQPLDGCWSYIGVNGGAQQ-VSLGKGGCIY-----------YGVIQHELNHVLGFVHEHSRSDRDNYVHINYQYISPDNIAFF---DKKDTDNLGLEYDYSSVMHYPGYSYSNTTGKNTIVPIPNANVPI---GQRYGLSTLDVSKINRLYQC-DVCSKLFTNASG 277          
BLAST of SMED30016458 vs. Ensembl Xenopus
Match: astl2c (astacin-like metallo-endopeptidase 2 gene c [Source:NCBI gene;Acc:594901])

HSP 1 Score: 90.5077 bits (223), Expect = 7.834e-18
Identity = 67/221 (30.32%), Postives = 112/221 (50.68%), Query Frame = -1
Query: 4225 WP---DGVI--PYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQNCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSFINEKGEPSIQVINESMIHLLLEVHEKDLSFLDAKVVNLYYKCADRCFQNVTCSAG 4872
            WP   +G++  PY I  + +++ E S +  A+  +   TCV F  + + D +++ I     C+S +G++  A+Q V+L   GC +           YG+  HEL H +G  HEH RS RD+Y+ I  + I  +N+  F   +K DT +  + +D  S+MHY   S+ N  G+ +I  I  + + +        LS LD   +N  Y+C D C +  T ++G
Sbjct:   81 WPKDSNGIVNVPYTISSD-YSQNEASLIMAAMQEFATLTCVQFIPQTDED-DYIAIQPLDGCWSYIGVNGGAQQ-VSLGKGGCIY-----------YGVIQHELNHVLGFVHEHSRSDRDNYVHINYQYISPDNIAFF---DKKDTDNLGLEYDYSSVMHYPGYSYSNTTGKNTIVPIPNANVPI---GQRYGLSTLDVSKINRLYQC-DVCSKLFTNASG 280          
BLAST of SMED30016458 vs. Ensembl Mouse
Match: Tll1 (tolloid-like [Source:MGI Symbol;Acc:MGI:106923])

HSP 1 Score: 83.5741 bits (205), Expect = 2.130e-15
Identity = 54/174 (31.03%), Postives = 77/174 (44.25%), Query Frame = -1
Query: 4390 RSKRAVVVKSADQWPDGVIPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQNCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSF 4911
            R  RA   ++   WP GVIPY I  N F   + +  + A+  W   TCV F  + + +   V       C S VG      Q +++    C            ++G+ +HELGH IG  HEH R  RD+++ I+ ENIQ      F K    +       +D  SIMHY   +F
Sbjct:  144 RVPRAATSRTERIWPGGVIPYVIGGN-FTGSQRAMFKQAMRHWEKHTCVTFTERSDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGK-NCD-----------KFGIVVHELGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFLKMEPGEVNSLGERYDFDSIMHYARNTF 304          
BLAST of SMED30016458 vs. Ensembl Mouse
Match: Tll2 (tolloid-like 2 [Source:MGI Symbol;Acc:MGI:1346044])

HSP 1 Score: 82.4185 bits (202), Expect = 3.852e-15
Identity = 53/176 (30.11%), Postives = 77/176 (43.75%), Query Frame = -1
Query: 4390 TTRSKRAVVVKSADQWPDGVIPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQNCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSF 4917
            + R +RA   ++   WP GVIPY I  N F   + +  + A+  W   TCV F  + + +   V       C S VG      Q +++    C            ++G+  HELGH +G  HEH R  RD ++ I+ ENIQ      F K    +       +D  SIMHY   +F
Sbjct:  141 SARVRRATTSRTERIWPGGVIPYVIGGN-FTGTQRAIFKQAMRHWEKHTCVTFVERTDEESFIVFSYRTCGCCSYVGRRGGGPQAISIGK-NCD-----------KFGIVAHELGHVVGFWHEHTRPDRDQHVTIIRENIQPGQEYNFLKMEAGEVSSLGETYDFDSIMHYARNTF 303          
BLAST of SMED30016458 vs. Ensembl Mouse
Match: Tll2 (tolloid-like 2 [Source:MGI Symbol;Acc:MGI:1346044])

HSP 1 Score: 82.4185 bits (202), Expect = 4.340e-15
Identity = 53/176 (30.11%), Postives = 77/176 (43.75%), Query Frame = -1
Query: 4390 TTRSKRAVVVKSADQWPDGVIPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQNCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSF 4917
            + R +RA   ++   WP GVIPY I  N F   + +  + A+  W   TCV F  + + +   V       C S VG      Q +++    C            ++G+  HELGH +G  HEH R  RD ++ I+ ENIQ      F K    +       +D  SIMHY   +F
Sbjct:  141 SARVRRATTSRTERIWPGGVIPYVIGGN-FTGTQRAIFKQAMRHWEKHTCVTFVERTDEESFIVFSYRTCGCCSYVGRRGGGPQAISIGK-NCD-----------KFGIVAHELGHVVGFWHEHTRPDRDQHVTIIRENIQPGQEYNFLKMEAGEVSSLGETYDFDSIMHYARNTF 303          
BLAST of SMED30016458 vs. Ensembl Mouse
Match: Bmp1 (bone morphogenetic protein 1 [Source:MGI Symbol;Acc:MGI:88176])

HSP 1 Score: 81.6481 bits (200), Expect = 6.958e-15
Identity = 54/170 (31.76%), Postives = 74/170 (43.53%), Query Frame = -1
Query: 4390 AVVVKSADQWPDGVIPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQNCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSF 4899
            A   +    WPDGVIP+ I  N F   + +  + A+  W   TCV F  + + D   V       C S VG      Q +++    C            ++G+ +HELGH IG  HEH R  RD ++ IV ENIQ      F K    +       +D  SIMHY   +F
Sbjct:  126 AATSRPERVWPDGVIPFVIGGN-FTGSQRAVFRQAMRHWEKHTCVTFLERTDEDSYIVFTYRPCGCCSYVGRRGGGPQAISIGK-NCD-----------KFGIVVHELGHVIGFWHEHTRPDRDRHVSIVRENIQPGQEYNFLKMEVQEVESLGETYDFDSIMHYARNTF 282          
BLAST of SMED30016458 vs. Ensembl Mouse
Match: Astl (astacin-like metalloendopeptidase (M12 family) [Source:MGI Symbol;Acc:MGI:3046414])

HSP 1 Score: 75.8702 bits (185), Expect = 1.552e-13
Identity = 57/187 (30.48%), Postives = 93/187 (49.73%), Query Frame = -1
Query: 4333 DQWPDGV-----IPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQNCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSFINEKGEPSIQVINESMIHL 4878
            ++WP GV     IP+ + R  ++E     + DA   +   TC+ F +     R++V I     C+S VG      Q V+LA P C          ++  G+ LHEL H +G  HEH R+ RD Y+++    I       F K+  ++ L   +P+D  S+MHYG  +F + +G+P+I  +  S +H+
Sbjct:   71 NKWPKGVGGFVEIPFLLSRK-YDELSRRVIMDAFAEFERFTCIRF-VAYHGQRDFVSILPMAGCFSGVGRSG-GMQVVSLA-PTCL---------RKGRGIVLHELMHVLGFWHEHSRADRDRYIQVNWNEILPGFEINFIKSRSTNML---VPYDYSSVMHYGRFAF-SWRGQPTIIPLWTSSVHI 240          
BLAST of SMED30016458 vs. UniProt/SwissProt
Match: sp|P42674|BP10_PARLI (Blastula protease 10 OS=Paracentrotus lividus OX=7656 GN=BP10 PE=2 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 7.722e-25
Identity = 77/261 (29.50%), Postives = 123/261 (47.13%), Query Frame = -1
Query: 4159 TTRSKRAVVVKSADQWPDGVIPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRN------WVKITGGQNCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSFINEKGEPSIQVINESMIHLLLEVHEKDLSFLDAKVVNLYYKCAD--RCFQNVTCSAGGYIDQYCQCHTPESFESRRCQD 4917
            T R KR   +  + +WP  VIPY I  ++  +  +  +++A++ W   TC+ F  +  S         ++    G  C+S VG  +  EQ++++ + GC +           +G  +HE+GHAIG  HE  R  RDDY+ ++ +NIQ+     F K         ++ +D+ SIMHYG   F +  G P+I   +  +   L +     LS  D ++ NL Y+C D   C     C  GGY D  C C  P  +    C+D
Sbjct:   87 TGRKKRKATIYESQRWPYKVIPYVISPSSSGQSSL--IRNAMDHWEQNTCLRFEPRTSSHSRQLGHNAYLSFFRGSGCWSYVGKAFNGEQQISIGN-GCAY-----------FGTIVHEIGHAIGFHHEQSRPDRDDYINVLYQNIQSGRQHNFAKYTWGRVTSRNVEYDVGSIMHYGGYGF-SSNGRPTITTRDPRLNSRLGQ--RIALSPADIELANLIYECDDIEDCAGANECLNGGYHDTECNCVCPSGYNGDLCED 330          
BLAST of SMED30016458 vs. UniProt/SwissProt
Match: sp|P98068|SPAN_STRPU (Protein SpAN OS=Strongylocentrotus purpuratus OX=7668 GN=SPAN PE=2 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 4.922e-23
Identity = 74/259 (28.57%), Postives = 120/259 (46.33%), Query Frame = -1
Query: 4159 RSKRAVVVKSADQWPDGVIPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRL------KRESDRNWVKITGGQNCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSFINEKGEPSIQVINESMIHLLLEVHEKDLSFLDAKVVNLYYKCAD--RCFQNVTCSAGGYIDQYCQCHTPESFESRRCQD 4911
            R KR   +  + +W   +IPY I+ ++  +  +  ++ A++ W   TC+ F         R    +++    G  C+S VG  +  +Q++++  P C +           +G  +HE+GHAIG  HE  R  RD+Y+ +  EN+Q+     F K         ++ +D+ SIMHYG   F +  G P+I  I+  +   L +     LS  D ++ N  Y+C D   C     C  GGY D  C C  P S+    CQD
Sbjct:   89 RKKRKATIYESQRWSYKIIPYVIESSSSGQSSL--IRSAMDHWEQNTCLRFEPLTSSHSSRLGHTSYISFFRGNGCWSHVGRSFTNQQQISIG-PQCGY-----------FGTIVHEIGHAIGFHHEQSRPDRDEYINVHFENVQSGREHNFAKYTWGSVTSSNVEYDVGSIMHYGGYGF-SSNGRPTITTIDPRLNSRLGQ--RTALSAADIELANRIYECDDVEDCSNADECLNGGYHDADCDCVCPSSYSGDLCQD 330          
BLAST of SMED30016458 vs. UniProt/SwissProt
Match: sp|P0DJJ2|ASTL_CHICK (Astacin-like metalloendopeptidase OS=Gallus gallus OX=9031 GN=ASTL PE=2 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 8.120e-22
Identity = 71/221 (32.13%), Postives = 114/221 (51.58%), Query Frame = -1
Query: 4225 WP---DGV--IPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQNCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSFINEKGEPSIQVINESMIHLLLEVHEKDLSFLDAKVVNLYYKCADRCFQNVTCSAG 4872
            WP   DG+  IPY +D   + E  V  +++A+  +   TC++F +KR+++R+++ I     C+S  G      Q +++   GC       W      G+  HEL HA+G  HEH RS RD Y++I+ E I   +   FKK   S+ L   +P+D  S+MHYGP +F N  G+ +I  + +  +H+   +    LS LD   +N  Y C+ RC   +  + G
Sbjct:   96 WPQSRDGIVRIPYVLD-PTYEENHVKGIREAMAEFETLTCINF-VKRKTERDYLIIRSADGCWSNYG-KVGGGQTISVMKGGCM------W-----KGIIQHELDHALGFLHEHSRSDRDKYVRIMWEYISPADRPDFKKFENSNNL--GLPYDYSSVMHYGPHTFTNTTGKATIVPVPDGSVHIGQRL---GLSNLDVAKINRLYNCS-RCSTIIDAAFG 296          
BLAST of SMED30016458 vs. UniProt/SwissProt
Match: sp|A0FKN6|VMPA_LOXIN (Astacin-like metalloprotease toxin 1 OS=Loxosceles intermedia OX=58218 PE=1 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.014e-21
Identity = 71/226 (31.42%), Postives = 110/226 (48.67%), Query Frame = -1
Query: 4261 VFHDGTTRSKRAVVVKSADQWPDGVIPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQNCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKK--NNKSDTLDFDMPFDLQSIMHYGPLSFINEKGEPSIQVINESMIHLLLEVHEKDLSFLDAKVVNLYYKCA 4932
            +F DG   ++R  V      WP+G I Y I       E++  +++A+ T+   TC+ FR +R ++ ++V I  G  CYS VG  +    +      GC            ++G  LHELGH++G DHEH R+ RD++L I +ENI+  +   F K   N + T+    PFD  SIM YG  +F  +  +       E  + +   + +  LS+ D   VN  YKC 
Sbjct:   41 LFDDGPLFTERNAVKYDQQLWPNGEIVYEISPGLRQYEQI--IREAMRTYEDNTCIKFR-RRTNEADYVNIHVGDRCYSRVGKSFRGGPQPLSLGRGCT-----------DFGTILHELGHSVGFDHEHSRADRDEFLIIHKENIKNGSEHNFDKLWENNTRTIG---PFDYDSIMLYGAYAFSKDTRKFKTMEPVEPGLPMKSVIQKGKLSYYDIVKVNKLYKCP 249          
BLAST of SMED30016458 vs. UniProt/SwissProt
Match: sp|Q19673|TYR3_CAEEL (Putative tyrosinase-like protein tyr-3 OS=Caenorhabditis elegans OX=6239 GN=tyr-3 PE=3 SV=5)

HSP 1 Score: 105.916 bits (263), Expect = 1.031e-21
Identity = 76/217 (35.02%), Postives = 101/217 (46.54%), Query Frame = -1
Query: 2194 INKNSECDKWSQMGECSKNPNYMLVNCAKSCNYCKFNKDLQKNCVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSCDSERE--CLNTHNDAECSKWSSMGECTKNPKYMLVNCAXXXXXXXXXNTDKGTCSNINSDKECENWSKRGECAKNPKYMLINCAKSCNSCESATQLPTACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVC 2838
             N+N  C  WS  GEC KNP YM V C  SC  C  N ++ + C + H  + C  WS+ GEC KNP +M  NC  SC+ C   R   C         S  ++M   T N               +++  D   C   N D+ C  W++RG+C  NP YM   C  SC  C     +   C + H    +C  W+ +GEC KN  +M ENC +SCN C
Sbjct:  473 FNENECCGPWSAKGECQKNPVYMNVWCKASCRQCTPNYNINEECSDRH--TNCAMWSRSGECNKNPLWMSENCRSSCQKCGRSRAATCGGGGGADSISNPTTMPPATNN-------------GQQNTPCDSPMC--YNEDQCCPIWAQRGQCRSNPGYMTCQCKVSCGVCR-PNYVYGPCADYHY---DCAAWARRGECLKN-KWMPENCRRSCNTC 667          

HSP 2 Score: 103.605 bits (257), Expect = 6.833e-21
Identity = 72/200 (36.00%), Postives = 100/200 (50.00%), Query Frame = -1
Query: 2584 CDKWSKLGECQKNPNYMLLNCAKSCNNCDLIPSDGKDCFNIYRNDKCEKWSNAGECSKNPKFMLENCAKSCNNCKTSQQ----------NDSNCV-------NINKNSECDK------------WSQMGECSKNPNYMLVNCAKSCNYCKFNKDLQKNCVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSCDSERE 3096
            C  WS  GECQKNP YM + C  SC  C    +  ++C +  R+  C  WS +GEC+KNP +M ENC  SC  C  S+           + SN         N  +N+ CD             W+Q G+C  NP YM   C  SC  C+ N  +   C + H D  C +W++RGEC KN K+M  NC +SC +C ++++
Sbjct:  479 CGPWSAKGECQKNPVYMNVWCKASCRQCTPNYNINEECSD--RHTNCAMWSRSGECNKNPLWMSENCRSSCQKCGRSRAATCGGGGGADSISNPTTMPPATNNGQQNTPCDSPMCYNEDQCCPIWAQRGQCRSNPGYMTCQCKVSCGVCRPNY-VYGPCADYHYD--CAAWARRGECLKN-KWMPENCRRSCNTCVNQQQ 672          

HSP 3 Score: 82.0333 bits (201), Expect = 2.769e-14
Identity = 66/208 (31.73%), Postives = 84/208 (40.38%), Query Frame = -1
Query: 1387 CKAWKDLGECFKNPVFMLSKCSQTCGSCDMEKNPVVVETCKNIDSNENCNTWQTAGECEKNPNYMLVNCAKACKTCQKDDAKNVEKKCDDVYSDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTCDQLKNNQTMCQNAYNDAICTKWKNMGECTKNPNFMLIQCKESCGKCEKLPKNTNCINLDNDKNCEKWAGENECTKNSKYMLERC 2010
            C  W   GEC KNPV+M   C  +C  C    N  + E C   D + NC  W  +GEC KNP +M  NC  +C+ C +  A                    A+ +    ++       +    CD       MC N   D  C  W   G+C  NP +M  QCK SCG C   P        D   +C  WA   EC KN K+M E C
Sbjct:  479 CGPWSAKGECQKNPVYMNVWCKASCRQCTPNYN--INEECS--DRHTNCAMWSRSGECNKNPLWMSENCRSSCQKCGRSRAATCGGGG------------GADSISNPTTMPPATNNGQQNTPCDS-----PMCYN--EDQCCPIWAQRGQCRSNPGYMTCQCKVSCGVCR--PNYVYGPCADYHYDCAAWARRGECLKN-KWMPENC 660          

HSP 4 Score: 81.6481 bits (200), Expect = 4.284e-14
Identity = 68/206 (33.01%), Postives = 94/206 (45.63%), Query Frame = -1
Query:   16 FYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSCQNLKFSLKVKCQNILTKEKCLKLKKAGECEKNSKQMAELCAYTCHKCNLSFVKP------MEINQNPTKMRSSK------FKCDNRA---GDFQCSYWARQKQCELNASYMRLFCQKSCGACLMEKPGQV--SCVDKFATMKCFSWSMRGECDRNGKWMTENCAKSCLVCQN 582
            F  N+ C  W+  G+C+ N  +M + C  SC  C    +++  +C +  T   C    ++GEC KN   M+E C  +C KC  S           +   NPT M  +         CD+      D  C  WA++ QC  N  YM   C+ SCG C   +P  V   C D      C +W+ RGEC +N KWM ENC +SC  C N
Sbjct:  473 FNENECCGPWSAKGECQKNPVYMNVWCKASCRQC-TPNYNINEECSDRHT--NCAMWSRSGECNKNPLWMSENCRSSCQKCGRSRAATCGGGGGADSISNPTTMPPATNNGQQNTPCDSPMCYNEDQCCPIWAQRGQCRSNPGYMTCQCKVSCGVC---RPNYVYGPCADYH--YDCAAWARRGECLKN-KWMPENCRRSCNTCVN 669          

HSP 5 Score: 75.0998 bits (183), Expect = 4.408e-12
Identity = 64/203 (31.53%), Postives = 85/203 (41.87%), Query Frame = -1
Query:  340 CDKWAAEGECLKNSKFMIQLCLKSCGRCYDLKNLKVNRTNSDGCENKYGDWSCEAWKQVGECERNPIFMNDQCSKSCGTCFKSTAT---------STSGPLRMSSVCKNFYSNKLCDE------------WTKNGDCKSNSDFMRINCARSCNSCQ-NLKFSLKVKCQNILTKEKCLKLKKAGECEKNSKQMAELCAYTCHKC 882
            C  W+A+GEC KN  +M   C  SC +C    N  +N   SD   N      C  W + GEC +NP++M++ C  SC  C +S A          S S P  M     N   N  CD             W + G C+SN  +M   C  SC  C+ N  +     C +      C    + GEC KN K M E C  +C+ C
Sbjct:  479 CGPWSAKGECQKNPVYMNVWCKASCRQC--TPNYNINEECSDRHTN------CAMWSRSGECNKNPLWMSENCRSSCQKCGRSRAATCGGGGGADSISNPTTMPPATNNGQQNTPCDSPMCYNEDQCCPIWAQRGQCRSNPGYMTCQCKVSCGVCRPNYVYG---PCADY--HYDCAAWARRGECLKN-KWMPENCRRSCNTC 667          

HSP 6 Score: 74.3294 bits (181), Expect = 7.051e-12
Identity = 62/207 (29.95%), Postives = 86/207 (41.55%), Query Frame = -1
Query: 2842 CEEFKSKGECTKNPDFMFIQCAKSCSKCKETKPGNDSLCKNIEKDNNCEQLKIRGECLRNVSYMRVNCAKTCFNC------------------NASVVDKPCVNSYMDSECDK------------WSKLGECQKNPNYMLLNCAKSCNNCDLIPSDGKDCFNIYRNDKCEKWSNAGECSKNPKFMLENCAKSCNNCKTSQQNDSNCV 3372
            C  + +KGEC KNP +M + C  SC +C      N+      ++  NC      GEC +N  +M  NC  +C  C                  N + +     N   ++ CD             W++ G+C+ NP YM   C  SC  C   P+        Y  D C  W+  GEC KN K+M ENC +SCN C   QQ  + C 
Sbjct:  479 CGPWSAKGECQKNPVYMNVWCKASCRQCTPNYNINEECS---DRHTNCAMWSRSGECNKNPLWMSENCRSSCQKCGRSRAATCGGGGGADSISNPTTMPPATNNGQQNTPCDSPMCYNEDQCCPIWAQRGQCRSNPGYMTCQCKVSCGVCR--PNYVYGPCADYHYD-CAAWARRGECLKN-KWMPENCRRSCNTCVNQQQLAARCA 678          

HSP 7 Score: 70.8626 bits (172), Expect = 8.034e-11
Identity = 69/244 (28.28%), Postives = 102/244 (41.80%), Query Frame = -1
Query:  406 FENKTCLNLYKDDTCDLWKKAGYCHIYPKFMLSHCLKSCGQCSE----YSECKNLYNNIVCDKWAAEGECLKNSKFMIQLCLKSCGRCYDLK------------------------NLKVNRT-NSDGCENKYGDWSCEAWKQVGECERNPIFMNDQCSKSCGTCFKSTATSTSGPLRMSSVCKNFYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSCQNLKFSLKVKCQNILTKEKCLKLKK 1050
            F   +C N  +++ C  W   G C   P +M   C  SC QC+       EC + + N  C  W+  GEC KN  +M + C  SC +C   +                        N + N   +S  C N+  D  C  W Q G+C  NP +M  QC  SCG C          P  +   C +++ +  C  W + G+C  N  +M  NC RSCN+C N +  L  +C   + +   L+L +
Sbjct:  467 FFQTSCFN--ENECCGPWSAKGECQKNPVYMNVWCKASCRQCTPNYNINEECSDRHTN--CAMWSRSGECNKNPLWMSENCRSSCQKCGRSRAATCGGGGGADSISNPTTMPPATNNGQQNTPCDSPMCYNE--DQCCPIWAQRGQCRSNPGYMTCQCKVSCGVC---------RPNYVYGPCADYHYD--CAAWARRGECLKNK-WMPENCRRSCNTCVNQQ-QLAARCATRIVRSAFLELIR 691          

HSP 8 Score: 70.4774 bits (171), Expect = 1.190e-10
Identity = 61/208 (29.33%), Postives = 88/208 (42.31%), Query Frame = -1
Query: 2704 CEQLKIRGECLRNVSYMRVNCAKTCFNCNASV-VDKPCVNSYMDSECDKWSKLGECQKNPNYMLLNCAKSCNNC--------------DLI-----------------PSDGKDCFNIYRNDKCEKWSNAGECSKNPKFMLENCAKSCNNCKTSQQNDSNCVNINKNSECDKWSQMGECSKNPNYMLVNCAKSCNYCKFNKDLQKNCV 3231
            C     +GEC +N  YM V C  +C  C  +  +++ C + +  + C  WS+ GEC KNP +M  NC  SC  C              D I                 P D   C+N   +  C  W+  G+C  NP +M   C  SC  C+ +      C + +   +C  W++ GEC KN  +M  NC +SCN C   + L   C 
Sbjct:  479 CGPWSAKGECQKNPVYMNVWCKASCRQCTPNYNINEECSDRH--TNCAMWSRSGECNKNPLWMSENCRSSCQKCGRSRAATCGGGGGADSISNPTTMPPATNNGQQNTPCDSPMCYN--EDQCCPIWAQRGQCRSNPGYMTCQCKVSCGVCRPNYVYGP-CADYHY--DCAAWARRGECLKN-KWMPENCRRSCNTCVNQQQLAARCA 678          

HSP 9 Score: 70.0922 bits (170), Expect = 1.352e-10
Identity = 56/197 (28.43%), Postives = 75/197 (38.07%), Query Frame = -1
Query: 1639 CESWKQAGECLNNEKYMKVQCGKSCGRCNAKTYV--DCKDIYQEDSCKAWKDLGECFKNPVFMLSKCSQTCGSC--------------DMEKNPVVVETCKN-------------IDSNENCNTWQTAGECEKNPNYMLVNCAKACKTCQKDDAKNVEKKCDDVYSDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTC 2142
            C  W   GEC  N  YM V C  SC +C     +  +C D  +  +C  W   GEC KNP++M   C  +C  C              D   NP  +    N              + ++ C  W   G+C  NP YM   C  +C  C+ +    V   C D + D  C  W   G C K    M   C ++C TC
Sbjct:  479 CGPWSAKGECQKNPVYMNVWCKASCRQCTPNYNINEECSD--RHTNCAMWSRSGECNKNPLWMSENCRSSCQKCGRSRAATCGGGGGADSISNPTTMPPATNNGQQNTPCDSPMCYNEDQCCPIWAQRGQCRSNPGYMTCQCKVSCGVCRPN---YVYGPCADYHYD--CAAWARRGECLKNKW-MPENCRRSCNTC 667          

HSP 10 Score: 67.0106 bits (162), Expect = 1.364e-9
Identity = 59/207 (28.50%), Postives = 79/207 (38.16%), Query Frame = -1
Query: 3514 EKCFKHRNRFVIPIKECKNLEKNETCDAWEKRGECKKNPRYMKFNCKQSCGLCDKSTTTLAPKIECKNIYGDDKCNLWEAVGDCQNNKLFMELNCAKACGKCGTXXXXXXXXXXXXXXXD-----------------------VYEENSCLSWADANECTKNPNFMHKMCKKSCKLCITKEPEKCTNQYDNLSCYVWSQTGECESNR 4065
            E C K R +F     +     +NE C  W  +GEC+KNP YM   CK SC  C   T       EC + + +  C +W   G+C  N L+M  NC  +C KCG             D                            E+  C  WA   +C  NP +M   CK SC +C           Y +  C  W++ GEC  N+
Sbjct:  458 ETCLKIRLKFF----QTSCFNENECCGPWSAKGECQKNPVYMNVWCKASCRQC---TPNYNINEECSDRHTN--CAMWSRSGECNKNPLWMSENCRSSCQKCGRSRAATCGGGGGADSISNPTTMPPATNNGQQNTPCDSPMCYNEDQCCPIWAQRGQCRSNPGYMTCQCKVSCGVCRPNYVYGPCADY-HYDCAAWARRGECLKNK 654          

HSP 11 Score: 63.1586 bits (152), Expect = 1.774e-8
Identity = 57/214 (26.64%), Postives = 86/214 (40.19%), Query Frame = -1
Query: 3592 CIEQQKKGHCELRNKYMSFNCRKTCEKCFKHRNRFVIPIKECKNLEKNETCDAWEKRGECKKNPRYMKFNCKQSCGLCDKS----------------TTTLAPKI---------ECKNIYGDDK-CNLWEAVGDCQNNKLFMELNCAKACGKCGTXXXXXXXXXXXXXXXDVYE-----ENSCLSWADANECTKNPNFMHKMCKKSCKLCITKE 4140
            C     KG C+    YM+  C+ +C +C  + N      +EC +   N  C  W + GEC KNP +M  NC+ SC  C +S                 TT+ P           +    Y +D+ C +W   G C++N  +M   C  +CG C                  VY         C +WA   EC KN  +M + C++SC  C+ ++
Sbjct:  479 CGPWSAKGECQKNPVYMNVWCKASCRQCTPNYNI----NEECSDRHTN--CAMWSRSGECNKNPLWMSENCRSSCQKCGRSRAATCGGGGGADSISNPTTMPPATNNGQQNTPCDSPMCYNEDQCCPIWAQRGQCRSNPGYMTCQCKVSCGVC--------------RPNYVYGPCADYHYDCAAWARRGECLKN-KWMPENCRRSCNTCVNQQ 671          

HSP 12 Score: 62.003 bits (149), Expect = 4.726e-8
Identity = 64/198 (32.32%), Postives = 96/198 (48.48%), Query Frame = -1
Query: 3148 CLSWADANECTKNPNFMHKMCKKSCKLCITKE--PEKCTNQYDNLSCYVWSQTGECESNRKYMEXXXXXXXXXXXXXKMQT-------------TTTPSLS---VITMPSNETLCQNKYGDKYCEEFKSKGECTKNPDFMFIQCAKSCSKCKETKPGNDSLCKNIEKDNNCEQLKIRGECLRNVSYMRVNCAKTCFNC 3687
            C  W+   EC KNP +M+  CK SC+ C       E+C++++ N  C +WS++GEC  N  +M +NC+ SC+ CG S+  T             TT P  +       P +  +C N+  D+ C  +  +G+C  NP +M  QC  SC  C+         C +   D  C     RGECL+N  +M  NC ++C  C
Sbjct:  479 CGPWSAKGECQKNPVYMNVWCKASCRQCTPNYNINEECSDRHTN--CAMWSRSGECNKNPLWMSENCRSSCQKCGRSRAATCGGGGGADSISNPTTMPPATNNGQQNTPCDSPMCYNE--DQCCPIWAQRGQCRSNPGYMTCQCKVSCGVCRPNYVYGP--CADYHYD--CAAWARRGECLKN-KWMPENCRRSCNTC 667          

HSP 13 Score: 57.7658 bits (138), Expect = 7.783e-7
Identity = 52/184 (28.26%), Postives = 79/184 (42.93%), Query Frame = -1
Query: 3760 YIDQYCQCH----TPESFESRRCQDKNDESWCIEQQKKGHCELRNKYMSFNCRKTCEKCFKHR--------------NRFVIPIKECKNLEKNETCDA------------WEKRGECKKNPRYMKFNCKQSCGLCDKSTTTLAPKIECKNIYGDDKCNLWEAVGDCQNNKLFMELNCAKACGKC 4221
            Y++ +C+      TP    +  C D++    C    + G C     +MS NCR +C+KC + R              N   +P     N ++N  CD+            W +RG+C+ NP YM   CK SCG+C +      P   C + + D  C  W   G+C  NK +M  NC ++C  C
Sbjct:  494 YMNVWCKASCRQCTPNYNINEECSDRHTN--CAMWSRSGECNKNPLWMSENCRSSCQKCGRSRAATCGGGGGADSISNPTTMP-PATNNGQQNTPCDSPMCYNEDQCCPIWAQRGQCRSNPGYMTCQCKVSCGVC-RPNYVYGP---CADYHYD--CAAWARRGECLKNK-WMPENCRRSCNTC 667          

HSP 14 Score: 54.299 bits (129), Expect = 8.950e-6
Identity = 67/226 (29.65%), Postives = 96/226 (42.48%), Query Frame = -1
Query:  925 ESCGKCEKLPKNTNCINLDNDKNCEKWAGENECTKNSKYMLERCFKXXXXXXXXXSAKTPSEVCSNLANDTDCESWSKAGHCEKNVSYMLKFCAKSCKACNRL----------------ITTSLPSIN------------CVNKLNDSTCETLKILGQCEKNSIFMIEKCGKSCGSCRPAKEKTFENKTCLNLYKDDTCDLWKKAGYCHIYPKFMLSHCLKSCGQC 1518
            E+C K       T+C N   ++ C  W+ + EC KN  YM   C  SC  C+ + +    +E CS+    T+C  WS++G C KN  +M + C  SC+ C R                  TT  P+ N            C N+  D  C      GQC  N  +M  +C  SCG CRP     +    C + + D  C  W + G C +  K+M  +C +SC  C
Sbjct:  458 ETCLKIRLKFFQTSCFN--ENECCGPWSAKGECQKNPVYMNVWCKASCRQCTPNYNI---NEECSD--RHTNCAMWSRSGECNKNPLWMSENCRSSCQKCGRSRAATCGGGGGADSISNPTTMPPATNNGQQNTPCDSPMCYNE--DQCCPIWAQRGQCRSNPGYMTCQCKVSCGVCRP----NYVYGPCADYHYD--CAAWARRGEC-LKNKWMPENCRRSCNTC 667          
BLAST of SMED30016458 vs. TrEMBL
Match: A0A1S3H5F6 (Metalloendopeptidase OS=Lingula unguis OX=7574 GN=LOC106152365 PE=4 SV=1)

HSP 1 Score: 470.7 bits (1210), Expect = 3.190e-138
Identity = 360/1182 (30.46%), Postives = 535/1182 (45.26%), Query Frame = -1
Query: 1612 TRSKRAVVVKSADQWPDGVIPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQNCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSFINEKGEPSIQVINESMIHLLLEVHEKDLSFLDAKVVNLYYKCADRCFQNVTCSAGGYIDQYCQC-----------HTPESF--ESRRCQDKNDESWCIEQQKKGHCELRNKYMSFNCRKTCEKCFKHRNRFVIP--IKECKNLEKNET-CDAWEKRGECKKNPRYMKFNCKQSCGLCDKSTTTLAPKIECKNIYGDD-KCNLWEAVGDCQNNKLFMELNCAKACGKCGTXXXXXXXXXXXXX-----XXDVYEENSCLSWADANECTKNPNFMHKMCKKSCKLCITKEP-------------EKCTNQYDNLSCYVWSQTGECESNRKYMEXXXXXXXXXXXXXKMQTTTTPSLSVITMPSNETLCQNKYGDKYCEEFKSKGECTKNPDFMFIQCAKSCSKCKE----TKPGNDSLCKNIEKDNNCEQLKIRGECLRNVSYMRVNCAKTCFNCNASV----VDKPCVNSYM-DSECDKWSKLGECQKNPNYMLLNCAKSCNNC--DLIPSDGKDCFNIYRND-KCEKWSNAGECSKNPKFMLENCAKSCNNC---KTSQQNDSNCVNINKNS-ECDKWSQMGECSKNPNYMLVNCAKSCNYC--------KFNKDLQKNCVNTHK-DSECESWSKRGECQKNPKYMLVNCAKSCKSCDSERE-------------CLNTHNDAECSKWSSMGECTKNPKYMLVNCAXXXXXXXXXNTDKGTCSNIN------SDKECENWSKRGECAKNPKYMLINCAKSCNSCESATQLPTACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVCKFNNETKGCRNLDPNSDCESWKQAGECLNNEKYMKVQCGKSCGRCNAKTYVDCKDIYQEDSCKAWKDLGECFKNPVFMLSKCSQTCGSCDMEKNPVVVETCKN--IDSNENCNTWQTAGECEKNPNYMLVNCAKACKTCQKDDAKNVEKKCDDVYSDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTCDQLKNNQTM 4914
            +R KR        +W +  +PY I  + F+E E+  +  A+  W   TC  FR     D N V    G  C S VGM     QE+NL +PGCR      W      GLYLHE+GHA+G  HEH    RD+Y++I   N+       F K  +++   +   +DL SIMHYG  +F  +    +I+  + S  H + +V +K+L+F D +VVN  Y CA  C + V C   G++D++C+C            TP +   ++  C++  ++  C +  +   C +   +M+ NCRK+C KCF   +       I+ C+N   ++  C  W K GEC  N ++M  NC ++CG C  +        +C N+YG D KC  W   G+C+ N  +M  NC KACGKCG  + G                   +  +C+ WA   EC  NP +M   C+KSC+ C T                + C ++ D   C  W   G CE++  +M              +    T     V     ++  C+N   DK C+E+  +GEC  + ++M   C K+C KC       K GN++          C +    GEC  N  +M  NC K+C  C+ S      D  C N +  D+EC+ W K GEC KNP +M+ NC K+CN C       D  +C NIY ND +C+ W+  GECS NP +M ENCAKSC  C     +  N  +C N   N  +C  W++ GEC+ NP +M +NC K+C  C                 C N +K D++C+ W+  GEC  NP +M +NC K+C  C                  C+N++ DA+C  W+   +C  NP +ML  C K+C SC   + + GT +N N       D+ C  W++ G C+ NP +M  NC K+C  C         C N H ++ +C  W++ G+C  NP++ML NC K+C  C  +    G    D N D             +         +C   NA    +C  + ++         G+C  +  +M   C + C  CD   N   V+  +   ID   NC        C  N  +M  NC K C  C+     N  ++C          +W   G CE+   VM  +C   CG C+  K ++ +
Sbjct:   84 SREKRKATSDLTLKWTNATMPYDIITSDFSENEIKIIHIAMREWEHHTCFKFRPAGPLDFNKVVFKNGIGCNSQVGM-VGGPQELNLEAPGCR------W-----KGLYLHEIGHAMGFFHEHQMPDRDNYIEINYNNVAPVMRQWFDKYPRNEVNTYGTSYDLSSIMHYGITAFAADGKSQTIRAKDRSKEHTIGKVWQKELAFSDIRVVNEMYHCAAHCPKTVRCVDEGFLDKHCKCVCKDGTSNCQRGTPITTGPDNSNCKNIKEDHRCEQWARDNECNMNPIWMTENCRKSCNKCFDFTDTSPDGPYIEGCENTYDDDLKCQQWAKDGECFVNIKWMATNCAKACGKCKSN--------KCLNLYGKDAKCQAWADEGECRANPTWMIPNCRKACGKCGDGTGGNGGGGTGTGSGGKCRDIHTDPLACMRWASEGECEANPLWMIPNCRKSCEKCDTDGGTDGGTDGGTDTGNKACADKLDTNKCQGWKDGGSCENDPAFM-------------IQYCQKTCDKCGV-----DKEGCKNLVEDKDCQEWAGRGECEASSEYMTANCRKACKKCITGSCVNKHGNEA---------ECGRWAAEGECSVNPLWMIENCKKSCGKCDTSTGDGGTDGTCKNIHSNDAECEAWEKRGECSKNPLWMVPNCRKACNRCGDGTDTPDTGNCRNIYGNDVQCDSWAKVGECSANPVWMGENCAKSCKTCDGNNNNNNNGGSCTNSYGNDVQCSDWAKRGECTANPVWMTMNCEKACQKCGGSEDGGGDGGNTNGGECKNLYKDDAQCQDWADSGECAANPDWMPINCKKACGLCGDGDNTGDGNTGNGGNVNCVNSYGDAQCELWARDNQCAVNPTFMLEQCKKACRSCDRGSDNGGTTANSNCVNTHHDDESCRIWAEHGHCSSNPDWMTKNCQKACGLC-GGRDGSGDCRNKHYDDAQCEDWAKYGQCQTNPDWMLPNCKKACTKC--DKIATGTSQEDNNVDDREIITLPTTTTTQNPPPPPPDDAC--VNAHGDTECAQMARD---------GKCISDSRWMRRHCRRACTECDKGSNSGTVDNNRLQCIDVVGNCAELAQNNGCSNNLQHMYNNCKKTCGLCEPGACTNKHRQCK---------RWARHGGCERNPGVMYRQCPVECGLCEHTKTDRAL 1195          

HSP 2 Score: 382.489 bits (981), Expect = 4.676e-107
Identity = 289/902 (32.04%), Postives = 420/902 (46.56%), Query Frame = -1
Query:  925 SVITMPSNETLCQNKYGDKYCEEFKSKGECTKNPDFMFIQCAKSCSKC---KETKPGNDSL--CKNIEKDN-NCEQLKIRGECLRNVSYMRVNCAKTCFNCNASVVDKPCVNSYM-DSECDKWSKLGECQKNPNYMLLNCAKSCNNCDLIPSDGKD----------CFNIYRND-KCEKWSNAGECSKNPKFMLENCAKSCNNC-----------KTSQQNDSNCVNINKNSECDKWSQMGECSKNPNYMLVNCAKSCNYCKFNKDLQKNCVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSCDSERECLNTH-NDAECSKWSSMGECTKNPKYMLVNCAXXXXXXXXXNTD---KGTCSNINS-DKECENWSKRGECAKNPKYMLINCAKSCNSCESATQLPTA--CTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVC----KFNNETKGCRNLDPNS-DCESWKQAGECLNNEKYMKVQCGKSCGRC----------NAKTYVDCKDIYQEDS-CKAWKDLGECFKNPVFMLSKCSQTCGSCDMEKNPVVVET-------CKNIDSNENCNTWQTAGECEKNPNYMLVNCAKACKTCQK---DDAKNVEKKCDDV-YSDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTCDQLKNNQTMCQNAYNDAICTKWKNMGECTKNPNFMLIQCKESCGKCEKLPKNTNCINLDNDKNCEKWAGENECTKNSKYMLERCFKXXXXXXXXXSAKTPSEVCSNLANDTDCESWSKAGHCEKNVSYMLKFCAKSCKACNRLITTSLPS---INCVNKLNDSTCETLKILGQCEKNSIFMIEKCGKSCGSCRPAKEKTFENKTCLNLYKDDTCDLWKKAGYCHIYPKFMLSHCLKSCGQC 3432
            + IT   + + C+N   D  CE++    EC  NP +M   C KSC+KC    +T P    +  C+N   D+  C+Q    GEC  N+ +M  NCAK C  C ++     C+N Y  D++C  W+  GEC+ NP +M+ NC K+C  C                   C +I+ +   C +W++ GEC  NP +M+ NC KSC  C             +   +  C +    ++C  W   G C  +P +M+  C K+C+ C  +K+  KN V   +D +C+ W+ RGEC+ + +YM  NC K+CK C +   C+N H N+AEC +W++ GEC+ NP +M+ NC KSC  C +S  D    GTC NI+S D ECE W KRGEC+KNP +M+ NC K+CN C   T  P    C NI+ N+ +C  W++ GECS NP +M ENCAKSC  C      NN    C N   N   C  W + GEC  N  +M + C K+C +C                +CK++Y++D+ C+ W D GEC  NP +M   C + CG C    N     T       C N   +  C  W    +C  NP +ML  C KAC++C +   +        C +  + D SC  W   G C      M   C K CG C     +       Y+DA C  W   G+C  NP++ML  CK++C KC+K+   T+      D N +                E         + +     P + C N   DT+C   ++ G C  +  +M + C ++C  C++   +       + C++ + +  C  L     C  N   M   C K+CG C P          C N ++   C  W + G C   P  M   C   CG C
Sbjct:  323 TPITTGPDNSNCKNIKEDHRCEQWARDNECNMNPIWMTENCRKSCNKCFDFTDTSPDGPYIEGCENTYDDDLKCQQWAKDGECFVNIKWMATNCAKACGKCKSN----KCLNLYGKDAKCQAWADEGECRANPTWMIPNCRKACGKCGDGTGGNGGGGTGTGSGGKCRDIHTDPLACMRWASEGECEANPLWMIPNCRKSCEKCDTDGGTDGGTDGGTDTGNKACADKLDTNKCQGWKDGGSCENDPAFMIQYCQKTCDKCGVDKEGCKNLV---EDKDCQEWAGRGECEASSEYMTANCRKACKKCITG-SCVNKHGNEAECGRWAAEGECSVNPLWMIENCKKSCGKCDTSTGDGGTDGTCKNIHSNDAECEAWEKRGECSKNPLWMVPNCRKACNRCGDGTDTPDTGNCRNIYGNDVQCDSWAKVGECSANPVWMGENCAKSCKTCDGNNNNNNNGGSCTNSYGNDVQCSDWAKRGECTANPVWMTMNCEKACQKCGGSEDGGGDGGNTNGGECKNLYKDDAQCQDWADSGECAANPDWMPINCKKACGLCGDGDNTGDGNTGNGGNVNCVNSYGDAQCELWARDNQCAVNPTFMLEQCKKACRSCDRGSDNGGTTANSNCVNTHHDDESCRIWAEHGHCSSNPDWMTKNCQKACGLCGGRDGSGDCRNKHYDDAQCEDWAKYGQCQTNPDWMLPNCKKACTKCDKIATGTS----QEDNNVDD--------------REIITLPTTTTTQNPPPPPPDDACVNAHGDTECAQMARDGKCISDSRWMRRHCRRACTECDKGSNSGTVDNNRLQCIDVVGN--CAELAQNNGCSNNLQHMYNNCKKTCGLCEPG--------ACTNKHR--QCKRWARHGGCERNPGVMYRQCPVECGLC 1186          

HSP 3 Score: 372.859 bits (956), Expect = 9.330e-104
Identity = 289/917 (31.52%), Postives = 420/917 (45.80%), Query Frame = -1
Query:  610 CVNSYMDSECDKWSKLGECQKNPNYMLLNCAKSCNNC----DLIPSDG---KDCFNIYRND-KCEKWSNAGECSKNPKFMLENCAKSCNNCKTSQQNDSNCVNI-NKNSECDKWSQMGECSKNPNYMLVNCAKSCNYCKFNKDLQKN----------CVNTHKDS-ECESWSKRGECQKNPKYMLVNCAKSCKSCDSE---------------RECLNTHNDAECSKWSSMGECTKNPKYMLVNCAXXXXXXXXXNTDKGTCSNINSDKECENWSKRGECAKNPKYMLINCAKSCNSCESATQLPTACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVCKFNNETKG----CRNLDPN-SDCESWKQAGECLNNEKYMKVQCGKSCGRCNAKTYV----DCKDIYQED-SCKAWKDLGECFKNPVFMLSKCSQTCGSCD-MEKNPVVVETCKNIDSNE-NCNTWQTAGECEKNPNYMLVNCAKACKTC------QKDDAKNVEKKCDDVY-SDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTCDQLKNNQTM---------CQNAYNDAICTKWKNMGECTKNPNFMLIQCKESCGKCEK------LPKNTNCINL-DNDKNCEKWAGENECTKNSKYMLERCFKXXXXXXXXXSAKTPSEVCSN-LANDTDCESWSKAGHCEKNVSYMLKFCAKSCKACNRLITTSLPSINCVNKLNDSTCETLKILGQCEKNSIFMIEKCGKSCGSCRPAKEKTFENKTCLNLYKDDTCDLWKKAGYCHIYPKFMLSHCLKSCGQCSEYSECKNLYNNIV--------CDKWAAEGECLKNSKFMIQLCLKSCGRCYDLKNLKVNRTNSDGCENKYGDWSCEAWKQVGECERNPIFMNDQCSKSCGTCFKSTATSTSGP 3123
            C N   D  C++W++  EC  NP +M  NC KSCN C    D  P DG   + C N Y +D KC++W+  GEC  N K+M  NCAK+C  CK+++     C+N+  K+++C  W+  GEC  NP +M+ NC K+C  C                   C + H D   C  W+  GEC+ NP +M+ NC KSC+ CD++               + C +  +  +C  W   G C  +P +M+  C     +C     DK  C N+  DK+C+ W+ RGEC  + +YM  NC K+C  C     +  +C N H NE EC +W+ +GECS NP +M+ENC KSC  C  +    G    C+N+  N ++CE+W++ GEC  N  +M   C K+C RC   T      +C++IY  D  C +W  +GEC  NPV+M   C+++C +CD    N     +C N   N+  C+ W   GEC  NP +M +NC KAC+ C        D       +C ++Y  D  C  W   G C      M + C K CG C    N             C N+Y DA C  W    +C  NP FML QCK++C  C++         N+NC+N   +D++C  WA    C+ N  +M + C K           +  S  C N   +D  CE W+K G C+ N  +ML  C K+C  C+++ T +                        E N++   E       +          +  C+N + D  C    + G C    ++M  HC ++C +C + S    + NN +        C + A    C  N + M   C K+CG C               C NK+    C+ W + G CERNP  M  QC   CG C + T T  + P
Sbjct:  334 CKNIKEDHRCEQWARDNECNMNPIWMTENCRKSCNKCFDFTDTSP-DGPYIEGCENTYDDDLKCQQWAKDGECFVNIKWMATNCAKACGKCKSNK-----CLNLYGKDAKCQAWADEGECRANPTWMIPNCRKACGKCGDGTGGNGGGGTGTGSGGKCRDIHTDPLACMRWASEGECEANPLWMIPNCRKSCEKCDTDGGTDGGTDGGTDTGNKACADKLDTNKCQGWKDGGSCENDPAFMIQYC---QKTCDKCGVDKEGCKNLVEDKDCQEWAGRGECEASSEYMTANCRKACKKC-----ITGSCVNKHGNEAECGRWAAEGECSVNPLWMIENCKKSCGKCDTSTGDGGTDGTCKNIHSNDAECEAWEKRGECSKNPLWMVPNCRKACNRCGDGTDTPDTGNCRNIYGNDVQCDSWAKVGECSANPVWMGENCAKSCKTCDGNNNNNNNGGSCTNSYGNDVQCSDWAKRGECTANPVWMTMNCEKACQKCGGSEDGGGDGGNTNGGECKNLYKDDAQCQDWADSGECAANPDWMPINCKKACGLCGDGDNTGDGNTGNGGNVNCVNSYGDAQCELWARDNQCAVNPTFMLEQCKKACRSCDRGSDNGGTTANSNCVNTHHDDESCRIWAEHGHCSSNPDWMTKNCQK----ACGLCGGRDGSGDCRNKHYDDAQCEDWAKYGQCQTNPDWMLPNCKKACTKCDKIATGTSQ----------------------EDNNVDDREIITLPTTTTTQNPPPPPPDDACVNAHGDTECAQMARDGKCISDSRWMRRHCRRACTECDKGSNSGTVDNNRLQCIDVVGNCAELAQNNGCSNNLQHMYNNCKKTCGLC-----------EPGACTNKHR--QCKRWARHGGCERNPGVMYRQCPVECGLC-EHTKTDRALP 1196          

HSP 4 Score: 347.821 bits (891), Expect = 2.997e-95
Identity = 273/892 (30.61%), Postives = 410/892 (45.96%), Query Frame = -1
Query:  469 TSQQNDSNCVNINKNSECDKWSQMGECSKNPNYMLVNCAKSCNYCKFNKDLQ------KNCVNTHKDS-ECESWSKRGECQKNPKYMLVNCAKSCKSCDSERECLNTHN-DAECSKWSSMGECTKNPKYMLVNCAXX----------XXXXXXXNTDKGTCSNINSDK-ECENWSKRGECAKNPKYMLINCAKSCNSCESATQLPT-----------ACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVCKFNNETKGCRNLDPNSDCESWKQAGECLNNEKYMKVQCGKSCGRCNAKTYVDCKDIYQEDSCKAWKDLGECFKNPVFMLSKCSQTCGSCDMEKNPVVVE-TCKNIDSNE-NCNTWQTAGECEKNPNYMLVNCAKACKTCQKDDAKNVEKKCDDVYS-DVSCLKWKAEGLCEKQSLVMKVKCSKTCGTCDQLKNNQTM---CQNAY-NDAICTKWKNMGECTKNPNFMLIQCKESCGKC---------EKLPKNTNCINL-DNDKNCEKWAGENECTKNSKYMLERCFKX------XXXXXXXXSAKTPSEVCSNLANDTDCESWSKAGHCEKNVSYMLKFCAKSCKACNRLI--TTSLPSINCVN-KLNDSTCETLKILGQCEKNSIFMIEKCGKSCGSCRPAKEKTFENKTCLNLYKDDT-CDLWKKAGYCHIYPKFMLSHCLKSCGQCSEYS----------------------------------ECKNLYNNIVCDKWAAEGECLKNSKFMIQLCLKSCGRCYDLKNLKVNRTNSDGCENKYGDWSCEAWKQVGECERNPIFMNDQCSKSCGTCFKSTATSTSGPLRMSSVCKNFYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSCQNLK 2871
            T+  ++SNC NI ++  C++W++  EC+ NP +M  NC KSCN C    D        + C NT+ D  +C+ W+K GEC  N K+M  NCAK+C  C S + CLN +  DA+C  W+  GEC  NP +M+ NC K+               +     G C +I++D   C  W+  GEC  NP +M+ NC KSC  C++                 AC +   + ++C+ W + G C  +P FM++ C K+C+ C  + E  GC+NL  + DC+ W   GEC  + +YM   C K+C +C   + V+      E  C  W   GEC  NP++M+  C ++CG CD        + TCKNI SN+  C  W+  GEC KNP +M+ NC KAC  C           C ++Y  DV C  W   G C    + M   C+K+C TCD   NN      C N+Y ND  C+ W   GECT NP +M + C+++C KC                 C NL  +D  C+ WA   EC  N  +M   C K+       +N    ++    +  C N   D  CE W++   C  N ++ML+ C K+C++C+R      +  + NCVN   +D +C      G C  N  +M + C K+CG C   ++ + +   C N + DD  C+ W K G C   P +ML +C K+C +C + +                                   C N + +  C + A +G+C+ +S++M + C ++C  C    N      N   C +  G+  C    Q   C  N   M + C K+CG C     T+                ++ C  W ++G C+ N   M   C   C  C++ K
Sbjct:  326 TTGPDNSNCKNIKEDHRCEQWARDNECNMNPIWMTENCRKSCNKCFDFTDTSPDGPYIEGCENTYDDDLKCQQWAKDGECFVNIKWMATNCAKACGKCKSNK-CLNLYGKDAKCQAWADEGECRANPTWMIPNCRKACGKCGDGTGGNGGGGTGTGSGGKCRDIHTDPLACMRWASEGECEANPLWMIPNCRKSCEKCDTDGGTDGGTDGGTDTGNKACAD-KLDTNKCQGWKDGGSCENDPAFMIQYCQKTCDKCGVDKE--GCKNLVEDKDCQEWAGRGECEASSEYMTANCRKACKKCITGSCVN--KHGNEAECGRWAAEGECSVNPLWMIENCKKSCGKCDTSTGDGGTDGTCKNIHSNDAECEAWEKRGECSKNPLWMVPNCRKACNRCGDGTDTPDTGNCRNIYGNDVQCDSWAKVGECSANPVWMGENCAKSCKTCDGNNNNNNNGGSCTNSYGNDVQCSDWAKRGECTANPVWMTMNCEKACQKCGGSEDGGGDGGNTNGGECKNLYKDDAQCQDWADSGECAANPDWMPINCKKACGLCGDGDNTGDGNTGNGGNVNCVNSYGDAQCELWARDNQCAVNPTFMLEQCKKACRSCDRGSDNGGTTANSNCVNTHHDDESCRIWAEHGHCSSNPDWMTKNCQKACGLC-GGRDGSGD---CRNKHYDDAQCEDWAKYGQCQTNPDWMLPNCKKACTKCDKIATGTSQEDNNVDDREIITLPTTTTTQNPPPPPPDDACVNAHGDTECAQMARDGKCISDSRWMRRHCRRACTECDKGSNSGTVDNNRLQCIDVVGN--CAELAQNNGCSNNLQHMYNNCKKTCGLCEPGACTN---------------KHRQCKRWARHGGCERNPGVMYRQCPVECGLCEHTK 1190          

HSP 5 Score: 334.339 bits (856), Expect = 7.554e-91
Identity = 263/899 (29.25%), Postives = 397/899 (44.16%), Query Frame = -1
Query:   16 DKGTCSNINSDKECENWSKRGECAKNPKYMLINCAKSCNSCESATQLPT------ACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVCKFNNETKGCRNL-DPNSDCESWKQAGECLNNEKYMKVQCGKSCGRCNAKTYVD------------CKDIYQED-SCKAWKDLGECFKNPVFMLSKCSQTCGSCDMEKNPVVV---------ETCKNIDSNENCNTWQTAGECEKNPNYMLVNCAKACKTCQKDDAKNVEKKCDDVYSDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTCDQLKNNQTMCQNAY-NDAICTKWKNMGECTKNPNFMLIQCKESCGKCEKLPKNTN----CINL-DNDKNCEKWAGENECTKNSKYMLERCFKXXXXXXXXXSAKTPSEVCSNLANDTDCESWSKAGHCEKNVSYMLKFCAKSCKACNRLITTSLPSINCVNKL-NDSTCETLKILGQCEKNSIFMIEKCGKSCGSCRPAKEKTFENKT-----CLNLYKDDT-CDLWKKAGYCHIYPKFMLSHCLKSCGQCSEYSE-------------CKNLYNNIVCDKWAAEGECLKNSKFMIQLCLKSCGRCYDLKNLKVNRTNSDGCENKYGDWSCEAWKQVGECERNPIFMNDQCSKSCGTCFKSTATSTSGPLRMSSVCKN-FYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSCQNLKFSLKVKCQNILTKE-----------------------------KCLKLKKAGECEKNSKQMAELCAYTCHKCNLSFVKPMEINQNPTKMRSSKFKCDNRAGDFQCSYWARQKQCELNASYMRLFCQKSCGACLMEKPGQVSCVDKFATMKCFSWSMRGECDRNGKWMTENCAKSCLVCQN 2457
            D   C NI  D  CE W++  EC  NP +M  NC KSCN C   T           C N + ++ +C++W++ GEC  N  +M  NCAK+C  CK N     C NL   ++ C++W   GEC  N  +M   C K+CG+C   T  +            C+DI+ +  +C  W   GEC  NP++M+  C ++C  CD +               + C +      C  W+  G CE +P +M+  C K C  C  D     ++ C ++  D  C +W   G CE  S  M   C K C  C         C N + N+A C +W   GEC+ NP +M+  CK+SCGKC+    +      C N+  ND  CE W    EC+KN  +M+  C K+CN C   +         +   ND  C+SW+K G C  N  +M + CAKSCK C+     +    +C N   ND  C      G+C  N ++M   C K+C  C  +++   +        C NLYKDD  C  W  +G C   P +M  +C K+CG C +                C N Y +  C+ WA + +C  N  FM++ C K+C  C    +      NS+     + D SC  W + G C  NP +M   C K+CG C         G    S  C+N  Y +  C++W K G C++N D+M  NC ++C  C  +      +  N+  +E                             +C ++ + G+C  +S+ M   C   C +C+           N   + +++ +C +  G+  C+  A+   C  N  +M   C+K+CG C   +PG  +C +K    +C  W+  G C+RN   M   C   C +C++
Sbjct:  330 DNSNCKNIKEDHRCEQWARDNECNMNPIWMTENCRKSCNKCFDFTDTSPDGPYIEGCENTYDDDLKCQQWAKDGECFVNIKWMATNCAKACGKCKSNK----CLNLYGKDAKCQAWADEGECRANPTWMIPNCRKACGKCGDGTGGNGGGGTGTGSGGKCRDIHTDPLACMRWASEGECEANPLWMIPNCRKSCEKCDTDGGTDGGTDGGTDTGNKACADKLDTNKCQGWKDGGSCENDPAFMIQYCQKTCDKCGVD-----KEGCKNLVEDKDCQEWAGRGECEASSEYMTANCRKACKKCIT-----GSCVNKHGNEAECGRWAAEGECSVNPLWMIENCKKSCGKCDTSTGDGGTDGTCKNIHSNDAECEAWEKRGECSKNPLWMVPNCRKACNRCGDGTDTPDTGNCRNIYGNDVQCDSWAKVGECSANPVWMGENCAKSCKTCDGNNNNNNNGGSCTNSYGNDVQCSDWAKRGECTANPVWMTMNCEKACQKCGGSEDGGGDGGNTNGGECKNLYKDDAQCQDWADSGECAANPDWMPINCKKACGLCGDGDNTGDGNTGNGGNVNCVNSYGDAQCELWARDNQCAVNPTFMLEQCKKACRSCDRGSDNGGTTANSNCVNTHHDDESCRIWAEHGHCSSNPDWMTKNCQKACGLC---------GGRDGSGDCRNKHYDDAQCEDWAKYGQCQTNPDWMLPNCKKACTKCDKIATGTSQEDNNVDDREIITLPTTTTTQNPPPPPPDDACVNAHGDTECAQMARDGKCISDSRWMRRHCRRACTECDKG--------SNSGTVDNNRLQCIDVVGN--CAELAQNNGCSNNLQHMYNNCKKTCGLC---EPG--ACTNKH--RQCKRWARHGGCERNPGVMYRQCPVECGLCEH 1188          
BLAST of SMED30016458 vs. TrEMBL
Match: A0A2C9KD44 (Metalloendopeptidase OS=Biomphalaria glabrata OX=6526 GN=106055728 PE=4 SV=1)

HSP 1 Score: 434.491 bits (1116), Expect = 1.030e-125
Identity = 325/1078 (30.15%), Postives = 499/1078 (46.29%), Query Frame = -1
Query: 1585 TWNFETCVHFRLKRESDRNWVKITGGQNCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSFINEKGEPSIQVINESMIHLLLEVHEKDLSFLDAKVVNLYYKCADRCFQNVTCSAGGYIDQYCQCHTPESFESRRCQDKNDESWCIEQQKKGHCELRNKYMSFNCRKTCEKCFKHRNRFVIPIKECKNLEKNETCDAWEKRGECKKNPRYMKFNCKQSCGLCDKSTTTLAPKIECKNIYGDDKCNLWEAVGDCQNNKLFMELNCAKACGKCGTXXXXXXXXXXXXXXXDVYEENSCLSWADANECTKNPNFMHKMCKKSCKLCITKEP--------EKCTNQYDNLSCYVWSQTGECESNRKYMEXXXXXXXXXXXXXKMQTTTTPSLSVITMPSNETLCQNKYGDKYCEEFKSKGECTKNPDFMFIQCAKSCSKCKETKPGNDSLCKNIEKDNNCEQLKIRGECLRNVSYMRVNCAKTCFNCNASVVDKPCVNSYMDSECDKWSKLGECQKNPNYMLLNCAKSCNNCDLIPSDGKDCFNIYRNDKCEKWSNAGECSKNPKFMLENCAKSCNNCKTSQQNDSNCVNINKNSECDKWSQMGECSKNPNYMLVNCAKSCNYCKFNKDLQKNCVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSCDSERECLNTHNDAECSKWSSMGECTKNPKYMLVNCAXXXXXXXXXNTDKGTCSNINSDKECENWSKRGECA-KNPKYMLINCAKSCNSCESATQLPTACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVCKFNNETKGCRNLDPNSDCESWKQAGECLNNEKYMKVQCGKSCGRCNAKTYVDCKDIYQEDSCKAWKDLGECFKNPVFMLSKCSQTCGSCDMEKNPVVVETCKNIDSNENCNTWQTAGECEKNPNYMLVNCAKACKTCQKDDAKNVEKKCDDVYSDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTCD-QLKNNQTMCQNAYNDAI 4788
             W+ +TC+ FR  R SD N +K   G  C S+VGM     Q ++LA+ GCR+            G+YLHELGHAIGL HEH    RD+Y+ I  +N+Q    D ++K +  D  ++ +P++  S+MHYG   F  ++ + +I V + +  H + EV +K LSF D KVVNL YKC   C  N  C   GY+D++C+C  P                 ++  K+GH                    +    + I   +C+N  K+E C AW KRGEC+ NP +MK NC+++C  C K+         C N++ D+ C+ W A G+C  NK +M  +C ++CG CGT  +     +          ++     A  +    N +    + +    L  +             C+N + +  C  W++ GEC  N+K+MEK                  + S  V       T C N + +  C ++ ++GEC  N ++M   C +SC  C+         C N+  + +C++  I GEC  N ++M  NC ++C  C +      C N + D++C KW+  GEC  N  +M   C +SC+ C+      K+C N + + +C  W++ GEC +N  +M ENC KSC  C       + C N+  +  C+KW+  GEC+ N  +M  NC +SC  CK        CVN   D +C+ W++ GEC+ N K+M  NC +SC+ C      +N     E   W +         Y   N          + TD G  +      E E++ K       N   ++IN      S    T+    C NI  +ED C KW+ +GECS N  +M +NC +SC  C  N     C N+ PN DC+ W   GEC  N K+M+  C +SC  CN     DC +++ +  C  W D GEC  N ++M + C ++C +C+M+        C NI  + +C  W    EC KN  +M  NC  +C  C  +        C + ++   C +W  +G C      M+  C   C  C   L  N+T+     N ++
Sbjct:    3 AWSSKTCLTFRAARSSDVNKIKFKNGYGCNSMVGM-VGGTQIISLAAAGCRND-----------GMYLHELGHAIGLVHEHQLPERDEYIHINVDNVQPHMQDWYEKYSSEDVNNYGVPYEYSSVMHYGLNDFARDQHKQTIFVQDRTREHEVGEVWKKGLSFTDIKVVNLMYKCNKNCAPNQRCKEPGYLDRWCRCVCPPE---------------VDCTKEGHG------------------LRVGGGWGIG-SDCRNSWKDEDCIAWAKRGECQGNPIWMKTNCRKACEKCAKN---------CSNVWPDEDCSKWAARGECSKNKQWMVKHCRESCGGCGTGFNLTSLTNWTLVEILNGTDDETNVTAGLDLLDDNASNNTDLDRGPSTLVTSHTITDSTSTSTAGCSNIWPDRDCKRWAEKGECILNKKWMEK----------------NCSRSCHVC-----HTECSNIWLESDCTKWAARGECNLNKNWMEKNCKESCKVCQRD-------CTNVYSNTDCDKWAISGECSANKNWMETNCRQSCEVCLSD-----CQNIWPDTDCKKWADKGECSANSKWMEKYCRRSCDACN------KNCSNKWSDTECYDWADRGECERNEHWMKENCFKSCGGCA------AGCTNVWPDFNCNKWADRGECTHNKEWMDRNCKESCGTCK------TGCVNIWPDKDCDKWTENGECKANAKWMKKNCKQSCRFCKLVNGTVN-----ETKSWYNNDTLDSIDVYDESN-----LFAVDNITDLGNDNVKEYSGEEEDFVKEDSSGLSNLSTLMINLTTG--SPTPITRKMKKCGNIWPDED-CSKWALRGECSLNKKWMEKNCKESCQKCSQN-----CTNIWPNKDCDKWASRGECEINTKWMERNCIRSCDACNQ----DCSNVWPDTDCIRWADRGECSTNQLWMETNCMRSCAACNMD--------CFNIWPDADCKKWSEQNECSKNQKWMQTNCRLSCDACNLN--------CSNRWNSSQCTQWAEQGECSSNKNWMEQNCKVACKVCQPNLGLNETITYGLMNTSV 936          

HSP 2 Score: 302.753 bits (774), Expect = 1.071e-80
Identity = 232/766 (30.29%), Postives = 357/766 (46.61%), Query Frame = -1
Query: 1498 YEENSCLSWADANECTKNPNFMHKMCKKSCKLCITKEPEKCTNQYDNLSCYVWSQTGECESNRKYMEXXXXXXXXXXXXXKMQTTTTPSLSVITMPSNETLCQNKYGDKYCEEFKSKGECTKNPDFMFIQCAKSCSKCKETKPGNDSLCKNIEKDNNCEQLKIRGECLRNVSYMRVNCAKTCFNCNASVVDKPCVNSYMDSECDKWSKLGECQKNPNYMLLNCAKSCNNCDLIPSDGKDCFNIYRNDKCEKWSNAGECSKNPKFMLENCAKSCNNCKTSQQNDSNCVNINKNSECDKWSQMGECSKNPNYMLVNCAKSCNYCKFNKDLQKNCVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSCDSERECLNTHNDAECSKWSSMGECTKNPKYMLVNCAXXXXXXXXXNTDKGTCSNINSDKECENWSKRGECAKNPKYMLINCAKSCNSCESATQLPTACTNIHKNE--DECRKWSE-----------------KGECSKNPNFMLENCAKSCNVCKF------------NNETKGCRNLDPNSDCESWKQAGECLNNEKYMKVQCGKSCGRCNAKTYVDCKDIYQEDSCKAWKDLGECFKNPVFMLSKCSQTCGSCDMEKNPVVVETCKNIDSNENCNTWQTAGECEKNPNYMLVNCAKACKTCQKDDAKNVEKKCDDVYSDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTCDQLKNNQTMCQNAYNDAICTKWKNMGECTKNPNFMLIQCKESCGKCE 3702
            +++  C++WA   EC  NP +M   C+K+C+ C     + C+N + +  C  W+  GEC  N+++M K+C++SC  CG     T+ T    V  +   +       G    ++  S            +           +  G    C NI  D +C++   +GEC+ N  +M  NC+++C  C+       C N +++S+C KW+  GEC  N N+M  NC +SC  C       +DC N+Y N  C+KW+ +GECS N  +M  NC +SC  C       S+C NI  +++C KW+  GECS N  +M   C +SC+ C       KNC N   D+EC  W+ RGEC++N  +M  NC KSC  C +   C N   D  C+KW+  GECT N ++M  NC       +S  T K  C NI  DK+C+ W++ GEC  N K+M  NC +SC  C+          + + N+  D    + E                 K    +  +F+ E+ +   N+                 + K C N+ P+ DC  W   GEC  N+K+M+  C +SC +C+     +C +I+    C  W   GEC  N  +M   C ++C +C+ +        C N+  + +C  W   GEC  N  +M  NC ++C  C  D        C +++ D  C KW  +  C K    M+  C  +C  C+        C N +N + CT+W   GEC+ N N+M   CK +C  C+
Sbjct:  218 WKDEDCIAWAKRGECQGNPIWMKTNCRKACEKC----AKNCSNVWPDEDCSKWAARGECSKNKQWMVKHCRESCGGCGTGFNLTSLTNWTLVEILNGTDDETNVTAGLDLLDDNASNNTDLDRGPSTLVTSHTITDSTSTSTAG----CSNIWPDRDCKRWAEKGECILNKKWMEKNCSRSCHVCHTE-----CSNIWLESDCTKWAARGECNLNKNWMEKNCKESCKVCQ------RDCTNVYSNTDCDKWAISGECSANKNWMETNCRQSCEVCL------SDCQNIWPDTDCKKWADKGECSANSKWMEKYCRRSCDAC------NKNCSNKWSDTECYDWADRGECERNEHWMKENCFKSCGGCAA--GCTNVWPDFNCNKWADRGECTHNKEWMDRNC------KESCGTCKTGCVNIWPDKDCDKWTENGECKANAKWMKKNCKQSCRFCKLVNGTVNETKSWYNNDTLDSIDVYDESNLFAVDNITDLGNDNVKEYSGEEEDFVKEDSSGLSNLSTLMINLTTGSPTPITRKMKKCGNIWPDEDCSKWALRGECSLNKKWMEKNCKESCQKCSQ----NCTNIWPNKDCDKWASRGECEINTKWMERNCIRSCDACNQD--------CSNVWPDTDCIRWADRGECSTNQLWMETNCMRSCAACNMD--------CFNIWPDADCKKWSEQNECSKNQKWMQTNCRLSCDACN------LNCSNRWNSSQCTQWAEQGECSSNKNWMEQNCKVACKVCQ 918          

HSP 3 Score: 269.24 bits (687), Expect = 8.381e-70
Identity = 227/775 (29.29%), Postives = 342/775 (44.13%), Query Frame = -1
Query:   13 CRNLDPNSDCESWKQAGECLNNEKYMKVQCGKSCGRCNAKTYVDCKDIYQEDSCKAWKDLGECFKNPVFMLSKCSQTCGSCDME------KNPVVVETCKNIDSNENCNTWQTAG------------ECEKNPNYMLVNCAKACKTCQKDDAKNVEKKCDDVYSDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTCDQLKNNQTMCQNAYNDAICTKWKNMGECTKNPNFMLIQCKESCGKCEKLPKNTNCINLDNDKNCEKWAGENECTKNSKYMLERCFKXXXXXXXXXSAKTPSEVCSNLANDTDCESWSKAGHCEKNVSYMLKFCAKSCKACNRLITTSLPSINCVNKLNDSTCETLKILGQCEKNSIFMIEKCGKSCGSCRPAKEKTFENKTCLNLYKDDTCDLWKKAGYCHIYPKFMLSHCLKSCGQCSEYSECKNLYNNIVCDKWAAEGECLKNSKFMIQLCLKSCGRCYDLKNLKVNRT----NSDGCE-------------NKYGDWSCEAWKQVGECERNPIFMNDQCSKSCGTCFKSTATSTSGPL-RMSSVCKNFYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSCQNLKFSLKVKCQNILTKEKCLKLKKAGECEKNSKQMAELCAYTCHKCN------------LSFVKPMEINQNPTKMRSS--------KFKCDNRAGDFQCSYWARQKQCELNASYMRLFCQKSCGACLMEKPGQVSCVDKFATMKCFSWSMRGECDRNGKWMTENCAKSCLVCQNN 2169
            CRN   + DC +W + GEC  N  +MK  C K+C +C AK   +C +++ ++ C  W   GEC KN  +M+  C ++CG C          N  +VE     D   N     TAG            + ++ P+ ++            D        C +++ D  C +W  +G C      M+  CS++C  C       T C N + ++ CTKW   GEC  N N+M   CKESC  C++     +C N+ ++ +C+KWA   EC+ N  +M   C +SC  C S          C N+  DTDC+ W+  G C  N  +M K+C +SC ACN+         NC NK +D+ C      G+CE+N  +M E C KSCG C            C N++ D  C+ W   G C    ++M  +C +SCG C   + C N++ +  CDKW   GEC  N+K+M + C +SC  C  L N  VN T    N+D  +             +   D   +  K+    E + +  +     +  T   +  T +  P+ R    C N + ++ C +W   G+C  N  +M  NC  SC  C          C NI   + C K    GECE N+K M   C  +C  CN            + +    E + N   M ++           C N   D  C  W+ Q +C  N  +M+  C+ SC AC       ++C +++ + +C  W+ +GEC  N  WM +NC  +C VCQ N
Sbjct:  214 CRNSWKDEDCIAWAKRGECQGNPIWMKTNCRKACEKC-AK---NCSNVWPDEDCSKWAARGECSKNKQWMVKHCRESCGGCGTGFNLTSLTNWTLVEILNGTDDETNV----TAGLDLLDDNASNNTDLDRGPSTLVT------SHTITDSTSTSTAGCSNIWPDRDCKRWAEKGECILNKKWMEKNCSRSCHVC------HTECSNIWLESDCTKWAARGECNLNKNWMEKNCKESCKVCQR-----DCTNVYSNTDCDKWAISGECSANKNWMETNCRQSCEVCLSD---------CQNIWPDTDCKKWADKGECSANSKWMEKYCRRSCDACNK---------NCSNKWSDTECYDWADRGECERNEHWMKENCFKSCGGCAAG---------CTNVWPDFNCNKWADRGECTHNKEWMDRNCKESCGTCK--TGCVNIWPDKDCDKWTENGECKANAKWMKKNCKQSCRFC-KLVNGTVNETKSWYNNDTLDSIDVYDESNLFAVDNITDLGNDNVKEYSGEEEDFVKEDSSGLSNLSTLMINLTTGSPTPITRKMKKCGNIWPDEDCSKWALRGECSLNKKWMEKNCKESCQKCSQ-------NCTNIWPNKDCDKWASRGECEINTKWMERNCIRSCDACNQDCSNVWPDTDCIRWADRGECSTNQLWMETNCMRSCAACNMDCFNIWPDADCKKWSEQNECSKNQKWMQTNCRLSCDAC------NLNCSNRWNSSQCTQWAEQGECSSNKNWMEQNCKVACKVCQPN 920          

HSP 4 Score: 219.164 bits (557), Expect = 6.666e-54
Identity = 152/461 (32.97%), Postives = 223/461 (48.37%), Query Frame = -1
Query: 1387 LQKNCVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSCDSERECLNTHNDAECSKWSSMGECTKNPKYMLVNC----------------AXXXXXXXXXNTDKGTCSNINSDKECENWSKRGECAKNPKYMLINCAKSCNSCESATQLPTACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVCKFNNETKGCRNLDPNSDCESWKQAGECLNNEKYMKVQCGKSCGRCNAKTYVDCKDIYQEDSCKAWKDLGECFKNPVFMLSKCSQTCGSCDMEKNPVVVETCKNIDSNENCNTWQTAGECEKNPNYMLVNCAKACKTCQKDDAKNVEKKCDDVYSDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTCDQLKNNQTMCQNAYNDAICTKWKNMGECTKNPNFMLIQCKESCGKCEKLPKNTNCINLDNDKNCEKWAGENECTKNSKYMLERC 2721
            +  +C N+ KD +C +W+KRGECQ NP +M  NC K+C+ C   + C N   D +CSKW++ GEC+KN ++M+ +C                         + TD  T      D   +N S   +  + P  ++ +   +    +S +     C+NI  + D C++W+EKGEC  N  +M +NC++SC+VC        C N+   SDC  W   GEC  N+ +M+  C +SC  C      DC ++Y    C  W   GEC  N  +M + C Q+C  C        +  C+NI  + +C  W   GEC  N  +M   C ++C  C K+        C + +SD  C  W   G CE+    MK  C K+CG C         C N + D  C KW + GECT N  +M   CKESCG C+     T C+N+  DK+C+KW    EC  N+K+M + C
Sbjct:  210 IGSDCRNSWKDEDCIAWAKRGECQGNPIWMKTNCRKACEKC--AKNCSNVWPDEDCSKWAARGECSKNKQWMVKHCRESCGGCGTGFNLTSLTNWTLVEILNGTDDETNVTAGLDLLDDNASNNTDLDRGPSTLVTSHTIT----DSTSTSTAGCSNIWPDRD-CKRWAEKGECILNKKWMEKNCSRSCHVCHTE-----CSNIWLESDCTKWAARGECNLNKNWMEKNCKESCKVCQR----DCTNVYSNTDCDKWAISGECSANKNWMETNCRQSCEVC--------LSDCQNIWPDTDCKKWADKGECSANSKWMEKYCRRSCDACNKN--------CSNKWSDTECYDWADRGECERNEHWMKENCFKSCGGC------AAGCTNVWPDFNCNKWADRGECTHNKEWMDRNCKESCGTCK-----TGCVNIWPDKDCDKWTENGECKANAKWMKKNC 627          

HSP 5 Score: 178.333 bits (451), Expect = 3.985e-41
Identity = 144/494 (29.15%), Postives = 208/494 (42.11%), Query Frame = -1
Query:   19 TNCINLDNDKNCEKWAGENECTKNSKYMLERCFKXXXXXXXXXSAKTPSEVCSNLANDTDCESWSKAGHCEKNVSYMLKFCAKSCKACNRLIT-TSLPSINCVNKLNDSTCET-----LKILGQCEKNSIFMIEKCGKSCGSCRPAKEKTFENKTCLNLYKDDTCDLWKKAGYCHIYPKFMLSHCLKSCGQCSEYSECKNLYNNIVCDKWAAEGECLKNSKFMIQLCLKSCGRCYDLKNLKVNRTNSDGCENKYGDWSCEAWKQVGECERNPIFMNDQCSKSCGTCFKSTATSTSGPLRMSSVCKNFYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSCQNLKFSLKVKCQNILTKEKCLKLKKAGECEKNSKQMAELCAYTCHKCNLSFVKPMEINQNPTKMRSSKFKCDNRAGDFQCSYWARQKQCELNASYMRLFCQKSCGACLMEKPGQVSCVDKFATMKCFSWSMRGECDRNGKWMTENCAKSCLVCQ 1482
            ++C N   D++C  WA   EC  N  +M   C K         + +  ++ CSN+  D DC  W+  G C KN  +M+K C +SC  C      TSL +   V  LN +  ET     L +L     N+  +         S       +     C N++ D  C  W + G C +  K+M  +C +SC  C  ++EC N++    C KWAA GEC  N  +M + C +SC  C               C N Y +  C+ W   GEC  N  +M   C +SC  C               S C+N + +  C +W   G+C +NS +M   C RSC++C          C N  +  +C      GECE+N   M E C  +C  C                       C N   DF C+ WA + +C  N  +M   C++SCG C      +  CV+ +    C  W+  GEC  N KWM +NC +SC  C+
Sbjct:  212 SDCRNSWKDEDCIAWAKRGECQGNPIWMKTNCRK---------ACEKCAKNCSNVWPDEDCSKWAARGECSKNKQWMVKHCRESCGGCGTGFNLTSLTNWTLVEILNGTDDETNVTAGLDLLDDNASNNTDLDRGPSTLVTSHTITDSTSTSTAGCSNIWPDRDCKRWAEKGECILNKKWMEKNCSRSCHVC--HTECSNIWLESDCTKWAARGECNLNKNWMEKNCKESCKVC------------QRDCTNVYSNTDCDKWAISGECSANKNWMETNCRQSCEVCL--------------SDCQNIWPDTDCKKWADKGECSANSKWMEKYCRRSCDACNK-------NCSNKWSDTECYDWADRGECERNEHWMKENCFKSCGGCAAG--------------------CTNVWPDFNCNKWADRGECTHNKEWMDRNCKESCGTC------KTGCVNIWPDKDCDKWTENGECKANAKWMKKNCKQSCRFCK 635          

HSP 6 Score: 117.857 bits (294), Expect = 1.443e-22
Identity = 100/381 (26.25%), Postives = 149/381 (39.11%), Query Frame = -1
Query:   22 SHCLKSCGQCSEYSECKNLYNNIVCDKWAAEGECLKNSKFMIQLCLKSCGRCYDLKNLKVNRTNSDGCENKYGDWSCEAWKQVGECERNPIFMNDQCSKSCGTC---FKSTATST----------------------------------SGPLRM-------------SSVCKNFYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSCQNLKFSLKVKCQNILTKEKCLKLKKAGECEKNSKQMAELCAYTCHKCNLS------------FVKPMEINQNPTKMRSS--------KFKCDNRAGDFQCSYWARQKQCELNASYMRLFCQKSCGACLMEKPGQVSCVDKFATMKCFSWSMRGECDRNGKWMTENCAKSCLVC 954
             H L+  G     S+C+N + +  C  WA  GEC  N  +M   C K+C +C            +  C N + D  C  W   GEC +N  +M   C +SCG C   F  T+ +                                    GP  +             ++ C N + ++ C  W + G+C  N  +M  NC+RSC+ C         +C NI  +  C K    GEC  N   M + C  +C  C               +    E + N   M ++           C N   D  C  WA + +C  N+ +M  +C++SC AC        +C +K++  +C+ W+ RGEC+RN  WM ENC KSC  C
Sbjct:  199 GHGLRVGGGWGIGSDCRNSWKDEDCIAWAKRGECQGNPIWMKTNCRKACEKC------------AKNCSNVWPDEDCSKWAARGECSKNKQWMVKHCRESCGGCGTGFNLTSLTNWTLVEILNGTDDETNVTAGLDLLDDNASNNTDLDRGPSTLVTSHTITDSTSTSTAGCSNIWPDRDCKRWAEKGECILNKKWMEKNCSRSCHVCH-------TECSNIWLESDCTKWAARGECNLNKNWMEKNCKESCKVCQRDCTNVYSNTDCDKWAISGECSANKNWMETNCRQSCEVCLSDCQNIWPDTDCKKWADKGECSANSKWMEKYCRRSCDAC------NKNCSNKWSDTECYDWADRGECERNEHWMKENCFKSCGGC 554          
BLAST of SMED30016458 vs. TrEMBL
Match: A0A1S3H8W2 (protein draper-like OS=Lingula unguis OX=7574 GN=LOC106153221 PE=4 SV=1)

HSP 1 Score: 356.681 bits (914), Expect = 2.397e-101
Identity = 270/834 (32.37%), Postives = 389/834 (46.64%), Query Frame = -1
Query:  925 EKDNNCEQLKIRGECLRNVSYMRVNCAKTCFNCNASVVDKPCVNSYM-DSECDKWSKLGECQKNPNYMLLNCAKSCNNCDLIPSDGKD----------CFNIYRND-KCEKWSNAGECSKNPKFMLENCAKSCNNCKTSQQN-----------DSNCVNINKNSECDKWSQMGECSKNPNYMLVNCAKSCNYCKFNKDLQKNCVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSCDSERECLNTH-NDAECSKWSSMGECTKNPKYMLVNCAXXXXXXXXXNTDK---GTCSNINS-DKECENWSKRGECAKNPKYMLINCAKSCNSCESATQLPTA--CTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVC----KFNNETKGCRNLDPN-SDCESWKQAGECLNNEKYMKVQCGKSCGRC----------NAKTYVDCKDIYQEDS-CKAWKDLGECFKNPVFMLSKCSQTCGSCDMEKNPVVVET-------CKNIDSNENCNTWQTAGECEKNPNYMLVNCAKACKTCQK---DDAKNVEKKCDDV-YSDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTCDQLKNNQTMCQNAYNDAICTKWKNMGECTKNPNFMLIQCKESCGKCEKLPKNTNCINLDNDKNCEKWAGENECTKNSKYMLERCFKXXXXXXXXXSAKTPSEVCSNLANDTDCESWSKAGHCEKNVSYMLKFCAKSCKACNRLITTSLPSIN---CVNKLNDSTCETLKILGQCEKNSIFMIEKCGKSCGSCRPAKEKTFENKTCLNLYKDDTCDLWKKAGYCHIYPKFMLSHCLKSCGQC 3246
            + D  C+Q    GEC  N+ +M  NCAK C  C ++     C+N Y  D++C  W+  GEC+ NP +M+ NC K+C  C                   C +I+ +   C +W++ GEC  NP +M+ NC KSC  C T               +  C +    ++C  W   G C  +P +M+  C K+C+ C  +K+  KN V   +D +C+ W+ RGEC+ N +YM  NC K+CK C +   C+N H N+AEC +W++ GEC+ NP +M+ NC KSC  C +S  D    GTC NI+S D ECE W KRGEC+KNP +M+ NC K+CN C   T  P    C NI+ N+ +C  W++ GECS NP +M ENCAKSC  C      NN    C N   N + C  W + GEC  N  +M + C K+C +C                +CK++Y++D+ C+ W D GEC  NP +M   C + CG C    N     T       C N   +  C  W    +C  NP++ML  C KAC++C +   +        C +  + D SC  W   G C      M   C K CG C     +       Y+DA C  W   G+C  NP++ML  CK++C KC+K+   T+      D N +                E         + +     P + C N   DT+C   ++ G C  +  +M + C ++C  C++   +     N   C++ + +  C  L     C  N   M   C K+CG C P          C N ++   C  W + G C   P  M   C   CG C
Sbjct:    7 DDDLKCQQWAKDGECFVNIKWMATNCAKACGKCKSN----KCLNLYGKDAKCQAWADEGECRANPTWMIPNCRKACGKCGDGTGGNGGGGTETGSGGKCRDIHTDPLACMRWASEGECEANPLWMIPNCRKSCEKCDTDGGTDGGTDGGTDTGNKACADKLDTNKCQGWKDGGSCENDPAFMIQYCQKTCDKCGVDKEGCKNLV---EDKDCQEWAGRGECEANSEYMTANCRKACKKCITG-SCVNKHGNEAECGRWAAEGECSVNPLWMIENCKKSCGKCDTSTGDGGTDGTCKNIHSNDAECEAWEKRGECSKNPLWMVPNCRKACNRCGDGTDTPDTGNCRNIYGNDVQCDSWAKVGECSANPVWMGENCAKSCKTCDGNNNNNNNGGSCTNSYGNDAQCSDWAKRGECTANPVWMTMNCEKACQKCGGSEDGGGDGGNTNGGECKNLYKDDAQCQDWADSGECAANPDWMPINCKKACGLCGDGDNTGDGNTGNGGNVNCVNSYGDAQCELWARDNQCAVNPSFMLEQCKKACRSCDRGSDNGGTTANSNCVNTHHDDESCRIWAEHGHCSSNPDWMTKNCQKACGLCGGRDGSGDCRNKHYDDAQCEDWAKYGQCQTNPDWMLPNCKKACTKCDKIATGTS----QEDNNVDD--------------REIITLPTTTTTQNPPPPPPDDACVNAHGDTECAQMARDGKCISDSRWMRRHCRRACTECDKGSNSGTVDNNRPQCIDVVGN--CAELAQNNGCSNNLQHMYNNCKKTCGLCEPG--------ACTNKHR--QCKRWARHGGCERNPGVMYRQCPVECGLC 802          

HSP 2 Score: 328.946 bits (842), Expect = 9.230e-92
Identity = 267/838 (31.86%), Postives = 385/838 (45.94%), Query Frame = -1
Query: 1915 NDESWCIEQQKKGHCELRNKYMSFNCRKTCEKCFKHRNRFVIPIKECKNL-EKNETCDAWEKRGECKKNPRYMKFNCKQSCGLC-------DKSTTTLAPKIECKNIYGDD-KCNLWEAVGDCQNNKLFMELNCAKACGKCGTXXXXXXXXXXXXXX-----XDVYEENSCLSWADANECTKNPNFMHKMCKKSCKLCITKEPEKCTNQYDNLSCYVWSQTGECESNRKYMEXXXXXXXXXXXXXKMQTTTTPSLSVITMPSNETLCQNKYGDKY-CEEFKSKGECTKNPDFMFIQCAKSCSKCKET--KPGNDSLCKNIEK-DNNCEQLKIRGECLRNVSYMRVNCAKTCFNCNASVVDKP----CVNSYM-DSECDKWSKLGECQKNPNYMLLNCAKSCNNCD---LIPSDGKDCFNIYRND-KCEKWSNAGECSKNPKFMLENCAKSCNNC--------KTSQQNDSNCVNINK-NSECDKWSQMGECSKNPNYMLVNCAKSCNYCKFNKDLQK---------NCVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSCDSERE---------CLNTHNDAE-CSKWSSMGECTKNPKYMLVNCAXXXXXXXXXNTDKGTCSNIN-SDKECENWSKRGECAKNPKYMLINCAKSCNSCESATQLPT------------------------------ACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVCKFNNETKGCRN-----LDPNSDCESWKQAGECLNNEKYMKVQCGKSCGRCNAKTYVDCKDIYQEDSCKAWKDLGECFKNPVFMLSKCSQTCGSCDMEK 4155
            +D+  C +  K G C +  K+M+ NC K C KC  ++         C NL  K+  C AW   GEC+ NP +M  NC+++CG C           T      +C++I+ D   C  W + G+C+ N L+M  NC K+C KC TD       D   D       D  + N C  W D   C  +P FM + C+K+C  C   + E C N  ++  C  W+  GECE+N +YM                    T +            C NK+G++  C  + ++GEC+ NP +M   C KSC KC  +    G D  CKNI   D  CE  + RGEC +N  +M  NC K C  C     D P    C N Y  D +CD W+K+GEC  NP +M  NCAKSC  CD      ++G  C N Y ND +C  W+  GEC+ NP +M  NC K+C  C             N   C N+ K +++C  W+  GEC+ NP++M +NC K+C  C    +            NCVN++ D++CE W++  +C  NP +ML  C K+C+SCD   +         C+NTH+D E C  W+  G C+ NP +M  NC +            G C N +  D +CE+W+K G+C  NP +ML NC K+C  C+      +                              AC N H  + EC + +  G+C  +  +M  +C ++C  C   + +    N     +D   +C    Q   C NN ++M   C K+CG C       C + +++  CK W   G C +NP  M  +C   CG C+  K
Sbjct:    7 DDDLKCQQWAKDGECFVNIKWMATNCAKACGKCKSNK---------CLNLYGKDAKCQAWADEGECRANPTWMIPNCRKACGKCGDGTGGNGGGGTETGSGGKCRDIHTDPLACMRWASEGECEANPLWMIPNCRKSCEKCDTDGGTDGGTDGGTDTGNKACADKLDTNKCQGWKDGGSCENDPAFMIQYCQKTCDKCGV-DKEGCKNLVEDKDCQEWAGRGECEANSEYM--------------------TANCRKACKKCITGSCVNKHGNEAECGRWAAEGECSVNPLWMIENCKKSCGKCDTSTGDGGTDGTCKNIHSNDAECEAWEKRGECSKNPLWMVPNCRKACNRC-GDGTDTPDTGNCRNIYGNDVQCDSWAKVGECSANPVWMGENCAKSCKTCDGNNNNNNNGGSCTNSYGNDAQCSDWAKRGECTANPVWMTMNCEKACQKCGGSEDGGGDGGNTNGGECKNLYKDDAQCQDWADSGECAANPDWMPINCKKACGLCGDGDNTGDGNTGNGGNVNCVNSYGDAQCELWARDNQCAVNPSFMLEQCKKACRSCDRGSDNGGTTANSNCVNTHHDDESCRIWAEHGHCSSNPDWMTKNC-QKACGLCGGRDGSGDCRNKHYDDAQCEDWAKYGQCQTNPDWMLPNCKKACTKCDKIATGTSQEDNNVDDREIITLPTTTTTQNPPPPPPDDACVNAH-GDTECAQMARDGKCISDSRWMRRHCRRACTECDKGSNSGTVDNNRPQCIDVVGNCAELAQNNGCSNNLQHMYNNCKKTCGLCEPGA---CTNKHRQ--CKRWARHGGCERNPGVMYRQCPVECGLCEHTK 806          

HSP 3 Score: 318.931 bits (816), Expect = 2.690e-88
Identity = 256/837 (30.59%), Postives = 378/837 (45.16%), Query Frame = -1
Query:  454 CVNTHKDS-ECESWSKRGECQKNPKYMLVNCAKSCKSCDSERECLNTHN-DAECSKWSSMGECTKNPKYMLVNCAXX----------XXXXXXXNTDKGTCSNINSDK-ECENWSKRGECAKNPKYMLINCAKSCNSCESATQLPT-----------ACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVCKFNNETKGCRNLDPNSDCESWKQAGECLNNEKYMKVQCGKSCGRCNAKTYVDCKDIYQEDSCKAWKDLGECFKNPVFMLSKCSQTCGSCDMEKNPVVVE-TCKNIDSNE-NCNTWQTAGECEKNPNYMLVNCAKACKTCQKDDAKNVEKKCDDVYS-DVSCLKWKAEGLCEKQSLVMKVKCSKTCGTCDQLKNNQTM---CQNAY-NDAICTKWKNMGECTKNPNFMLIQCKESCGKC---------EKLPKNTNCINL-DNDKNCEKWAGENECTKNSKYMLERCFKXXXXXXXXXSAKTPSEV------CSNLANDTDCESWSKAGHCEKNVSYMLKFCAKSCKACNRLI--TTSLPSINCVN-KLNDSTCETLKILGQCEKNSIFMIEKCGKSCGSCRPAKEKTFENKTCLNLYKDDT-CDLWKKAGYCHIYPKFMLSHCLKSCGQCSEYS----------------------------------ECKNLYNNIVCDKWAAEGECLKNSKFMIQLCLKSCGRCYDLKNLKVNRTNSDGCENKYGDWSCEAWKQVGECERNPIFMNDQCSKSCGTCFKSTATSTSGPLRMSSVCKNFYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSCQNLKFSLKV 2709
            C NT+ D  +C+ W+K GEC  N K+M  NCAK+C  C S + CLN +  DA+C  W+  GEC  NP +M+ NC K+               +     G C +I++D   C  W+  GEC  NP +M+ NC KSC  C++                 AC +   + ++C+ W + G C  +P FM++ C K+C+ C  + E  GC+NL  + DC+ W   GEC  N +YM   C K+C +C   + V+      E  C  W   GEC  NP++M+  C ++CG CD        + TCKNI SN+  C  W+  GEC KNP +M+ NC KAC  C           C ++Y  DV C  W   G C    + M   C+K+C TCD   NN      C N+Y NDA C+ W   GECT NP +M + C+++C KC                 C NL  +D  C+ WA   EC  N  +M   C K+C  C    +    +        C N   D  CE W++   C  N S+ML+ C K+C++C+R      +  + NCVN   +D +C      G C  N  +M + C K+CG C   ++ + +   C N + DD  C+ W K G C   P +ML +C K+C +C + +                                   C N + +  C + A +G+C+ +S++M + C ++C  C    N      N   C +  G+  C    Q   C  N   M + C K+CG C     T+                ++ C  W ++G C+ N   M   C   C  C++ K    +
Sbjct:    2 CENTYDDDLKCQQWAKDGECFVNIKWMATNCAKACGKCKSNK-CLNLYGKDAKCQAWADEGECRANPTWMIPNCRKACGKCGDGTGGNGGGGTETGSGGKCRDIHTDPLACMRWASEGECEANPLWMIPNCRKSCEKCDTDGGTDGGTDGGTDTGNKACAD-KLDTNKCQGWKDGGSCENDPAFMIQYCQKTCDKCGVDKE--GCKNLVEDKDCQEWAGRGECEANSEYMTANCRKACKKCITGSCVN--KHGNEAECGRWAAEGECSVNPLWMIENCKKSCGKCDTSTGDGGTDGTCKNIHSNDAECEAWEKRGECSKNPLWMVPNCRKACNRCGDGTDTPDTGNCRNIYGNDVQCDSWAKVGECSANPVWMGENCAKSCKTCDGNNNNNNNGGSCTNSYGNDAQCSDWAKRGECTANPVWMTMNCEKACQKCGGSEDGGGDGGNTNGGECKNLYKDDAQCQDWADSGECAANPDWMPINCKKACGLCGDGDNTGDGNTGNGGNVNCVNSYGDAQCELWARDNQCAVNPSFMLEQCKKACRSCDRGSDNGGTTANSNCVNTHHDDESCRIWAEHGHCSSNPDWMTKNCQKACGLC-GGRDGSGD---CRNKHYDDAQCEDWAKYGQCQTNPDWMLPNCKKACTKCDKIATGTSQEDNNVDDREIITLPTTTTTQNPPPPPPDDACVNAHGDTECAQMARDGKCISDSRWMRRHCRRACTECDKGSNSGTVDNNRPQCIDVVGN--CAELAQNNGCSNNLQHMYNNCKKTCGLCEPGACTN---------------KHRQCKRWARHGGCERNPGVMYRQCPVECGLCEHTKTDRAL 811          

HSP 4 Score: 315.464 bits (807), Expect = 3.805e-87
Identity = 265/846 (31.32%), Postives = 364/846 (43.03%), Query Frame = -1
Query:  148 NSDKECENWSKRGECAKNPKYMLINCAKSCNSCESATQLPTACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVCKFNNETKG-----------CRNL--DPNSDCESWKQAGECLNNEKYMKVQCGKSCGRCNAKTYVD-------------CKDIYQEDSCKAWKDLGECFKNPVFMLSKCSQTCGSCDMEKNPVVVETCKNIDSNENCNTWQTAGECEKNPNYMLVNCAKACKTCQKDDAKNVEKKCDDVYSDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTCDQLKNN---QTMCQNAY-NDAICTKWKNMGECTKNPNFMLIQCKESCGKC---EKLPKNTNCINL-DNDKNCEKWAGENECTKNSKYMLERCFKXXXXXXXXXSAKTPSEVCSN-LANDTDCESWSKAGHCEKNVSYMLKFCAKSCKAC-----NRLITTSLPSINCVNKL-NDSTCETLKILGQCEKNSIFMIEKCGKSCGSCRPAKEKTFENKT------CLNLYKDDTCDLWKKAGYCHIYPKFMLSHCLKSCGQCSEYSE---------CKNLYNNI-VCDKWAAEGECLKNSKFMIQLCLKSCGRCYDLKNLKVNRTNSDGCENK-YGDWSCEAWKQVGECERNPIFMNDQCSKSCGTCFKSTATSTS-----------------------GPLRMSSVCKNFYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSCQNLKFSLKV---KCQNILTKEKCLKLKKAGECEKNSKQMAELCAYTCHKCNLSFVKPMEINQNPTKMRSSKFKCDNRAGDFQCSYWARQKQCELNASYMRLFCQKSCGACLMEK 2433
            + D +C+ W+K GEC  N K+M  NCAK+C  C+S       C N++  + +C+ W+++GEC  NP +M+ NC K+C  C       G           CR++  DP + C  W   GEC  N  +M   C KSC +C+     D             C D    + C+ WKD G C  +P FM+  C +TC  C ++K     E CKN+  +++C  W   GECE N  YM  NC KACK C      N         ++  C +W AEG C    L M   C K+CG CD    +      C+N + NDA C  W+  GEC+KNP +M+  C+++C +C      P   NC N+  ND  C+ WA   EC+ N  +M E C KSC  C  +++       C+N   ND  C  W+K G C  N  +M   C K+C+ C           +     C N   +D+ C+     G+C  N  +M   C K+CG C         N        C+N Y D  C+LW +   C + P FML  C K+C  C   S+         C N +++   C  WA  G C  N  +M + C K+CG C         R  S  C NK Y D  CE W + G+C+ NP +M   C K+C  C K  AT TS                        P      C N + +  C +  ++G C S+S +MR +C R+C  C     S  V   + Q I     C +L +   C  N + M   C  TC  C        E      K R             QC  WAR   CE N   M   C   CG C   K
Sbjct:    7 DDDLKCQQWAKDGECFVNIKWMATNCAKACGKCKS-----NKCLNLYGKDAKCQAWADEGECRANPTWMIPNCRKACGKCGDGTGGNGGGGTETGSGGKCRDIHTDPLA-CMRWASEGECEANPLWMIPNCRKSCEKCDTDGGTDGGTDGGTDTGNKACADKLDTNKCQGWKDGGSCENDPAFMIQYCQKTCDKCGVDK-----EGCKNLVEDKDCQEWAGRGECEANSEYMTANCRKACKKCITGSCVNKHG------NEAECGRWAAEGECSVNPLWMIENCKKSCGKCDTSTGDGGTDGTCKNIHSNDAECEAWEKRGECSKNPLWMVPNCRKACNRCGDGTDTPDTGNCRNIYGNDVQCDSWAKVGECSANPVWMGENCAKSCKTCDGNNNNNNNGGSCTNSYGNDAQCSDWAKRGECTANPVWMTMNCEKACQKCGGSEDGGGDGGNTNGGECKNLYKDDAQCQDWADSGECAANPDWMPINCKKACGLCGDGDNTGDGNTGNGGNVNCVNSYGDAQCELWARDNQCAVNPSFMLEQCKKACRSCDRGSDNGGTTANSNCVNTHHDDESCRIWAEHGHCSSNPDWMTKNCQKACGLCG-------GRDGSGDCRNKHYDDAQCEDWAKYGQCQTNPDWMLPNCKKACTKCDK-IATGTSQEDNNVDDREIITLPTTTTTQNPPPPPPDDACVNAHGDTECAQMARDGKCISDSRWMRRHCRRACTECDKGSNSGTVDNNRPQCIDVVGNCAELAQNNGCSNNLQHMYNNCKKTCGLC--------EPGACTNKHR-------------QCKRWARHGGCERNPGVMYRQCPVECGLCEHTK 806          

HSP 5 Score: 308.916 bits (790), Expect = 6.766e-85
Identity = 259/858 (30.19%), Postives = 377/858 (43.94%), Query Frame = -1
Query: 1612 CDAWEKRGECKKNPRYMKFNCKQSCGLCDKSTTTLAPKIECKNIYGDD-KCNLWEAVGDCQNNKLFMELNCAKACGKCGTXXXXXXXXXXXXX-----XXDVYEENSCLSWADANECTKNPNFMHKMCKKSCKLCITKEP-------------EKCTNQYDNLSCYVWSQTGECESNRKYMEXXXXXXXXXXXXXKMQTTTTPSLSVITMPSNETLCQNKYGDKYCEEFKSKGECTKNPDFMFIQCAKSCSKCKE----TKPGNDSLCKNIEKDNNCEQLKIRGECLRNVSYMRVNCAKTCFNCNASV----VDKPCVNSYM-DSECDKWSKLGECQKNPNYMLLNCAKSCNNC--DLIPSDGKDCFNIYRND-KCEKWSNAGECSKNPKFMLENCAKSCNNC---KTSQQNDSNCVNINKN-SECDKWSQMGECSKNPNYMLVNCAKSCNYC--------KFNKDLQKNCVNTHK-DSECESWSKRGECQKNPKYMLVNCAKSCKSCDSERE-------------CLNTHNDAECSKWSSMGECTKNPKYMLVNCAXXXXXXXXXNTDKGTCSNIN------SDKECENWSKRGECAKNPKYMLINCAKSCNSCESATQLPTACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVCKFNNETKGCRNLDPNSDCESWKQAGECLNNEKYMKVQCGKSCGRCNAKTYVDCKDIYQEDSCKAWKDLGECFKNPVFMLSKCSQTCGSCDMEKNPVVVETCKN--IDSNENCNTWQTAGECEKNPNYMLVNCAKACKTCQKDDAKNVEKKCDDVYSDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTCDQLKNNQTM 3990
            C  W K GEC  N ++M  NC ++CG C  +        +C N+YG D KC  W   G+C+ N  +M  NC KACGKCG  + G      +            +  +C+ WA   EC  NP +M   C+KSC+ C T                + C ++ D   C  W   G CE++  +M              +    T     V     ++  C+N   DK C+E+  +GEC  N ++M   C K+C KC       K GN++          C +    GEC  N  +M  NC K+C  C+ S      D  C N +  D+EC+ W K GEC KNP +M+ NC K+CN C       D  +C NIY ND +C+ W+  GECS NP +M ENCAKSC  C     +  N  +C N   N ++C  W++ GEC+ NP +M +NC K+C  C                 C N +K D++C+ W+  GEC  NP +M +NC K+C  C                  C+N++ DA+C  W+   +C  NP +ML  C K+C SC   + + GT +N N       D+ C  W++ G C+ NP +M  NC K+C  C         C N H ++ +C  W++ G+C  NP++ML NC K+C  C  +    G    D N D           + E         +           C + + +  C      G+C  +  +M   C + C  CD   N   V+  +   ID   NC        C  N  +M  NC K C  C+     N  ++         C +W   G CE+   VM  +C   CG C+  K ++ +
Sbjct:   12 CQQWAKDGECFVNIKWMATNCAKACGKCKSN--------KCLNLYGKDAKCQAWADEGECRANPTWMIPNCRKACGKCGDGTGGNGGGGTETGSGGKCRDIHTDPLACMRWASEGECEANPLWMIPNCRKSCEKCDTDGGTDGGTDGGTDTGNKACADKLDTNKCQGWKDGGSCENDPAFM-------------IQYCQKTCDKCGV-----DKEGCKNLVEDKDCQEWAGRGECEANSEYMTANCRKACKKCITGSCVNKHGNEA---------ECGRWAAEGECSVNPLWMIENCKKSCGKCDTSTGDGGTDGTCKNIHSNDAECEAWEKRGECSKNPLWMVPNCRKACNRCGDGTDTPDTGNCRNIYGNDVQCDSWAKVGECSANPVWMGENCAKSCKTCDGNNNNNNNGGSCTNSYGNDAQCSDWAKRGECTANPVWMTMNCEKACQKCGGSEDGGGDGGNTNGGECKNLYKDDAQCQDWADSGECAANPDWMPINCKKACGLCGDGDNTGDGNTGNGGNVNCVNSYGDAQCELWARDNQCAVNPSFMLEQCKKACRSCDRGSDNGGTTANSNCVNTHHDDESCRIWAEHGHCSSNPDWMTKNCQKACGLC-GGRDGSGDCRNKHYDDAQCEDWAKYGQCQTNPDWMLPNCKKACTKC--DKIATGTSQEDNNVD-----------DREIITLPTTTTTQNPPPPPPDDACVNAHGDTECAQMARDGKCISDSRWMRRHCRRACTECDKGSNSGTVDNNRPQCIDVVGNCAELAQNNGCSNNLQHMYNNCKKTCGLCEPGACTNKHRQ---------CKRWARHGGCERNPGVMYRQCPVECGLCEHTKTDRAL 811          

HSP 6 Score: 301.212 bits (770), Expect = 3.080e-82
Identity = 242/844 (28.67%), Postives = 374/844 (44.31%), Query Frame = -1
Query:   16 ACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVCKFNNETKGCRNL-DPNSDCESWKQAGECLNNEKYMKVQCGKSCGRCNAKTYVD------------CKDIYQED-SCKAWKDLGECFKNPVFMLSKCSQTCGSCDMEKNPVVV---------ETCKNIDSNENCNTWQTAGECEKNPNYMLVNCAKACKTCQKDDAKNVEKKCDDVYSDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTCDQLKNNQTMCQNAY-NDAICTKWKNMGECTKNPNFMLIQCKESCGKCEKLPKNTN----CINL-DNDKNCEKWAGENECTKNSKYMLERCFKXXXXXXXXXSAKTPSEVCSNLANDTDCESWSKAGHCEKNVSYMLKFCAKSCKACNRLITTSLPSINCVNKL-NDSTCETLKILGQCEKNSIFMIEKCGKSCGSCRPAKEKTFENKT-----CLNLYKDDT-CDLWKKAGYCHIYPKFMLSHCLKSCGQCSEYSE-------------CKNLYNNIVCDKWAAEGECLKNSKFMIQLCLKSCGRCYDLKNLKVNRTNSDGCENKYGDWSCEAWKQVGECERNPIFMNDQCSKSCGTCFKSTATSTSGPLRMSSVCKN-FYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSCQNLKFSLKVKCQNILTKE-----------------------------KCLKLKKAGECEKNSKQMAELCAYTCHKCNLSFVKPMEINQNPTKMRSSKFKCDNRAGDFQCSYWARQKQCELNASYMRLFCQKSCGACLMEKPGQVSCVDKFATMKCFSWSMRGECDRNGKWMTENCAKSCLVCQN 2310
             C N + ++ +C++W++ GEC  N  +M  NCAK+C  CK N     C NL   ++ C++W   GEC  N  +M   C K+CG+C   T  +            C+DI+ +  +C  W   GEC  NP++M+  C ++C  CD +               + C +      C  W+  G CE +P +M+  C K C  C  D     ++ C ++  D  C +W   G CE  S  M   C K C  C         C N + N+A C +W   GEC+ NP +M+  CK+SCGKC+    +      C N+  ND  CE W    EC+KN  +M+  C K+CN C   +         +   ND  C+SW+K G C  N  +M + CAKSCK C+     +    +C N   ND+ C      G+C  N ++M   C K+C  C  +++   +        C NLYKDD  C  W  +G C   P +M  +C K+CG C +                C N Y +  C+ WA + +C  N  FM++ C K+C  C    +      NS+     + D SC  W + G C  NP +M   C K+CG C         G    S  C+N  Y +  C++W K G C++N D+M  NC ++C  C  +      +  N+  +E                             +C ++ + G+C  +S+ M   C   C +C+           N   + +++ +C +  G+  C+  A+   C  N  +M   C+K+CG C   +PG  +C +K    +C  W+  G C+RN   M   C   C +C++
Sbjct:    1 GCENTYDDDLKCQQWAKDGECFVNIKWMATNCAKACGKCKSNK----CLNLYGKDAKCQAWADEGECRANPTWMIPNCRKACGKCGDGTGGNGGGGTETGSGGKCRDIHTDPLACMRWASEGECEANPLWMIPNCRKSCEKCDTDGGTDGGTDGGTDTGNKACADKLDTNKCQGWKDGGSCENDPAFMIQYCQKTCDKCGVD-----KEGCKNLVEDKDCQEWAGRGECEANSEYMTANCRKACKKCIT-----GSCVNKHGNEAECGRWAAEGECSVNPLWMIENCKKSCGKCDTSTGDGGTDGTCKNIHSNDAECEAWEKRGECSKNPLWMVPNCRKACNRCGDGTDTPDTGNCRNIYGNDVQCDSWAKVGECSANPVWMGENCAKSCKTCDGNNNNNNNGGSCTNSYGNDAQCSDWAKRGECTANPVWMTMNCEKACQKCGGSEDGGGDGGNTNGGECKNLYKDDAQCQDWADSGECAANPDWMPINCKKACGLCGDGDNTGDGNTGNGGNVNCVNSYGDAQCELWARDNQCAVNPSFMLEQCKKACRSCDRGSDNGGTTANSNCVNTHHDDESCRIWAEHGHCSSNPDWMTKNCQKACGLC---------GGRDGSGDCRNKHYDDAQCEDWAKYGQCQTNPDWMLPNCKKACTKCDKIATGTSQEDNNVDDREIITLPTTTTTQNPPPPPPDDACVNAHGDTECAQMARDGKCISDSRWMRRHCRRACTECDKG--------SNSGTVDNNRPQCIDVVGN--CAELAQNNGCSNNLQHMYNNCKKTCGLC---EPG--ACTNKH--RQCKRWARHGGCERNPGVMYRQCPVECGLCEH 804          

HSP 7 Score: 247.284 bits (630), Expect = 2.987e-64
Identity = 207/684 (30.26%), Postives = 317/684 (46.35%), Query Frame = -1
Query: 2332 RRCQDKNDESWCIEQQKKGHCELRNKYMSFNCRKTCEKCFKHRNRFVIPIKECKNLEKNETCDAWEKRGECKKNPRYMKFNCKQSCGLCDKSTTTLAPKIECKNIYGDD-KCNLWEAVGDCQNNKLFMELNCAKACGKCGTXXXXXXXXXXXXXXXDVYEENSCLSWADANECTKNPNFMHKMCKKSCKLCI----TKEPEKCTNQYDN-LSCYVWSQTGECESNRKYMEXXXXXXXXXXXXXKMQTTTTPSLSVITMPSNETLCQNKYG-DKYCEEFKSKGECTKNPDFMFIQCAKSCSKC-------KETKPGNDSLCKNIEKDN-NCEQLKIRGECLRNVSYMRVNCAKTCFNCNASVVDKP----------CVNSYMDSECDKWSKLGECQKNPNYMLLNCAKSCNNCDLIPSDG-----KDCFNIYRNDK-CEKWSNAGECSKNPKFMLENCAKSCNNCKTSQQNDSNCVNIN-KNSECDKWSQMGECSKNPNYMLVNCAKSCNYC----------KFNKDLQK--------------------NCVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSCDSERECLNTHND--------AECSKWSSMGECTKNPKYMLVNCAXXXXXXXXXNTDKGTCSNINSDKECENWSKRGECAKNPKYMLINCAKSCNSCE 4173
            + C DK D + C   +  G CE    +M   C+KTC+KC        +  + CKNL +++ C  W  RGEC+ N  YM  NC+++C  C   +        C N +G++ +C  W A G+C  N L+M  NC K+CGKC T +          +      E  C +W    EC+KNP +M   C+K+C  C     T +   C N Y N + C  W++ GEC +N  +M +NC KSCK C G+        S            C N YG D  C ++  +GECT NP +M + C K+C KC        +    N   CKN+ KD+  C+     GEC  N  +M +NC K C  C                  CVNSY D++C+ W++  +C  NP++ML  C K+C +CD    +G      +C N + +D+ C  W+  G CS NP +M +NC K+C  C   +    +C N +  +++C+ W++ G+C  NP++ML NC K+C  C            N D ++                     CVN H D+EC   ++ G+C  + ++M  +C ++C  CD         N+          C++ +    C+ N ++M  NC            + G C+N +  ++C+ W++ G C +NP  M   C   C  CE
Sbjct:  157 KACADKLDTNKCQGWKDGGSCENDPAFMIQYCQKTCDKCG-------VDKEGCKNLVEDKDCQEWAGRGECEANSEYMTANCRKACKKCITGS--------CVNKHGNEAECGRWAAEGECSVNPLWMIENCKKSCGKCDTSTGDGGTDGTCKNIHSNDAE--CEAWEKRGECSKNPLWMVPNCRKACNRCGDGTDTPDTGNCRNIYGNDVQCDSWAKVGECSANPVWMGENCAKSCKTCDGNNNNNNNGGS------------CTNSYGNDAQCSDWAKRGECTANPVWMTMNCEKACQKCGGSEDGGGDGGNTNGGECKNLYKDDAQCQDWADSGECAANPDWMPINCKKACGLCGDGDNTGDGNTGNGGNVNCVNSYGDAQCELWARDNQCAVNPSFMLEQCKKACRSCDRGSDNGGTTANSNCVNTHHDDESCRIWAEHGHCSSNPDWMTKNCQKACGLC-GGRDGSGDCRNKHYDDAQCEDWAKYGQCQTNPDWMLPNCKKACTKCDKIATGTSQEDNNVDDREIITLPTTTTTQNPPPPPPDDACVNAHGDTECAQMARDGKCISDSRWMRRHCRRACTECDKGSNSGTVDNNRPQCIDVVGNCAELAQNNGCSNNLQHMYNNC-----KKTCGLCEPGACTNKH--RQCKRWARHGGCERNPGVMYRQCPVECGLCE 803          

HSP 8 Score: 233.802 bits (595), Expect = 9.512e-60
Identity = 197/639 (30.83%), Postives = 289/639 (45.23%), Query Frame = -1
Query: 2494 YIDQYCQCHTPE-SFESRRCQDKNDESWCIEQQKKGHCELRNKYMSFNCRKTCEKCFKHRNRFVIPIKECKNLEKNET-CDAWEKRGECKKNPRYMKFNCKQSCGLCDKSTTTLAPKIECKNIYGDD-KCNLWEAVGDCQNNKLFMELNCAKACGKCGTXXXXXXXXXXXXXXXDVYEEN-SCLSWADANECTKNPNFMHKMCKKSCKLC-----ITKEPEKCTNQYDN-LSCYVWSQTGECESNRKYMEXXXXXXXXXXXXXKMQTTTTPSLSVITMPSNETLCQNKY-GDKYCEEFKSKGECTKNPDFMFIQCAKSCSKCKETKPGNDSL--------CKNIEKDNNCEQLKIRGECLRNVSYMRVNCAKTCFNCN------ASVVDKPCVNSYMDSE-CDKWSKLGECQKNPNYMLLNCAKSCNNCDLIPSDGKDCFNIYRND-KCEKWSNAGECSKNPKFMLENCAKSCNNC-----KTSQQN-------------------------DSNCVNINKNSECDKWSQMGECSKNPNYMLVNCAKSCNYCKFNKDLQKNCVNTHKD------SECESWSKRGECQKNPKYMLVNCAKSCKSCDSERECLNTHNDAECSKWSSMGECTKNPKYMLVNC 4221
            ++ QYCQ    +   +   C++  ++  C E   +G CE  ++YM+ NCRK C+KC             C N   NE  C  W   GEC  NP +M  NCK+SCG CD ST        CKNI+ +D +C  WE  G+C  N L+M  NC KAC +CG       D     +C+++Y  +  C SWA   EC+ NP +M + C KSCK C            CTN Y N   C  W++ GEC +N  +M          C  +  +   +         +N   C+N Y  D  C+++   GEC  NPD+M I C K+C  C +     D          C N   D  CE      +C  N S+M   C K C +C+       +  +  CVN++ D E C  W++ G C  NP++M  NC K+C  C      G DC N + +D +CE W+  G+C  NP +ML NC K+C  C      TSQ++                         D  CVN + ++EC + ++ G+C  +  +M  +C ++C  C  +K      V+ ++         C   ++   C  N ++M  NC K+C  C+    C N H   +C +W+  G C +NP  M   C
Sbjct:  183 FMIQYCQKTCDKCGVDKEGCKNLVEDKDCQEWAGRGECEANSEYMTANCRKACKKCI---------TGSCVNKHGNEAECGRWAAEGECSVNPLWMIENCKKSCGKCDTSTGDGGTDGTCKNIHSNDAECEAWEKRGECSKNPLWMVPNCRKACNRCGD----GTDTPDTGNCRNIYGNDVQCDSWAKVGECSANPVWMGENCAKSCKTCDGNNNNNNNGGSCTNSYGNDAQCSDWAKRGECTANPVWM-------TMNCEKACQKCGGSEDGGGDGGNTNGGECKNLYKDDAQCQDWADSGECAANPDWMPINCKKACGLCGDGDNTGDGNTGNGGNVNCVNSYGDAQCELWARDNQCAVNPSFMLEQCKKACRSCDRGSDNGGTTANSNCVNTHHDDESCRIWAEHGHCSSNPDWMTKNCQKACGLCGGRDGSG-DCRNKHYDDAQCEDWAKYGQCQTNPDWMLPNCKKACTKCDKIATGTSQEDNNVDDREIITLPTTTTTQNPPPPPPDDACVNAHGDTECAQMARDGKCISDSRWMRRHCRRACTEC--DKGSNSGTVDNNRPQCIDVVGNCAELAQNNGCSNNLQHMYNNCKKTCGLCEPG-ACTNKHR--QCKRWARHGGCERNPGVMYRQC 795          
BLAST of SMED30016458 vs. TrEMBL
Match: A0A068Y1M8 (Metalloendopeptidase OS=Echinococcus multilocularis OX=6211 GN=EmuJ_001195900 PE=4 SV=1)

HSP 1 Score: 306.605 bits (784), Expect = 1.571e-87
Identity = 168/398 (42.21%), Postives = 223/398 (56.03%), Query Frame = -1
Query: 3760 TRSKRAVVVKSADQWPDGVIPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQNCYS-IVGMDYF-AEQEVNLASPGCRHVRYFSWI*K-------REYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSFINEKGEPSIQVINESMIHLLLEVHEKDLSFLDAKVVNLYYKCADRCFQNV--TCSAGGYIDQYCQCHTPESFESRRCQDKNDESWCIEQQKKGHCELRNKYMSFNCRKTCEKCFKH-RNRFVIPIKECKNLEKNETCDAWEKRGECKKNPRYMKFNCKQSCGLCDKSTTTLAPKIECKNIYG-DDKCNLWEAVGDCQNNKLFMELNCAKACGKC 4914
            TR+KRA +  +A  WP GVIPY ID+  F EEE+  L  AI  WN ETCV FR  R SDR+WV+IT G  C+S  +G      EQ + L+  GCR V Y + +          EYGLYLHELGH +GLDHEH R+ RD YL++ +  +       F + +  D   +D P+DLQSIMHYG  SF     +  I   +E + H+L +V+ KD+SF DA+++NL+Y C DRC +N+   C   GYID++C+C TPESF  RRC D + E  C +   K  C     +M+  CRKTC  C+K+     V P   CK  ++ E C  W + G C K   YMK  C +SCG C+ +         CK+ Y     C  W   G C   K++M  NCAK+CG C
Sbjct:   23 TRTKRAAIPVNAISWPKGVIPYIIDKYVFKEEELKHLATAIEVWNNETCVQFRPYRRSDRHWVRITDGNTCFSEYMGFKGIPGEQTITLSRNGCRFVSYQNKLIDIQNLNKLHEYGLYLHELGHVMGLDHEHARADRDKYLRVNDAGVPENFKSFFARKSIEDLHTYDSPYDLQSIMHYGRSSFSVYADKAPIDARDEKVRHMLADVYVKDISFWDARILNLHYHCEDRC-KNIQPLCPFPGYIDKFCKCQTPESFAQRRCVDTHGELQCQKLADKLECYRNASFMTAYCRKTCGFCYKNILPAAVRPSVACK--DRQERCADWARVGHCAKTSGYMKMMCPESCGFCNLTKNDPGETGGCKDRYMYPSDCEAWAKEGRCATYKMWMHFNCAKSCGVC 417          

HSP 2 Score: 79.337 bits (194), Expect = 4.499e-11
Identity = 60/218 (27.52%), Postives = 96/218 (44.04%), Query Frame = -1
Query:  475 KTFENKTCLNLYKDDTCDLWKKAGYCHIYPKFMLSHCLKSCGQCSEYSECKNLYNNIVCDK-------WAAEGECLKNSKFMIQLCLKSCGRCYDLKNLKVNRTNSDGCENKYGDWS-CEAWKQVGECERNPIFMNDQCSKSCGTCFKS----------------TATSTSGPLRMSSVCKNFYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSCQN 1056
            ++F  + C++ + +  C        C+    FM ++C K+CG C +      +  ++ C         WA  G C K S +M  +C +SCG C   KN   +   + GC+++Y   S CEAW + G C    ++M+  C+KSCG C  S                T TS     ++SSVC+N Y  + C        C ++  +M   C   C  CQ+
Sbjct:  275 ESFAQRRCVDTHGELQCQKLADKLECYRNASFMTAYCRKTCGFCYKNILPAAVRPSVACKDRQERCADWARVGHCAKTSGYMKMMCPESCGFCNLTKN---DPGETGGCKDRYMYPSDCEAWAKEGRCATYKMWMHFNCAKSCGVCTNSEGSGVNITVSPLSATTTTTSKGVATKVSSVCRNNYGTQNCRRLVSRKMCLTHKKWMERQCRAVCGFCQS 489          

HSP 3 Score: 77.0258 bits (188), Expect = 2.010e-10
Identity = 64/225 (28.44%), Postives = 91/225 (40.44%), Query Frame = -1
Query: 1768 CNSCESATQLPTACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVCKFNNETKGCRNL----DPNSDCESWKQAGECLNNEKYMKVQCGKSCGRCN-----AKTYVDCKDIYQEDS-CKAWKDLGECFKNPVFMLSKCSQTCGSC--------DMEKNPV--------------VVETCKNIDSNENCNTWQTAGECEKNPNYMLVNCAKACKTCQKDDA 2346
            C + ES  Q    C + H  E +C+K ++K EC +N +FM   C K+C  C  N      R      D    C  W + G C     YMK+ C +SCG CN           CKD Y   S C+AW   G C    ++M   C+++CG C        ++  +P+              V   C+N    +NC    +   C  +  +M   C   C  CQ D A
Sbjct:  271 CQTPESFAQ--RRCVDTH-GELQCQKLADKLECYRNASFMTAYCRKTCGFCYKNILPAAVRPSVACKDRQERCADWARVGHCAKTSGYMKMMCPESCGFCNLTKNDPGETGGCKDRYMYPSDCEAWAKEGRCATYKMWMHFNCAKSCGVCTNSEGSGVNITVSPLSATTTTTSKGVATKVSSVCRNNYGTQNCRRLVSRKMCLTHKKWMERQCRAVCGFCQSDTA 492          

HSP 4 Score: 75.8702 bits (185), Expect = 4.550e-10
Identity = 62/244 (25.41%), Postives = 98/244 (40.16%), Query Frame = -1
Query: 2590 KCKETKPGNDSLCKNIEKDNNCEQLKIRGECLRNVSYMRVNCAKTCFNCNASVVDKPCVNSYM----DSECDKWSKLGECQKNPNYMLLNCAKSCNNCDLI---PSDGKDCFN--IYRNDKCEKWSNAGECSKNPKFMLENCAKSCNNCKTSQQNDSNCVNINKNSECDKWSQMGECSKNPNYMLVNCAKSCNYCKFNKDLQKNCVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSCDSE 3294
            KC+  +      C +   +  C++L  + EC RN S+M   C KTC  C  +++      S         C  W+++G C K   YM + C +SC  C+L    P +   C +  +Y +D CE W+  G C+    +M  NCAKSC  C  S+ +  N + ++  S     +  G  +K                     +   C N +    C     R  C  + K+M   C   C  C S+
Sbjct:  270 KCQTPESFAQRRCVDTHGELQCQKLADKLECYRNASFMTAYCRKTCGFCYKNILPAAVRPSVACKDRQERCADWARVGHCAKTSGYMKMMCPESCGFCNLTKNDPGETGGCKDRYMYPSD-CEAWAKEGRCATYKMWMHFNCAKSCGVCTNSEGSGVN-ITVSPLSATTTTTSKGVATK---------------------VSSVCRNNYGTQNCRRLVSRKMCLTHKKWMERQCRAVCGFCQSD 490          

HSP 5 Score: 74.7146 bits (182), Expect = 1.203e-9
Identity = 59/210 (28.10%), Postives = 83/210 (39.52%), Query Frame = -1
Query: 1498 CKDIYQEDSCKAWKDLGECFKNPVFMLSKCSQTCGSCDMEKNPVVVE---TCKNIDSNENCNTWQTAGECEKNPNYMLVNCAKACKTC--QKDDAKNVEKKCDDVYSDVS-CLKWKAEGLCEKQSLVMKVKCSKTCGTCDQLKNN------------------------QTMCQNAYNDAICTKWKNMGECTKNPNFMLIQCKESCGKCE 2037
            C D + E  C+   D  EC++N  FM + C +TCG C     P  V     CK  D  E C  W   G C K   YM + C ++C  C   K+D       C D Y   S C  W  EG C    + M   C+K+CG C   + +                         ++C+N Y    C +  +   C  +  +M  QC+  CG C+
Sbjct:  282 CVDTHGELQCQKLADKLECYRNASFMTAYCRKTCGFCYKNILPAAVRPSVACK--DRQERCADWARVGHCAKTSGYMKMMCPESCGFCNLTKNDPGET-GGCKDRYMYPSDCEAWAKEGRCATYKMWMHFNCAKSCGVCTNSEGSGVNITVSPLSATTTTTSKGVATKVSSVCRNNYGTQNCRRLVSRKMCLTHKKWMERQCRAVCGFCQ 488          

HSP 6 Score: 73.559 bits (179), Expect = 2.347e-9
Identity = 67/242 (27.69%), Postives = 102/242 (42.15%), Query Frame = -1
Query: 2047 QKNCVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSC------DSERECLNTHNDAE-CSKWSSMGECTKNPKYMLVNCAXXXXXXXXXNTDKGTCSN----INSDKECENWSKRGECAKNPKYMLINCAKSCNSCESA-------TQLPTACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVCKFNNETKGCRNLDPNSDCESWKQAGECLNNEKYMKVQCGKSCGRCNAKT 2718
            Q+ CV+TH + +C+  + + EC +N  +M   C K+C  C       + R  +   +  E C+ W+ +G C K   YM + C +SC  C  +  D G             +CE W+K G CA    +M  NCAKSC  C ++       T  P + T            + KG  +           K  +VC+ N  T+ CR L              CL ++K+M+ QC   CG C + T
Sbjct:  279 QRRCVDTHGELQCQKLADKLECYRNASFMTAYCRKTCGFCYKNILPAAVRPSVACKDRQERCADWARVGHCAKTSGYMKMMCPESCGFCNLTKNDPGETGGCKDRYMYPSDCEAWAKEGRCATYKMWMHFNCAKSCGVCTNSEGSGVNITVSPLSATTTT---------TSKGVAT-----------KVSSVCRNNYGTQNCRRLVSRK---------MCLTHKKWMERQCRAVCGFCQSDT 491          

HSP 7 Score: 70.0922 bits (170), Expect = 3.294e-8
Identity = 52/170 (30.59%), Postives = 76/170 (44.71%), Query Frame = -1
Query:  475 YPKFMLSHCLKSCGQCSEYSECKNLYNNIVCDKWAAEGECLKNSKFMIQLCLKSCGRCYDLKN-LKVNRTNSDGCENKYGDWSCEAWKQVGECERNPIFMNDQCSKSCGTC--FKSTATSTSGPLRMSSVCKNFYSNKL-CDEWTKNGDCKSNSDFMRINCARSCNSCQN 972
            +P ++   C     +      C + +  + C K A + EC +N+ FM   C K+CG CY  KN L      S  C+++     C  W +VG C +   +M   C +SCG C   K+    T G       CK+ Y     C+ W K G C +   +M  NCA+SC  C N
Sbjct:  261 FPGYIDKFCKCQTPESFAQRRCVDTHGELQCQKLADKLECYRNASFMTAYCRKTCGFCY--KNILPAAVRPSVACKDR--QERCADWARVGHCAKTSGYMKMMCPESCGFCNLTKNDPGETGG-------CKDRYMYPSDCEAWAKEGRCATYKMWMHFNCAKSCGVCTN 419          

HSP 8 Score: 69.3218 bits (168), Expect = 5.033e-8
Identity = 70/249 (28.11%), Postives = 94/249 (37.75%), Query Frame = -1
Query:  619 HCE---KNVSYMLKFCAKSCKACNRLITTSLPSINCVNKLNDSTCETLKILGQCEKNSIFMIEKCGKSCGSCRPAKEKTFENKTCLNLYKDDTCDLWKKAGYCHIYPKFMLSHCLKSCGQC-------SEYSECKNLYNNIV-CDKWAAEGECLKNSKFMIQLCLKSCGRCYDLKNLKVN----------RTNSDG--------CENKYGDWSCEAWKQVGECERNPIFMNDQCSKSCGTCFKSTATST 1278
            HCE   KN+  +  F     K C      S     CV+   +  C+ L    +C +N+ FM   C K+CG C           +     + + C  W + G+C     +M   C +SCG C        E   CK+ Y     C+ WA EG C     +M   C KSCG C + +   VN           T S G        C N YG  +C        C  +  +M  QC   CG C   TAT T
Sbjct:  247 HCEDRCKNIQPLCPFPGYIDKFCKCQTPESFAQRRCVDTHGELQCQKLADKLECYRNASFMTAYCRKTCGFCYKNILPAAVRPSVACKDRQERCADWARVGHCAKTSGYMKMMCPESCGFCNLTKNDPGETGGCKDRYMYPSDCEAWAKEGRCATYKMWMHFNCAKSCGVCTNSEGSGVNITVSPLSATTTTTSKGVATKVSSVCRNNYGTQNCRRLVSRKMCLTHKKWMERQCRAVCGFCQSDTATVT 495          

HSP 9 Score: 68.9366 bits (167), Expect = 6.930e-8
Identity = 51/161 (31.68%), Postives = 76/161 (47.20%), Query Frame = -1
Query:   13 CQNLKFSLKVKCQNILTKEKCLKLKKAGECEKNSKQMAELCAYTCHKCNLSFVKPMEINQNPTKMRSSKFKCDNRAGDFQCSYWARQKQCELNASYMRLFCQKSCGACLMEK--PGQVS-CVDKFA-TMKCFSWSMRGECDRNGKWMTENCAKSCLVCQNN 483
            CQ  +   + +C +   + +C KL    EC +N+  M   C  TC  C  + +        P  +R S   C +R    +C+ WAR   C   + YM++ C +SCG C + K  PG+   C D++     C +W+  G C     WM  NCAKSC VC N+
Sbjct:  271 CQTPESFAQRRCVDTHGELQCQKLADKLECYRNASFMTAYCRKTCGFCYKNIL--------PAAVRPS-VACKDRQE--RCADWARVGHCAKTSGYMKMMCPESCGFCNLTKNDPGETGGCKDRYMYPSDCEAWAKEGRCATYKMWMHFNCAKSCGVCTNS 420          

HSP 10 Score: 62.3882 bits (150), Expect = 8.767e-6
Identity = 44/138 (31.88%), Postives = 64/138 (46.38%), Query Frame = -1
Query: 3013 CQNKYGDKYCEEFKSKGECTKNPDFMFIQCAKSCSKC-KETKPGN---DSLCKNIEKDNNCEQLKIRGECLRNVSYMRVNCAKTCFNCNASVVDK----PCVNSYM-DSECDKWSKLGECQKNPNYMLLNCAKSCNNC 3399
            C + +G+  C++   K EC +N  FM   C K+C  C K   P        CK  ++   C      G C +   YM++ C ++C  CN +  D      C + YM  S+C+ W+K G C     +M  NCAKSC  C
Sbjct:  282 CVDTHGELQCQKLADKLECYRNASFMTAYCRKTCGFCYKNILPAAVRPSVACK--DRQERCADWARVGHCAKTSGYMKMMCPESCGFCNLTKNDPGETGGCKDRYMYPSDCEAWAKEGRCATYKMWMHFNCAKSCGVC 417          
BLAST of SMED30016458 vs. TrEMBL
Match: A0A068WRN1 (Metalloendopeptidase OS=Echinococcus granulosus OX=6210 GN=EgrG_001195900 PE=4 SV=1)

HSP 1 Score: 303.908 bits (777), Expect = 1.360e-86
Identity = 167/397 (42.07%), Postives = 226/397 (56.93%), Query Frame = -1
Query: 3760 RSKRAVVVKSADQWPDGVIPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQNCYS-IVGMDYF-AEQEVNLASPGCRHVRY------FSWI*K-REYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSFINEKGEPSIQVINESMIHLLLEVHEKDLSFLDAKVVNLYYKCADRCFQNV--TCSAGGYIDQYCQCHTPESFESRRCQDKNDESWCIEQQKKGHCELRNKYMSFNCRKTCEKCFKH-RNRFVIPIKECKNLEKNETCDAWEKRGECKKNPRYMKFNCKQSCGLCDKSTTTLAPKIECKNIYG-DDKCNLWEAVGDCQNNKLFMELNCAKACGKC 4911
            R++RA +  +A  WP GVIPY ID++ F EEE+  L  AI  WN ETCV FR  R SDR+W++IT G  C+S  +G      EQ + L+  GCR V Y         + K  EYGLYLHELGH +GLDHEH R+ RD YL++ +  +       F + +  D   +D P+DLQSIMHYG  SF     +  I V +E M H+L  V+ KD+SF DA+++NL+Y+C DRC +NV   C   GYID++C+C TPE+F  RRC D + +  C +   K  C     +M+  CRKTC  C+K+     V P   CK  ++ E+C  W + G C K   YMK  C +SCG C+ +         CK+ Y     C  W   G C + K++M  NCAK+CG C
Sbjct:   23 RTRRAAIPVNAISWPKGVIPYIIDKSLFKEEELKHLATAIEVWNNETCVQFRPYRRSDRHWMRITDGNTCFSEYMGFKGIPGEQTITLSRNGCRFVSYQNKPINIQNLKKLHEYGLYLHELGHVMGLDHEHARADRDKYLRVNDAGVPENFKLFFTRKSIEDLHTYDSPYDLQSIMHYGRSSFSVYADKAPIDVRDEKMRHMLAAVYVKDISFWDARILNLHYRCEDRC-KNVQPLCPFPGYIDKFCKCQTPEAFAQRRCVDTHGDLQCQKLADKLECYRNASFMTAYCRKTCGFCYKNILPATVRPSVACK--DRQESCADWARVGHCAKTSGYMKMMCPESCGFCNLTKDDAGETGGCKDRYMYPSDCEAWAKEGRCASYKMWMHFNCAKSCGVC 416          

HSP 2 Score: 78.5666 bits (192), Expect = 7.326e-11
Identity = 67/235 (28.51%), Postives = 100/235 (42.55%), Query Frame = -1
Query: 2047 QKNCVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSC------DSERECLNTHNDAE-CSKWSSMGECTKNPKYMLVNCAXXXXXXXXXNTDKGTCSN----INSDKECENWSKRGECAKNPKYMLINCAKSCNSCESATQLPTACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVCKFNNETKGCRNLDPNSDCESWKQAGECLNNEKYMKVQCGKSCGRCNAKT 2718
            Q+ CV+TH D +C+  + + EC +N  +M   C K+C  C       + R  +   +  E C+ W+ +G C K   YM + C +SC  C  +  D G             +CE W+K G CA    +M  NCAKSC  C   T    +  NI          + +G  +           K  +VC+ N  T+ CR L              CL ++K+M+ QC   CG C + T
Sbjct:  278 QRRCVDTHGDLQCQKLADKLECYRNASFMTAYCRKTCGFCYKNILPATVRPSVACKDRQESCADWARVGHCAKTSGYMKMMCPESCGFCNLTKDDAGETGGCKDRYMYPSDCEAWAKEGRCASYKMWMHFNCAKSCGVC---TNSEGSGVNITAPPLSATTTTARGVAT-----------KVSSVCRNNYGTQNCRRLVSRK---------MCLTHKKWMERQCRAVCGFCQSDT 489          

HSP 3 Score: 77.411 bits (189), Expect = 1.562e-10
Identity = 62/239 (25.94%), Postives = 100/239 (41.84%), Query Frame = -1
Query: 2302 KDCFNIYRNDKCEKWSNAGECSKNPKFMLENCAKSCNNCKTSQQNDSNCVNI---NKNSECDKWSQMGECSKNPNYMLVNCAKSCNYCKFNKD---LQKNCVNTHK-DSECESWSKRGECQKNPKYMLVNCAKSCKSC-DSERECLN-THNDAECSKWSSMGECTKNPKYMLVNCAXXXXXXXXXNTDKGTCSNINSDKECENWSKRGECAKNPKYMLINCAKSCNSCESATQLPTACT 2991
            + C + + + +C+K ++  EC +N  FM   C K+C  C  +    +   ++   ++   C  W+++G C+K   YM + C +SC +C   KD       C + +   S+CE+W+K G C     +M  NCAKSC  C +SE   +N T      +  ++ G  TK                         C N    + C     R  C  + K+M   C   C  C+S T   T  T
Sbjct:  279 RRCVDTHGDLQCQKLADKLECYRNASFMTAYCRKTCGFCYKNILPATVRPSVACKDRQESCADWARVGHCAKTSGYMKMMCPESCGFCNLTKDDAGETGGCKDRYMYPSDCEAWAKEGRCASYKMWMHFNCAKSCGVCTNSEGSGVNITAPPLSATTTTARGVATKV---------------------SSVCRNNYGTQNCRRLVSRKMCLTHKKWMERQCRAVCGFCQSDTSTVTPST 496          

HSP 4 Score: 75.8702 bits (185), Expect = 4.394e-10
Identity = 50/159 (31.45%), Postives = 74/159 (46.54%), Query Frame = -1
Query: 2848 KCKETKPGNDSLCKNIEKDNNCEQLKIRGECLRNVSYMRVNCAKTCFNCNASVVDKPCVNSYM----DSECDKWSKLGECQKNPNYMLLNCAKSCNNCDLIPSDG------KDCFNIYRNDKCEKWSNAGECSKNPKFMLENCAKSCNNCKTSQQNDSN 3294
            KC+  +      C +   D  C++L  + EC RN S+M   C KTC  C  +++      S         C  W+++G C K   YM + C +SC  C+L   D       KD + +Y +D CE W+  G C+    +M  NCAKSC  C  S+ +  N
Sbjct:  269 KCQTPEAFAQRRCVDTHGDLQCQKLADKLECYRNASFMTAYCRKTCGFCYKNILPATVRPSVACKDRQESCADWARVGHCAKTSGYMKMMCPESCGFCNLTKDDAGETGGCKDRY-MYPSD-CEAWAKEGRCASYKMWMHFNCAKSCGVCTNSEGSGVN 425          

HSP 5 Score: 75.485 bits (184), Expect = 5.702e-10
Identity = 55/170 (32.35%), Postives = 78/170 (45.88%), Query Frame = -1
Query:  475 YPKFMLSHCLKSCGQCSEYSECKNLYNNIVCDKWAAEGECLKNSKFMIQLCLKSCGRCYDLKN-LKVNRTNSDGCENKYGDWSCEAWKQVGECERNPIFMNDQCSKSCGTC--FKSTATSTSGPLRMSSVCKNFYSNKL-CDEWTKNGDCKSNSDFMRINCARSCNSCQN 972
            +P ++   C     +      C + + ++ C K A + EC +N+ FM   C K+CG CY  KN L      S  C+++    SC  W +VG C +   +M   C +SCG C   K  A  T G       CK+ Y     C+ W K G C S   +M  NCA+SC  C N
Sbjct:  260 FPGYIDKFCKCQTPEAFAQRRCVDTHGDLQCQKLADKLECYRNASFMTAYCRKTCGFCY--KNILPATVRPSVACKDR--QESCADWARVGHCAKTSGYMKMMCPESCGFCNLTKDDAGETGG-------CKDRYMYPSDCEAWAKEGRCASYKMWMHFNCAKSCGVCTN 418          

HSP 6 Score: 75.485 bits (184), Expect = 6.610e-10
Identity = 58/220 (26.36%), Postives = 90/220 (40.91%), Query Frame = -1
Query: 1894 CSNINSDKECENWSKRGECAKNPKYMLINCAKSCNSCE----SATQLPT-ACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVCKFN----NETKGC--RNLDPNSDCESWKQAGECLNNEKYMKVQCGKSCGRCN-------------------------AKTYVDCKDIYQEDSCKAWKDLGECFKNPVFMLSKCSQTCGSCDMEKNPVVVET 2445
            C + + D +C+  + + EC +N  +M   C K+C  C      AT  P+ AC +    ++ C  W+  G C+K   +M   C +SC  C        ET GC  R + P SDCE+W + G C + + +M   C KSCG C                           K    C++ Y   +C+       C  +  +M  +C   CG C  + + V   T
Sbjct:  281 CVDTHGDLQCQKLADKLECYRNASFMTAYCRKTCGFCYKNILPATVRPSVACKD---RQESCADWARVGHCAKTSGYMKMMCPESCGFCNLTKDDAGETGGCKDRYMYP-SDCEAWAKEGRCASYKMWMHFNCAKSCGVCTNSEGSGVNITAPPLSATTTTARGVATKVSSVCRNNYGTQNCRRLVSRKMCLTHKKWMERQCRAVCGFCQSDTSTVTPST 496          

HSP 7 Score: 75.485 bits (184), Expect = 6.667e-10
Identity = 62/222 (27.93%), Postives = 90/222 (40.54%), Query Frame = -1
Query: 1774 CNSCESATQLPTACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVCKFNNETKGCRNL----DPNSDCESWKQAGECLNNEKYMKVQCGKSCGRCN-----AKTYVDCKDIYQEDS-CKAWKDLGECFKNPVFMLSKCSQTCGSC--------DMEKNPV-------------VVETCKNIDSNENCNTWQTAGECEKNPNYMLVNCAKACKTCQKD 2346
            C + E+  Q    C + H  + +C+K ++K EC +N +FM   C K+C  C  N      R      D    C  W + G C     YMK+ C +SCG CN     A     CKD Y   S C+AW   G C    ++M   C+++CG C        ++   P+             V   C+N    +NC    +   C  +  +M   C   C  CQ D
Sbjct:  270 CQTPEAFAQ--RRCVDTH-GDLQCQKLADKLECYRNASFMTAYCRKTCGFCYKNILPATVRPSVACKDRQESCADWARVGHCAKTSGYMKMMCPESCGFCNLTKDDAGETGGCKDRYMYPSDCEAWAKEGRCASYKMWMHFNCAKSCGVCTNSEGSGVNITAPPLSATTTTARGVATKVSSVCRNNYGTQNCRRLVSRKMCLTHKKWMERQCRAVCGFCQSD 488          

HSP 8 Score: 75.0998 bits (183), Expect = 9.035e-10
Identity = 67/240 (27.92%), Postives = 95/240 (39.58%), Query Frame = -1
Query:  619 CSNLANDTDCESWSKAGHCEKNVSYMLKFCAKSCKAC--NRLITTSLPSINCVNKLNDSTCETLKILGQCEKNSIFMIEKCGKSCGSCRPAKEKTFENKTCLNLYKDDT-CDLWKKAGYCHIYPKFMLSHCLKSCGQCSEYSECKNLYNNIVCDKWAAEGECLKNSKFMIQLCLKSCGRCYDLKNLKVNRTNSDGCENKYGDWSCEAWKQVGECERNPIFMNDQCSKSCGTCFKSTATST 1329
            C +   D  C+  +    C +N S+M  +C K+C  C  N L  T  PS+ C ++    +C     +G C K S +M   C +SCG C   K+   E   C + Y   + C+ W K G C  Y  +M  +C KSCG C+  SE   +  NI     +A     +                       V    S  C N YG  +C        C  +  +M  QC   CG C   T+T T
Sbjct:  281 CVDTHGDLQCQKLADKLECYRNASFMTAYCRKTCGFCYKNILPATVRPSVACKDR--QESCADWARVGHCAKTSGYMKMMCPESCGFCNLTKDDAGETGGCKDRYMYPSDCEAWAKEGRCASYKMWMHFNCAKSCGVCTN-SEGSGV--NITAPPLSATTTTARG----------------------VATKVSSVCRNNYGTQNCRRLVSRKMCLTHKKWMERQCRAVCGFCQSDTSTVT 493          

HSP 9 Score: 68.1662 bits (165), Expect = 1.174e-7
Identity = 57/235 (24.26%), Postives = 91/235 (38.72%), Query Frame = -1
Query: 1498 KGCRNLDPNSDCESWKQAGECLNNEKYMKVQCGKSCGRC-------NAKTYVDCKDIYQEDSCKAWKDLGECFKNPVFMLSKCSQTCGSCDMEKNPVV-VETCKN-IDSNENCNTWQTAGECEKNPNYMLVNCAKACKTCQKDDAKNVEKKCDDVYSDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTCDQLKNNQTMCQNAYNDAICTKWKNMGECTKNPNFMLIQCKESCGKCE 2175
            + C +   +  C+      EC  N  +M   C K+CG C         +  V CKD  +++SC  W  +G C K   +M   C ++CG C++ K+       CK+      +C  W   G C     +M  NCAK+C  C   +   V    +     +S     A G+  K S                     ++C+N Y    C +  +   C  +  +M  QC+  CG C+
Sbjct:  279 RRCVDTHGDLQCQKLADKLECYRNASFMTAYCRKTCGFCYKNILPATVRPSVACKD--RQESCADWARVGHCAKTSGYMKMMCPESCGFCNLTKDDAGETGGCKDRYMYPSDCEAWAKEGRCASYKMWMHFNCAKSCGVCTNSEGSGV----NITAPPLSATTTTARGVATKVS---------------------SVCRNNYGTQNCRRLVSRKMCLTHKKWMERQCRAVCGFCQ 486          

HSP 10 Score: 65.0846 bits (157), Expect = 1.218e-6
Identity = 62/234 (26.50%), Postives = 91/234 (38.89%), Query Frame = -1
Query:   88 CENKYGDWSCEAWKQVGECERNPIFMNDQCSKSCGTCFKSTATSTSGPLRMSSVCKNFYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSCQNLK--FSLKVKCQN-ILTKEKCLKLKKAGECEKNSKQMAELCAYTCHKCNLSFVKPMEINQNPTKMRSSKFK---------CDNRAGDFQCSYWARQKQCELNASYMRLFCQKSCGACLMEKPGQVSCVDKFATMKCFSWSM 753
            C + +GD  C+      EC RN  FM   C K+CG C+K+   +T   +R S  CK+    + C +W + G C   S +M++ C  SC  C   K        C++  +    C    K G C      M   CA +C  C  S    + I   P    ++  +         C N  G   C     +K C  +  +M   C+  CG C  +     S V      K FS+S 
Sbjct:  281 CVDTHGDLQCQKLADKLECYRNASFMTAYCRKTCGFCYKNILPAT---VRPSVACKD--RQESCADWARVGHCAKTSGYMKMMCPESCGFCNLTKDDAGETGGCKDRYMYPSDCEAWAKEGRCASYKMWMHFNCAKSCGVCTNSEGSGVNITAPPLSATTTTARGVATKVSSVCRNNYGTQNCRRLVSRKMCLTHKKWMERQCRAVCGFCQSD----TSTVTPSTKEKFFSFSF 505          

HSP 11 Score: 65.0846 bits (157), Expect = 1.261e-6
Identity = 45/138 (32.61%), Postives = 65/138 (47.10%), Query Frame = -1
Query: 3013 CQNKYGDKYCEEFKSKGECTKNPDFMFIQCAKSCSKC-KETKPGN---DSLCKNIEKDNNCEQLKIRGECLRNVSYMRVNCAKTCFNCNASVVDK----PCVNSYM-DSECDKWSKLGECQKNPNYMLLNCAKSCNNC 3399
            C + +GD  C++   K EC +N  FM   C K+C  C K   P        CK  ++  +C      G C +   YM++ C ++C  CN +  D      C + YM  S+C+ W+K G C     +M  NCAKSC  C
Sbjct:  281 CVDTHGDLQCQKLADKLECYRNASFMTAYCRKTCGFCYKNILPATVRPSVACK--DRQESCADWARVGHCAKTSGYMKMMCPESCGFCNLTKDDAGETGGCKDRYMYPSDCEAWAKEGRCASYKMWMHFNCAKSCGVC 416          

HSP 12 Score: 64.3142 bits (155), Expect = 2.247e-6
Identity = 50/161 (31.06%), Postives = 73/161 (45.34%), Query Frame = -1
Query:   13 CQNLKFSLKVKCQNILTKEKCLKLKKAGECEKNSKQMAELCAYTCHKCNLSFVKPMEINQNPTKMRSSKFKCDNRAGDFQCSYWARQKQCELNASYMRLFCQKSCGACLMEK--PGQVS-CVDKFA-TMKCFSWSMRGECDRNGKWMTENCAKSCLVCQNN 483
            CQ  +   + +C +     +C KL    EC +N+  M   C  TC  C  + +        P  +R S   C +R     C+ WAR   C   + YM++ C +SCG C + K   G+   C D++     C +W+  G C     WM  NCAKSC VC N+
Sbjct:  270 CQTPEAFAQRRCVDTHGDLQCQKLADKLECYRNASFMTAYCRKTCGFCYKNIL--------PATVRPS-VACKDRQE--SCADWARVGHCAKTSGYMKMMCPESCGFCNLTKDDAGETGGCKDRYMYPSDCEAWAKEGRCASYKMWMHFNCAKSCGVCTNS 419          
BLAST of SMED30016458 vs. Ensembl Cavefish
Match: tll1 (tolloid-like 1 [Source:NCBI gene;Acc:474335])

HSP 1 Score: 91.6633 bits (226), Expect = 4.320e-18
Identity = 57/177 (32.20%), Postives = 82/177 (46.33%), Query Frame = -1
Query: 4390 GTTRSKRAVVVKSADQWPDGVIPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQNCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSF 4920
            G +R  RA   ++   WP GVIPY I  N F  ++ +  + A+  W  +TCV F  K + +   V       C S VG      Q +++    C            ++G+ +HELGH IG  HEH R  RDD++ I+ +NIQ      F K    +      P+D  SIMHY   +F
Sbjct:   86 GKSRVPRAATSRAERIWPGGVIPYVIGGN-FTGDQRAMFKQAMRHWEKQTCVTFIEKTDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGK-NCD-----------KFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRDNIQPGQEYNFLKMEPGEVNSLGEPYDFDSIMHYARNTF 249          
BLAST of SMED30016458 vs. Ensembl Cavefish
Match: c6ast1 (low choriolytic enzyme-like [Source:NCBI gene;Acc:103028848])

HSP 1 Score: 86.6557 bits (213), Expect = 5.013e-18
Identity = 61/196 (31.12%), Postives = 99/196 (50.51%), Query Frame = -1
Query: 4270 IPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQNCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSFINEKGEPSIQVINESMIHLLLEVHEKDLSFLDAKVVNLYY 4857
            +PY I  N F+  E   ++DA+ ++   TCV F + R+ +++++ I     C+S VG      Q V+L   GC             +G+  HEL HA+G +HE  RS RD +++I+ +N+       F+   K  TL+ D P+D  SIMHYG  +F   + EP+I  I  S   +       ++S +D + +N  Y
Sbjct:   94 VPYVIS-NQFSSRERRVIEDAMKSFQSSTCVRF-VPRQREQDYILIRSLDGCFSFVGRRG-GGQIVSLNRNGCVF-----------FGVVQHELLHALGFNHEQTRSDRDQHVRILFQNVIRGQEHNFQ---KIRTLNLDTPYDYNSIMHYGRFAFSRNR-EPTIIPIPNSNTVI---GRATEMSRVDIQRINRLY 268          
BLAST of SMED30016458 vs. Ensembl Cavefish
Match: tll1 (tolloid-like 1 [Source:NCBI gene;Acc:474335])

HSP 1 Score: 91.2781 bits (225), Expect = 6.042e-18
Identity = 57/177 (32.20%), Postives = 81/177 (45.76%), Query Frame = -1
Query: 4390 GTTRSKRAVVVKSADQWPDGVIPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQNCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSF 4920
            G +R  RA   ++   WP GVIPY I  N F   + +  + A+  W  +TCV F  K + +   V       C S VG      Q +++    C            ++G+ +HELGH IG  HEH R  RDD++ I+ +NIQ      F K    +      P+D  SIMHY   +F
Sbjct:  135 GKSRVPRAATSRAERIWPGGVIPYVIGGN-FTGSQRAMFKQAMRHWEKQTCVTFIEKTDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGK-NCD-----------KFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRDNIQPGQEYNFLKMEPGEVNSLGEPYDFDSIMHYARNTF 298          
BLAST of SMED30016458 vs. Ensembl Cavefish
Match: c6ast3 (six-cysteine containing astacin protease 3 [Source:ZFIN;Acc:ZDB-GENE-050320-99])

HSP 1 Score: 85.8853 bits (211), Expect = 1.101e-17
Identity = 60/176 (34.09%), Postives = 95/176 (53.98%), Query Frame = -1
Query: 4363 WP---DG--VIPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQNCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKN-NKSDTLDFDMPFDLQSIMHYGPLSFINEKGEPSI 4872
            WP   DG   +PY I  N F   EV  +Q  +++++  +C+ F+ +R ++R+++ I     CYS VG    A Q V+LA  GC +           +    HEL HA+G +HE  RS RD+++++  ENI    VD  K N NK  TL+   P+D  S+M Y   +F ++ G+P++
Sbjct:   61 WPKSNDGKVYVPYVIS-NQFASREVQVIQRGLDSFSSFSCIRFK-RRTNERDYLSIESRNGCYSYVGRRGNA-QTVSLARNGCIY-----------HKTVQHELLHALGFNHEQTRSDRDNHIRVAWENI----VDTMKHNFNKIATLNQGTPYDYNSVMQYHKTAF-SKNGKPTM 217          
BLAST of SMED30016458 vs. Ensembl Cavefish
Match: ENSAMXT00000033223.1 (high choriolytic enzyme 1-like [Source:NCBI gene;Acc:111197481])

HSP 1 Score: 85.1149 bits (209), Expect = 1.348e-17
Identity = 59/198 (29.80%), Postives = 103/198 (52.02%), Query Frame = -1
Query: 4264 IPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQNCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSFINEKGEPSIQVINESMIHLLLEVHEKDLSFLDAKVVNLYYKC 4857
            +P+ +  + F+  + + +  A+ T++ +TC+ F + R ++ +++ I     CYS +G     +Q V+L++ GC +           +G+  HEL HA+G  HEH RS RD Y+ I  +NI       F   NK +T + + P+D  S+MHYG  +F    G  +I  I ++ + +   V   DLS +D + +N  Y C
Sbjct:   79 VPFTVSAD-FSSTDRAVIAGAMATFHSKTCIRF-VDRSTEIDYLSIENRDGCYSSLGRT-GGKQVVSLSTRGCVY-----------HGIVQHELNHALGFYHEHTRSDRDRYVTINWQNIDPTMQYNF---NKENTNNLNTPYDYSSVMHYGKTAF-TINGLNTITPIPDASVQIGQRV---DLSVIDIQRINTLYNC 255          
BLAST of SMED30016458 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007253.1 (pep scaffold:Pmarinus_7.0:GL476910:54360:144194:-1 gene:ENSPMAG00000006538.1 transcript:ENSPMAT00000007253.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.8113 bits (216), Expect = 1.461e-17
Identity = 55/176 (31.25%), Postives = 83/176 (47.16%), Query Frame = -1
Query: 4390 TRSKRAVVVKSADQWPDGVIPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQ-NCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSF 4914
            +R+ RA   +S   WP GVIPY +  N F   + +  + A+  W   TCV F ++R  + +++  T     C S VG      Q +++    C            ++G+ +HELGH IG  HEH R  RDD++ I++ NIQ      F K    +       +D  SIMHY   +F
Sbjct:    8 SRAPRAATARSERIWPGGVIPYIVGGN-FTGSQKAMFRQAMRHWEKHTCVTF-IERTDEESYIVFTYRPCGCCSYVGRRGGGPQAISIGK-NCD-----------KFGIVVHELGHVIGFWHEHTRPDRDDHVTIIKANIQPGQEYNFLKMEPGEVDSLGESYDFDSIMHYARNTF 169          
BLAST of SMED30016458 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004913.1 (pep scaffold:Pmarinus_7.0:GL478359:22377:26907:1 gene:ENSPMAG00000004462.1 transcript:ENSPMAT00000004913.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.929 bits (154), Expect = 1.053e-11
Identity = 36/100 (36.00%), Postives = 52/100 (52.00%), Query Frame = -1
Query: 4405 CYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHY 4704
            C+S VGM    EQ V++   GC  V           G   HELGHA+G  HE  R  RD ++ ++E N+Q   +  F   + +D     +P+DL+S+MHY
Sbjct:    1 CWSFVGMIGVGEQVVSIGR-GCEGV-----------GTVAHELGHAVGYVHEQSRPDRDAFISVLEGNVQDGQLPQFAVYSATDPR--GVPYDLKSVMHY 86          
BLAST of SMED30016458 vs. Ensembl Nematostella
Match: EDO47261 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMF1])

HSP 1 Score: 132.88 bits (333), Expect = 2.962e-33
Identity = 114/423 (26.95%), Postives = 173/423 (40.90%), Query Frame = -1
Query: 3604 WPDGVIPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQNCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSFINEKGEPSIQVINESMIHLLLEVHEKDLSFLDAKVVNLYYKCADRCFQNVTCSAGGYIDQYCQCHTPESFESRRCQDKNDESWCIEQQKKGHCELRNKYMSFNCRKTCEKCFKHRNRFVIPIKECKNLEKNETCDAWEKRGECKKNPRYMKFNCKQSCGLCDKSTTTLAPKIECKNIYGDDKCNLWEAVGDCQNNKLFMELNCAKACGKCGTXXXXXXXXXXXXXXXDVYEENSCLSWADANECTKNPNFMHKMCKKSCKLC 4872
            W DGVIPY ID +     E+  +   +  W  +TCV F ++RE + +++ I  G +CYS VG      + +     GC +           + + LHELGH IG  HE  R  RD+Y++++  NI     + F K +        + +D  SIMHY   +F        + +I       +       L+  D   VNL YKC                             S  C+DK     C    K+G CE+R  +M   C K+C+ C     R    +  CK+  +   C  W   G C     YM  +CK+SCG+C+       P + C++ +    C  W ++G C     +M  +C  AC  C         P  + D      +  C  WA   +C   P++M + C+KSC  C
Sbjct:   10 WYDGVIPYVIDCSL---SELMKVFFTMKEWESKTCVRF-VEREGEDDYLTIFRGTHCYSTVGRA--KGKRIMSVGNGCEY-----------HHVMLHELGHVIGFWHEQSRPDRDEYVRVLWHNIAKGWENAFLKLSWEAVDTMRVHYDFSSIMHYPFDAFSRNNKRTLLPLIP------VKATPYTKLTDRDVLKVNLMYKC-----------------------------STICRDKLYS--CKLWAKQGFCEIRKDFMPTECPKSCKICQDKNERTTTSMPVCKD--RTSWCRKWASYGYCHTKAVYMLKSCKRSCGICEDPRD---PSLPCEDKH--KSCVYWASIGVCDVRPTYMYKHCRLACRVCTPGIKHEGPPCDNKD-----PDEECDHWAKLGKCASRPSYMMEKCQKSCNAC 366          

HSP 2 Score: 93.9745 bits (232), Expect = 3.246e-20
Identity = 59/177 (33.33%), Postives = 87/177 (49.15%), Query Frame = -1
Query: 2326 NKNSECDKWSQMGECSKNPNYMLVNCAKSCNYCKFNKDLQKNCVNTHKD--SECESWSKRGECQKNPKYMLVNCAKSCKSCDSERE----CLNTHNDAECSKWSSMGECTKNPKYMLVNCAXXXXXXXXXNTDKGT-CSNINSDKECENWSKRGECAKNPKYMLINCAKSCNSCESA 2835
            +K   C  W++ G C    ++M   C KSC  C+   +     +   KD  S C  W+  G C     YML +C +SC  C+  R+    C + H    C  W+S+G C   P YM  +C  +C  C      +G  C N + D+EC++W+K G+CA  P YM+  C KSCN+C  +
Sbjct:  195 DKLYSCKLWAKQGFCEIRKDFMPTECPKSCKICQDKNERTTTSMPVCKDRTSWCRKWASYGYCHTKAVYMLKSCKRSCGICEDPRDPSLPCEDKHK--SCVYWASIGVCDVRPTYMYKHCRLACRVCTPGIKHEGPPCDNKDPDEECDHWAKLGKCASRPSYMMEKCQKSCNACPPS 369          

HSP 3 Score: 91.6633 bits (226), Expect = 1.998e-19
Identity = 63/189 (33.33%), Postives = 86/189 (45.50%), Query Frame = -1
Query:  469 TCDLWKKAGYCHIYPKFMLSHCLKSCGQCSEYSE--------CKNLYNNIVCDKWAAEGECLKNSKFMIQLCLKSCGRCYDLKNLKVNRTNSDGCENKYGDWSCEAWKQVGECERNPIFMNDQCSKSCGTCFKSTATSTSGPLRMSSVCKNFYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSCQNLK 1011
            +C LW K G+C I   FM + C KSC  C + +E        CK+      C KWA+ G C   + +M++ C +SCG C D       R  S  CE+K+   SC  W  +G C+  P +M   C  +C  C       T G       C N   ++ CD W K G C S   +M   C +SCN+C   K
Sbjct:  199 SCKLWAKQGFCEIRKDFMPTECPKSCKICQDKNERTTTSMPVCKD--RTSWCRKWASYGYCHTKAVYMLKSCKRSCGICED------PRDPSLPCEDKHK--SCVYWASIGVCDVRPTYMYKHCRLACRVC-------TPGIKHEGPPCDNKDPDEECDHWAKLGKCASRPSYMMEKCQKSCNACPPSK 370          

HSP 4 Score: 88.9669 bits (219), Expect = 1.392e-18
Identity = 50/162 (30.86%), Postives = 73/162 (45.06%), Query Frame = -1
Query: 2494 CEKWSNAGECSKNPKFMLENCAKSCNNCKTSQQNDSNCVNI--NKNSECDKWSQMGECSKNPNYMLVNCAKSCNYCKFNKDLQKNCVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSCDS-----ERECLNTHNDAECSKWSSMGECTKNPKYMLVNC 2958
            C+ W+  G C     FM   C KSC  C+   +  +  + +  ++ S C KW+  G C     YML +C +SC  C+  +D    C + HK   C  W+  G C   P YM  +C  +C+ C          C N   D EC  W+ +G+C   P YM+  C
Sbjct:  200 CKLWAKQGFCEIRKDFMPTECPKSCKICQDKNERTTTSMPVCKDRTSWCRKWASYGYCHTKAVYMLKSCKRSCGICEDPRDPSLPCEDKHK--SCVYWASIGVCDVRPTYMYKHCRLACRVCTPGIKHEGPPCDNKDPDEECDHWAKLGKCASRPSYMMEKC 359          

HSP 5 Score: 86.6557 bits (213), Expect = 1.019e-17
Identity = 50/171 (29.24%), Postives = 79/171 (46.20%), Query Frame = -1
Query: 1381 DSNENCNTWQTAGECEKNPNYMLVNCAKACKTCQKDDAKNVEKK--CDDVYSDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTCDQLKNNQTMCQNAYNDAICTKWKNMGECTKNPNFMLIQCKESCGKCEKLPKNTN--CINLDNDKNCEKWAGENECTKNSKYMLERCFK 1881
            D   +C  W   G CE   ++M   C K+CK CQ  + +       C D  S   C KW + G C  +++ M   C ++CG C+  ++    C++ +    C  W ++G C   P +M   C+ +C  C    K+    C N D D+ C+ WA   +C     YM+E+C K
Sbjct:  195 DKLYSCKLWAKQGFCEIRKDFMPTECPKSCKICQDKNERTTTSMPVCKDRTS--WCRKWASYGYCHTKAVYMLKSCKRSCGICEDPRDPSLPCEDKHKS--CVYWASIGVCDVRPTYMYKHCRLACRVCTPGIKHEGPPCDNKDPDEECDHWAKLGKCASRPSYMMEKCQK 361          

HSP 6 Score: 85.1149 bits (209), Expect = 3.301e-17
Identity = 54/173 (31.21%), Postives = 74/173 (42.77%), Query Frame = -1
Query: 1783 CRKWSEKGECSKNPNFMLENCAKSCNVCKFNNETKGCRNL---DPNSDCESWKQAGECLNNEKYMKVQCGKSCGRCN--AKTYVDCKDIYQEDSCKAWKDLGECFKNPVFMLSKCSQTCGSCDMEKNPVVVE---TCKNIDSNENCNTWQTAGECEKNPNYMLVNCAKACKTC 2277
            C+ W+++G C    +FM   C KSC +C+  NE          D  S C  W   G C     YM   C +SCG C       + C+D  +  SC  W  +G C   P +M   C   C  C     P +      C N D +E C+ W   G+C   P+YM+  C K+C  C
Sbjct:  200 CKLWAKQGFCEIRKDFMPTECPKSCKICQDKNERTTTSMPVCKDRTSWCRKWASYGYCHTKAVYMLKSCKRSCGICEDPRDPSLPCED--KHKSCVYWASIGVCDVRPTYMYKHCRLACRVC----TPGIKHEGPPCDNKDPDEECDHWAKLGKCASRPSYMMEKCQKSCNAC 366          

HSP 7 Score: 84.7297 bits (208), Expect = 3.888e-17
Identity = 58/210 (27.62%), Postives = 83/210 (39.52%), Query Frame = -1
Query: 2059 CESWSKRGECQKNPKYMLVNCAKSCKSCDSERECLNTHNDAECSKWSSMGECTKNPKYMLVNCAXXXXXXXXXNTDKGTCSNINSDKECENWSKRGECAKNPKYMLINCAKSCNSCESATQLPTACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVCK--FNNETKGCRNLDPNSDCESWKQAGECLNNEKYMKVQCGKSCGRC 2682
            C+ W+K+G C+    +M   C KSCK C  + E   T          SM  C     +                              C  W+  G C     YML +C +SC  CE        C + HK+   C  W+  G C   P +M ++C  +C VC     +E   C N DP+ +C+ W + G+C +   YM  +C KSC  C
Sbjct:  200 CKLWAKQGFCEIRKDFMPTECPKSCKICQDKNERTTT----------SMPVCKDRTSW------------------------------CRKWASYGYCHTKAVYMLKSCKRSCGICEDPRDPSLPCEDKHKS---CVYWASIGVCDVRPTYMYKHCRLACRVCTPGIKHEGPPCDNKDPDEECDHWAKLGKCASRPSYMMEKCQKSCNAC 366          

HSP 8 Score: 84.3445 bits (207), Expect = 4.622e-17
Identity = 63/187 (33.69%), Postives = 86/187 (45.99%), Query Frame = -1
Query: 1219 NVEKKCDDVYSD--VSCLKWKAEGLCEKQSLVMKVKCSKTCGTCDQLKNNQTMCQNAY---NDAICTKWKNMGECTKNPNFMLIQCKESCGKCEKLPKNTNCINLDNDKNCEKWAGENECTKNSKYMLERCFKXXXXXXXXXSAKTPSEVCSNLANDTDCESWSKAGHCEKNVSYMLKFCAKSCKAC 1764
            N+  KC  +  D   SC  W  +G CE +   M  +C K+C  C Q KN +T           + C KW + G C     +ML  CK SCG CE  P++ +    D  K+C  WA    C     YM + C  +C  C+     + P   C N   D +C+ W+K G C    SYM++ C KSC AC
Sbjct:  184 NLMYKCSTICRDKLYSCKLWAKQGFCEIRKDFMPTECPKSCKIC-QDKNERTTTSMPVCKDRTSWCRKWASYGYCHTKAVYMLKSCKRSCGICED-PRDPSLPCEDKHKSCVYWASIGVCDVRPTYMYKHCRLACRVCTPGIKHEGPP--CDNKDPDEECDHWAKLGKCASRPSYMMEKCQKSCNAC 366          

HSP 9 Score: 82.4185 bits (202), Expect = 2.416e-16
Identity = 52/178 (29.21%), Postives = 84/178 (47.19%), Query Frame = -1
Query: 2725 EKDNNCEQLKIRGECLRNVSYMRVNCAKTCFNC---NASVVDKPCVNSYMDSECDKWSKLGECQKNPNYMLLNCAKSCNNCDLIPSDGKDCFNIYRNDKCEKWSNAGECSKNPKFMLENCAKSCNNCKTSQQNDSN-CVNINKNSECDKWSQMGECSKNPNYMLVNCAKSCNYCKFNK 3246
            +K  +C+    +G C     +M   C K+C  C   N        V     S C KW+  G C     YML +C +SC  C+        C +  ++  C  W++ G C   P +M ++C  +C  C    +++   C N + + ECD W+++G+C+  P+YM+  C KSCN C  +K
Sbjct:  195 DKLYSCKLWAKQGFCEIRKDFMPTECPKSCKICQDKNERTTTSMPVCKDRTSWCRKWASYGYCHTKAVYMLKSCKRSCGICEDPRDPSLPCED--KHKSCVYWASIGVCDVRPTYMYKHCRLACRVCTPGIKHEGPPCDNKDPDEECDHWAKLGKCASRPSYMMEKCQKSCNACPPSK 370          

HSP 10 Score: 81.6481 bits (200), Expect = 4.437e-16
Identity = 54/178 (30.34%), Postives = 81/178 (45.51%), Query Frame = -1
Query: 1627 CESWKQAGECLNNEKYMKVQCGKSCGRCNAK------TYVDCKDIYQEDSCKAWKDLGECFKNPVFMLSKCSQTCGSCDMEKNPVVVETCKNIDSNENCNTWQTAGECEKNPNYMLVNCAKACKTCQKDDAKNVEKKCDDVYSDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTCDQLK 2142
            C+ W + G C   + +M  +C KSC  C  K      +   CKD  +   C+ W   G C    V+ML  C ++CG C+  ++P +   C+  D +++C  W + G C+  P YM  +C  AC+ C     K+    CD+   D  C  W   G C  +   M  KC K+C  C   K
Sbjct:  200 CKLWAKQGFCEIRKDFMPTECPKSCKICQDKNERTTTSMPVCKD--RTSWCRKWASYGYCHTKAVYMLKSCKRSCGICEDPRDPSL--PCE--DKHKSCVYWASIGVCDVRPTYMYKHCRLACRVCTPG-IKHEGPPCDNKDPDEECDHWAKLGKCASRPSYMMEKCQKSCNACPPSK 370          

HSP 11 Score: 80.8777 bits (198), Expect = 8.217e-16
Identity = 54/184 (29.35%), Postives = 83/184 (45.11%), Query Frame = -1
Query: 1915 CSNINSDK--ECENWSKRGECAKNPKYMLINCAKSCNSCESATQLPTACTNIHKNEDE-CRKWSEKGECSKNPNFMLENCAKSCNVCK-FNNETKGCRNLDPNSDCESWKQAGECLNNEKYMKVQCGKSCGRCNAKTYVD---CKDIYQEDSCKAWKDLGECFKNPVFMLSKCSQTCGSCDMEK 2445
            CS I  DK   C+ W+K+G C     +M   C KSC  C+   +  T    + K+    CRKW+  G C     +ML++C +SC +C+   + +  C   D +  C  W   G C     YM   C  +C  C      +   C +   ++ C  W  LG+C   P +M+ KC ++C +C   K
Sbjct:  189 CSTICRDKLYSCKLWAKQGFCEIRKDFMPTECPKSCKICQDKNERTTTSMPVCKDRTSWCRKWASYGYCHTKAVYMLKSCKRSCGICEDPRDPSLPCE--DKHKSCVYWASIGVCDVRPTYMYKHCRLACRVCTPGIKHEGPPCDNKDPDEECDHWAKLGKCASRPSYMMEKCQKSCNACPPSK 370          

HSP 12 Score: 78.1814 bits (191), Expect = 6.287e-15
Identity = 67/215 (31.16%), Postives = 97/215 (45.12%), Query Frame = -1
Query:  160 DLKNLKVNRTN--SDGCENKYGDWSCEAWKQVGECERNPIFMNDQCSKSCGTCF-KSTATSTSGPLRMSSVCKNFYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSCQNLKFSLKVKCQNILTKEKCLKLKKAGECEKNSKQMAELCAYTCHKCNLSFVKPMEINQNPTKMRSSKFKCDNRAGDFQCSYWARQKQCELNASYMRLFCQKSCGAC 795
            D   LKVN     S  C +K   +SC+ W + G CE    FM  +C KSC  C  K+  T+TS P     VCK+      C +W   G C + + +M  +C RSC  C++ +    + C++    + C+     G C+     M + C   C  C      P   ++ P         CDN+  D +C +WA+  +C    SYM   CQKSC AC
Sbjct:  177 DRDVLKVNLMYKCSTICRDKL--YSCKLWAKQGFCEIRKDFMPTECPKSCKICQDKNERTTTSMP-----VCKD--RTSWCRKWASYGYCHTKAVYMLKSCKRSCGICEDPR-DPSLPCED--KHKSCVYWASIGVCDVRPTYMYKHCRLACRVCT-----PGIKHEGPP--------CDNKDPDEECDHWAKLGKCASRPSYMMEKCQKSCNAC 366          

HSP 13 Score: 76.6406 bits (187), Expect = 1.711e-14
Identity = 58/178 (32.58%), Postives = 82/178 (46.07%), Query Frame = -1
Query: 1060 CTKWKNMGECTKNPNFMLIQCKESCGKCE-KLPKNTNCINLDNDKN--CEKWAGENECTKNSKYMLERCFKXXXXXXXXXSAKTPSEVCSNLANDTDCESWSKAGHCEKNVSYMLKFCAKSCKACNRLITTSLPSINCVNKLNDSTCETLKILGQCEKNSIFMIEKCGKSCGSCRPAK 1584
            C  W   G C    +FM  +C +SC  C+ K  + T  + +  D+   C KWA    C   + YML+ C +SC  C      + PS  C +      C  W+  G C+   +YM K C  +C+ C   I    P   C NK  D  C+    LG+C     +M+EKC KSC +C P+K
Sbjct:  200 CKLWAKQGFCEIRKDFMPTECPKSCKICQDKNERTTTSMPVCKDRTSWCRKWASYGYCHTKAVYMLKSCKRSCGICED---PRDPSLPCED--KHKSCVYWASIGVCDVRPTYMYKHCRLACRVCTPGIKHEGPP--CDNKDPDEECDHWAKLGKCASRPSYMMEKCQKSCNACPPSK 370          

HSP 14 Score: 72.4034 bits (176), Expect = 3.837e-13
Identity = 62/185 (33.51%), Postives = 92/185 (49.73%), Query Frame = -1
Query: 3013 SCYVWSQTGECESNRKYMEXXXXXXXXXXXXXKMQTTTTPSLSVITMPSNETLCQNKYGDKYCEEFKSKGECTKNPDFMFIQCAKSCSKCKETKPGNDSL-CKNIEKDNNCEQLKIRGECLRNVSYMRVNCAKTCFNCNASVVDK--PCVNSYMDSECDKWSKLGECQKNPNYMLLNCAKSCNNC 3558
            SC +W++ G CE  + +M   C KSCK C     +TTT+       MP    +C+++    +C ++ S G C     +M   C +SC  C++  P + SL C++  K  +C      G C    +YM  +C   C  C   +  +  PC N   D ECD W+KLG+C   P+YM+  C KSCN C
Sbjct:  199 SCKLWAKQGFCEIRKDFMPTECPKSCKICQDKNERTTTS-------MP----VCKDR--TSWCRKWASYGYCHTKAVYMLKSCKRSCGICED--PRDPSLPCED--KHKSCVYWASIGVCDVRPTYMYKHCRLACRVCTPGIKHEGPPCDNKDPDEECDHWAKLGKCASRPSYMMEKCQKSCNAC 366          

HSP 15 Score: 68.5514 bits (166), Expect = 6.649e-12
Identity = 57/181 (31.49%), Postives = 78/181 (43.09%), Query Frame = -1
Query:  925 DNDKNCEKWAGENECTKNSKYMLERCFKXXXXXXXXXSAKTPS-EVCSNLANDTDCESWSKAGHCEKNVSYMLKFCAKSCKACNRLITTSLPSINCVNKLNDSTCETLKILGQCEKNSIFMIEKCGKSCGSCRPAKEKTFENKTCLNLYKDDTCDLWKKAGYCHIYPKFMLSHCLKSCGQC 1464
            D   +C+ WA +  C     +M   C KSC  C   +   T S  VC +    + C  W+  G+C     YMLK C +SC  C      SLP   C +K    +C     +G C+    +M + C  +C  C P  +   E   C N   D+ CD W K G C   P +M+  C KSC  C
Sbjct:  195 DKLYSCKLWAKQGFCEIRKDFMPTECPKSCKICQDKNERTTTSMPVCKD--RTSWCRKWASYGYCHTKAVYMLKSCKRSCGICEDPRDPSLP---CEDK--HKSCVYWASIGVCDVRPTYMYKHCRLACRVCTPGIKH--EGPPCDNKDPDEECDHWAKLGKCASRPSYMMEKCQKSCNAC 366          

HSP 16 Score: 59.3066 bits (142), Expect = 7.427e-9
Identity = 57/202 (28.22%), Postives = 85/202 (42.08%), Query Frame = -1
Query:   22 SSVCKN-FYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSCQN----LKFSLKVKCQNILTKEKCLKLKKAGECEKNSKQMAELCAYTCHKCNLSFVKPMEINQNPTKMRSSKFKCDNRAGDFQCSYWARQKQCELNASYMRLFCQKSCGACLMEKPG----QVSCVDKFATMKCFSWSMRGECDRNGKWMTENCAKSCLVC 600
            S++C++  YS KL   W K G C+   DFM   C +SC  CQ+       S+ V C++      C K    G C   +  M + C  +C  C           ++P   R     C+++     C YWA    C++  +YM   C+ +C  C    PG       C +K    +C  W+  G+C     +M E C KSC  C
Sbjct:  190 STICRDKLYSCKL---WAKQGFCEIRKDFMPTECPKSCKICQDKNERTTTSMPV-CKD--RTSWCRKWASYGYCHTKAVYMLKSCKRSCGIC-----------EDP---RDPSLPCEDKHK--SCVYWASIGVCDVRPTYMYKHCRLACRVC---TPGIKHEGPPCDNKDPDEECDHWAKLGKCASRPSYMMEKCQKSCNAC 366          

HSP 17 Score: 58.151 bits (139), Expect = 1.328e-8
Identity = 56/214 (26.17%), Postives = 85/214 (39.72%), Query Frame = -1
Query: 3277 LCDKSTTTLAPKIECKNIYGDD--KCNLWEAVGDCQNNKLFMELNCAKACGKCGTXXXXXXXXXXXXXXXDVYEENSCLSWADANECTKNPNFMHKMCKKSCKLCITKEPEKCTNQYDNLSCYVWSQTGECESNRKYMEXXXXXXXXXXXXXKMQTTTTPSLSVITMPSNETLCQNKYGDKYCEEFKSKGECTKNPDFMFIQCAKSCSKCKETK 3912
            L D+    +    +C  I  D    C LW   G C+  K FM   C K+C  C   ++           +  +    C  WA    C     +M K CK+SC +C          +  + SC  W+  G C+    YM K+C+ +C+           TP +     P     C NK  D+ C+ +   G+C   P +M  +C KSC+ C  +K
Sbjct:  175 LTDRDVLKVNLMYKCSTICRDKLYSCKLWAKQGFCEIRKDFMPTECPKSCKICQDKNERTTTSMPVCKDRTSW----CRKWASYGYCHTKAVYMLKSCKRSCGICEDPRDPSLPCEDKHKSCVYWASIGVCDVRPTYMYKHCRLACR---------VCTPGIKHEGPP-----CDNKDPDEECDHWAKLGKCASRPSYMMEKCQKSCNACPPSK 370          

HSP 18 Score: 55.0694 bits (131), Expect = 1.348e-7
Identity = 52/189 (27.51%), Postives = 72/189 (38.10%), Query Frame = -1
Query: 3139 SCLSWADANECTKNPNFMHKMCKKSCKLCITKEPEKCTNQY---DNLS-CYVWSQTGECESNRKYMEXXXXXXXXXXXXXKMQTTTTPSLSVITMPSNETL-CQNKYGDKYCEEFKSKGECTKNPDFMFIQCAKSCSKCKETKPGNDSLCKNIEKDNNCEQLKIRGECLRNVSYMRVNCAKTCFNCNAS 3690
            SC  WA    C    +FM   C KSCK+C  K     T+     D  S C  W+  G C +   YM                  +   S  +   P + +L C++K+  K C  + S G C   P +M+  C  +C  C          C N + D  C+     G+C    SYM   C K+C  C  S
Sbjct:  199 SCKLWAKQGFCEIRKDFMPTECPKSCKICQDKNERTTTSMPVCKDRTSWCRKWASYGYCHTKAVYM----------------LKSCKRSCGICEDPRDPSLPCEDKH--KSCVYWASIGVCDVRPTYMYKHCRLACRVCTPGIKHEGPPCDNKDPDEECDHWAKLGKCASRPSYMMEKCQKSCNACPPS 369          
BLAST of SMED30016458 vs. Ensembl Nematostella
Match: EDO43132 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZN5])

HSP 1 Score: 114.775 bits (286), Expect = 7.057e-28
Identity = 89/305 (29.18%), Postives = 138/305 (45.25%), Query Frame = -1
Query: 3907 SSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQN-CYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSFINEKGEPSIQVINESMIHLLLEVHEKDLSFLDAKVVNLYYKCADRCFQNVTCSAGGYIDQYCQCHTPESFESRRCQDKNDESWCIEQQKKGHCELRNKYMSFNCRKTCEKCFKHRNRFVIPIKECKNL--EKNETCDAWEKRGECKKNPRYMKFNCKQSCGLC 4812
            S +   I  ++  TC+ F +KR ++++++++   Q+ C S+VG+    EQ +N+   GC++V           GL LHE GHAIG  HEH R  RD+ + ++ +N+Q    D FKK   S+     +P+DL SIMHY   +F       +   +     + +  V+ ++ S  D K +N+ Y C       V C                      C+DK  +  C      G C   N +MS NC K+C  C               NL  +K   C +W   GEC  N ++M  NCK+SC +C
Sbjct:   13 SQIYKGIEHYHKYTCLRF-VKRTTEKDYIRVMKPQSGCNSMVGV-MGGEQILNMGD-GCQYV-----------GLVLHEFGHAIGYFHEHNRPDRDNTINVLWDNVQPWFKDAFKKYQFSEANTQGLPYDLTSIMHYENTAFAKAGFCKTTITVKSDPTYEISPVYLREFSPQDIKKINMLYGCTTNQLPPVACV---------------------CEDKYKDR-CPGWASSGECSNNNAWMSNNCPKSCRTCGD------------PNLCEDKYPKCSSWASTGECSANFQWMHQNCKKSCRVC 269          

HSP 2 Score: 55.8398 bits (133), Expect = 5.029e-8
Identity = 32/76 (42.11%), Postives = 41/76 (53.95%), Query Frame = -1
Query: 2737 DKCEKWSNAGECSKNPKFMLENCAKSCNNCKTSQQNDSNCVNINKNSECDKWSQMGECSKNPNYMLVNCAKSCNYC 2964
            D+C  W+++GECS N  +M  NC KSC  C      D N    +K  +C  W+  GECS N  +M  NC KSC  C
Sbjct:  200 DRCPGWASSGECSNNNAWMSNNCPKSCRTC-----GDPNLCE-DKYPKCSSWASTGECSANFQWMHQNCKKSCRVC 269          

HSP 3 Score: 55.0694 bits (131), Expect = 9.216e-8
Identity = 37/98 (37.76%), Postives = 43/98 (43.88%), Query Frame = -1
Query: 2053 SCESATQLPTACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVCKFNNETKGCRNL--DPNSDCESWKQAGECLNNEKYMKVQCGKSCGRCNA 2340
             C +    P AC    K +D C  W+  GECS N  +M  NC KSC  C       G  NL  D    C SW   GEC  N ++M   C KSC  C  
Sbjct:  181 GCTTNQLPPVACVCEDKYKDRCPGWASSGECSNNNAWMSNNCPKSCRTC-------GDPNLCEDKYPKCSSWASTGECSANFQWMHQNCKKSCRVCGG 271          

HSP 4 Score: 53.5286 bits (127), Expect = 2.421e-7
Identity = 30/76 (39.47%), Postives = 40/76 (52.63%), Query Frame = -1
Query: 2194 ECENWSKRGECAKNPKYMLINCAKSCNSCESATQLPTACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVC 2421
             C  W+  GEC+ N  +M  NC KSC +C      P  C + +    +C  W+  GECS N  +M +NC KSC VC
Sbjct:  201 RCPGWASSGECSNNNAWMSNNCPKSCRTCGD----PNLCEDKYP---KCSSWASTGECSANFQWMHQNCKKSCRVC 269          

HSP 5 Score: 53.5286 bits (127), Expect = 2.626e-7
Identity = 35/89 (39.33%), Postives = 46/89 (51.69%), Query Frame = -1
Query: 2857 CVNSYMDSECDKWSKLGECQKNPNYMLLNCAKSCNNCDLIPSDGKDCFNIYRNDKCEKWSNAGECSKNPKFMLENCAKSCNNCKTSQQN 3123
            C + Y D  C  W+  GEC  N  +M  NC KSC  C     D   C + Y   KC  W++ GECS N ++M +NC KSC  C  ++ N
Sbjct:  194 CEDKYKD-RCPGWASSGECSNNNAWMSNNCPKSCRTC----GDPNLCEDKY--PKCSSWASTGECSANFQWMHQNCKKSCRVCGGTRNN 275          

HSP 6 Score: 52.7582 bits (125), Expect = 4.549e-7
Identity = 39/107 (36.45%), Postives = 54/107 (50.47%), Query Frame = -1
Query: 2563 NCKTSQQNDSNCVNINKNSE-CDKWSQMGECSKNPNYMLVNCAKSCNYCKFNKDLQKNCVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSCDSERECLNTHND 2880
             C T+Q     CV  +K  + C  W+  GECS N  +M  NC KSC  C  + +L ++     K  +C SW+  GEC  N ++M  NC KSC+ C   R   +T  D
Sbjct:  181 GCTTNQLPPVACVCEDKYKDRCPGWASSGECSNNNAWMSNNCPKSCRTCG-DPNLCED-----KYPKCSSWASTGECSANFQWMHQNCKKSCRVCGGTRNNTHTKRD 281          

HSP 7 Score: 51.9878 bits (123), Expect = 8.772e-7
Identity = 34/100 (34.00%), Postives = 49/100 (49.00%), Query Frame = -1
Query: 3604 TTTLAPKIEC--KNIYGDDKCNLWEAVGDCQNNKLFMELNCAKACGKCGTXXXXXXXXXXXXXXXDVYEENSCLSWADANECTKNPNFMHKMCKKSCKLC 3897
            TT   P + C  ++ Y  D+C  W + G+C NN  +M  NC K+C  CG  +                +   C SWA   EC+ N  +MH+ CKKSC++C
Sbjct:  183 TTNQLPPVACVCEDKY-KDRCPGWASSGECSNNNAWMSNNCPKSCRTCGDPNLCED------------KYPKCSSWASTGECSANFQWMHQNCKKSCRVC 269          

HSP 8 Score: 50.8322 bits (120), Expect = 1.899e-6
Identity = 28/72 (38.89%), Postives = 41/72 (56.94%), Query Frame = -1
Query: 2494 CVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSCDSERECLNTHNDAECSKWSSMGECTKNPKYMLVNC 2709
            C + +KD  C  W+  GEC  N  +M  NC KSC++C     C + +   +CS W+S GEC+ N ++M  NC
Sbjct:  194 CEDKYKD-RCPGWASSGECSNNNAWMSNNCPKSCRTCGDPNLCEDKY--PKCSSWASTGECSANFQWMHQNC 262          

HSP 9 Score: 50.447 bits (119), Expect = 3.027e-6
Identity = 34/83 (40.96%), Postives = 45/83 (54.22%), Query Frame = -1
Query:   22 CDNRAGDFQCSYWARQKQCELNASYMRLFCQKSCGACLMEKPGQVSCVDKFATMKCFSWSMRGECDRNGKWMTENCAKSCLVC 270
            C+++  D +C  WA   +C  N ++M   C KSC  C    P    C DK+   KC SW+  GEC  N +WM +NC KSC VC
Sbjct:  194 CEDKYKD-RCPGWASSGECSNNNAWMSNNCPKSCRTC--GDPNL--CEDKYP--KCSSWASTGECSANFQWMHQNCKKSCRVC 269          

HSP 10 Score: 49.2914 bits (116), Expect = 6.481e-6
Identity = 31/95 (32.63%), Postives = 44/95 (46.32%), Query Frame = -1
Query:  469 CENKYGDWSCEAWKQVGECERNPIFMNDQCSKSCGTCFKSTATSTSGPLRMSSVCKNFYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSCQNLK 753
            CE+KY D  C  W   GEC  N  +M++ C KSC TC               ++C++ Y    C  W   G+C +N  +M  NC +SC  C   +
Sbjct:  194 CEDKYKD-RCPGWASSGECSNNNAWMSNNCPKSCRTCGD------------PNLCEDKYPK--CSSWASTGECSANFQWMHQNCKKSCRVCGGTR 273          
BLAST of SMED30016458 vs. Ensembl Nematostella
Match: EDO30194 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1H5])

HSP 1 Score: 110.538 bits (275), Expect = 2.117e-27
Identity = 68/204 (33.33%), Postives = 101/204 (49.51%), Query Frame = -1
Query: 4264 QWPDGVIPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQNCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSFINEKGEPSIQVINESMIHLLLEVHEKDLSFLDAKVVNLYYKC 4875
            +WP+G IP+ I       +    ++ AI  W  +TC+ FR KR  D +++K      C+S VG     EQ++++  PGC  V           G  +HE+GHAIG  HE  R  RDDY++I+ ENI  + +D F K  K         +D  SIMHYG   F +  G+P+I++  +           K LS++D   V+  Y C
Sbjct:    3 RWPNGEIPFRIS-TRLPTKFKKEIRKAIRHWRRKTCLRFRNKRADDTDYIKFVYETGCWSYVGRA-GGEQKISVG-PGCEFV-----------GTIIHEIGHAIGFWHEQSRRDRDDYIRIIRENILPDALDQFNKMPKRLMDSMGYAYDFYSIMHYGA-KFFSRNGKPTIKIRKKYRDLDAKIGQRKGLSWIDIAQVHAMYNC 191          
BLAST of SMED30016458 vs. Ensembl Nematostella
Match: EDO42421 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1T1])

HSP 1 Score: 106.301 bits (264), Expect = 7.876e-26
Identity = 73/206 (35.44%), Postives = 105/206 (50.97%), Query Frame = -1
Query: 4261 WPDGVIPYYID-RNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQNCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSFINEKGEPSIQVINESMIHLLLEVHEKD-LSFLDAKVVNLYYKCA 4872
            WP GV+ Y +D R   +   +  L  AI+ +   TC+ FR K  +D ++V I     C S VG     +Q ++L+S GC H            G  +HELGHA+G  HE  R  RDDY+ I+ ENI+      F K++  +      P+D  SIMHYGP  F +  G+P+I           ++  ++D LS +D K VNL YKC+
Sbjct:   12 WPGGVVVYELDPRFERSSRAMEKLTQAISDYEKYTCIRFRKKTANDNDYVYIKDRGGCRSHVGRK-GGKQYLSLSS-GCWHK-----------GTIIHELGHALGFFHEQTRPDRDDYVTILFENIRLGMASNFMKHSAGEVDSLGTPYDYGSIMHYGPKIF-SANGKPTIVAKKPG-----VKFGQRDGLSPIDIKQVNLLYKCS 198          
BLAST of SMED30016458 vs. Ensembl Nematostella
Match: EDO39627 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9K8])

HSP 1 Score: 104.375 bits (259), Expect = 1.735e-24
Identity = 70/220 (31.82%), Postives = 114/220 (51.82%), Query Frame = -1
Query: 4261 TTRSKRAVVVKSADQWPDGVIPYYIDRNAFNEEEVSSLQD-AINTWNFETCVHFRLKRESDRNWVKITGGQNCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSFINEKGEPSIQVINESMIHLLLEVHEKDLSFLDAKVVNLYYKCA 4917
            T  + RA +    + W +GV+PY +D +  +     S+ + AI  +N +TC+ FR +  SD+  +KI  G  C+S VGM     Q+++LA  GC       W      G+ +HE  HA+G  HE  R  RD +++I  ENI+      FKK++ +       P+D  S+MHYG  +F ++ G+P+I      +I        + LS +D K +N++Y+C 
Sbjct:   37 TQLNSRAAI--KTNHWTNGVVPYELDPSISSSSYAVSVINSAIAEYNQKTCIRFRPRVPSDKYGLKIFKGGGCWSYVGMS-MPTQQLSLAG-GC-------W----SKGIVIHEFAHALGFYHEQSRPDRDQFVEIKTENIRDGVASNFKKHSFNYVTTHGTPYDYGSVMHYGAYAF-SKNGKPTIVAKQPGVI----LGQRRGLSDIDTKQINIHYRCG 236          
BLAST of SMED30016458 vs. Ensembl Medaka
Match: ENSORLT00000018637.2 (pep primary_assembly:ASM223467v1:3:32702055:32705063:-1 gene:ENSORLG00000014863.2 transcript:ENSORLT00000018637.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.5893 bits (231), Expect = 2.890e-20
Identity = 61/199 (30.65%), Postives = 100/199 (50.25%), Query Frame = -1
Query: 4264 VIPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQNCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSFINEKGEPSIQVINESMIHLLLEVHEKDLSFLDAKVVNLYYKC 4860
            VIPY I  + ++  EV++++ A+  +N  TC+ F ++R ++ +++ +     CYS +G     +QE++L   GC +            G+  HEL HA+G  HE  RS RD Y++I  +NI   +   F   NK DT + + P+D  SIMHYG  +F    G  +I  I    + +        +S  D   +N+ Y C
Sbjct:   91 VIPYVIS-SQYSRGEVATIEGAMRAFNGRTCIRF-VRRTNEYDFISVVSKNGCYSELGRK-GGQQELSLNRGGCMYS-----------GIIQHELNHALGFQHEQTRSDRDSYVRINWQNIIPASAYNF---NKHDTNNLNTPYDYSSIMHYGRDAFSIAYGRDTITPIPNPNVPI---GQRNGMSRWDITRINVLYNC 269          
BLAST of SMED30016458 vs. Ensembl Medaka
Match: hce (Oryzias latipes protease (hce), mRNA. [Source:RefSeq mRNA;Acc:NM_001201498])

HSP 1 Score: 92.0485 bits (227), Expect = 9.094e-20
Identity = 62/199 (31.16%), Postives = 100/199 (50.25%), Query Frame = -1
Query: 4264 VIPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQNCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSFINEKGEPSIQVINESMIHLLLEVHEKDLSFLDAKVVNLYYKC 4860
            VIPY I  + ++  EV++++ A+  +N +TC+ F ++R ++ +++ +     CYS +G      QE+++   GC +            G+  HEL HA+G  HE  RS RD Y++I  ENI   +   F   NK DT + + P+D  SIMHYG  +F    G  SI  I    + +        +S  D   +N+ Y C
Sbjct:  100 VIPYVIS-SEYSGGEVATIEGAMRAFNGKTCIRF-VRRTNEYDFISVVSKTGCYSELGRK-GGLQELSINRGGCMYS-----------GIIQHELNHALGFQHEQTRSDRDSYVRINWENIIPASAYNF---NKHDTNNLNTPYDYSSIMHYGRDAFSIAYGRDSITPIPNPNVPI---GQRNGMSRWDITRINVLYNC 278          
BLAST of SMED30016458 vs. Ensembl Medaka
Match: ENSORLT00000018649.2 (pep primary_assembly:ASM223467v1:3:32704054:32707947:-1 gene:ENSORLG00000014873.2 transcript:ENSORLT00000018649.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.5817 bits (218), Expect = 2.765e-18
Identity = 53/157 (33.76%), Postives = 86/157 (54.78%), Query Frame = -1
Query: 4390 VIPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQNCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSF 4860
            VIPY I  + ++  EV++++ A+  +N  TC+ F ++R ++ +++ +     CYS +G     +QE++L   GC +            G+  HEL HA+G  HE  RS RD Y++I  +NI   +   F   NK DT + + P+D  SIMHYG  +F
Sbjct:  100 VIPYVIS-SQYSRGEVATIEGAMRAFNGRTCIRF-VRRTNEYDFISVVSKNGCYSELGRK-GGQQELSLNRGGCMYS-----------GIIQHELNHALGFQHEQTRSDRDSYVRINWQNIIPASAYNF---NKHDTNNLNTPYDYSSIMHYGRDAF 239          
BLAST of SMED30016458 vs. Ensembl Medaka
Match: tll1 (tolloid like 1 [Source:NCBI gene;Acc:101160961])

HSP 1 Score: 91.2781 bits (225), Expect = 6.684e-18
Identity = 57/177 (32.20%), Postives = 81/177 (45.76%), Query Frame = -1
Query: 4390 GTTRSKRAVVVKSADQWPDGVIPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQNCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSF 4920
            G +R  RA   ++   WP GVIPY I  N F   + +  + A+  W  +TCV F  K + +   V       C S VG      Q +++    C            ++G+ +HELGH IG  HEH R  RDD++ I+ +NIQ      F K    +      P+D  SIMHY   +F
Sbjct:   52 GKSRIPRAATSRAERIWPGGVIPYVIGGN-FTGSQRAMFKQAMRHWEKQTCVTFIEKTDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGK-NCD-----------KFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRDNIQPGQEYNFLKMEPGEVNSLGEPYDFDSIMHYARNTF 215          
BLAST of SMED30016458 vs. Ensembl Medaka
Match: tll1 (tolloid like 1 [Source:NCBI gene;Acc:101160961])

HSP 1 Score: 90.8929 bits (224), Expect = 8.416e-18
Identity = 57/177 (32.20%), Postives = 81/177 (45.76%), Query Frame = -1
Query: 4390 GTTRSKRAVVVKSADQWPDGVIPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQNCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSF 4920
            G +R  RA   ++   WP GVIPY I  N F   + +  + A+  W  +TCV F  K + +   V       C S VG      Q +++    C            ++G+ +HELGH IG  HEH R  RDD++ I+ +NIQ      F K    +      P+D  SIMHY   +F
Sbjct:  151 GKSRIPRAATSRAERIWPGGVIPYVIGGN-FTGSQRAMFKQAMRHWEKQTCVTFIEKTDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGK-NCD-----------KFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRDNIQPGQEYNFLKMEPGEVNSLGEPYDFDSIMHYARNTF 314          
BLAST of SMED30016458 vs. Planmine SMEST
Match: SMESG000074522.1 (SMESG000074522.1)

HSP 1 Score: 2358.18 bits (6110), Expect = 0.000e+0
Identity = 1259/1304 (96.55%), Postives = 1260/1304 (96.63%), Query Frame = -1
Query:   10 MELNCAKACGKCGTXXXXXXXXXXXXXXXDVYEENSCLSWADANECTKNPNFMHKMCKKSCKLCITKEPEKCTNQYDNLSCYVWSQTGECESNRKYMEXXXXXXXXXXXXXKMQTTTTPSLSVITMPSNETLCQNKYGDKYCEEFKSKGECTKNPDFMFIQCAKSCSKCKETKPGNDSLCKNIEKDNNCEQLKIRGECLRNVSYMRVNCAKTCFNCNASVVDKPCVNSYMDSECDKWSKLGECQKNPNYMLLNCAKSCNNCDLIPSDGKDCFNIYRNDKCEKWSNAGECSKNPKFMLENCAKSCNNCKTSQQNDSNCVNINKNSECDKWSQMGECSKNPNYMLVNCAKSCNYCKFNKDLQKNCVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSCDS------------------------------------------ERECLNTHNDAECSKWSSMGECTKNPKYMLVNCAXXXXXXXXXNTDKGTCSNINSDKECENWSKRGECAKNPKYMLINCAKSCNSCESATQLPTACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVCKFNNETKGCRNLDPNSDCESWKQAGECLNNEKYMKVQCGKSCGRCNAKTYVDCKDIYQEDSCKAWKDLGECFKNPVFMLSKCSQTCGSCDMEKNPVVVETCKNIDSNENCNTWQTAGECEKNPNYMLVNCAKACKTCQKDDAKNVEKKCDDVYSDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTCDQLKNNQTMCQNAYNDAICTKWKNMGECTKNPNFMLIQCKESCGKCEKLPKNTNCINLDNDKNCEKWAGENECTKNSKYMLERCFKXXXXXXXXXSAKTPSEVCSNLANDTDCESWSKAGHCEKNVSYMLKFCAKSCKACNRLITTSLPSINCVNKLNDSTCETLKILGQCEKNSIFMIEKCGKSCGSCRPAKEKTFENKTCLNLYKDDTCDLWKKAGYCHIYPKFMLSHCLKSCGQCSEYSECKNLYNNIVCDKWAAEGECLKNSKFMIQLCLKSCGRCYDLKNLKVNRTNSDGCENKYGDWSCEAWKQVGECERNPIFMNDQCSKSCGTCFKSTATSTSGPLRMSSVCKNFYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSCQNLKFSLKVKCQNILTKEKCLKLKKAGECEKNSKQMAELCAYTCHKCNLSFVKPMEINQNPTKMRSSKFKCDNRAGDFQCSYWARQKQCELNASYMRLFCQKSCGACLMEKPGQVSCVDKFATMKCFSWSMRGECDRNGKWMTENCAKSCLVCQNNY 3795
            MELNCAKACGKCGTDSDGFLDPDKDDDCKDVYEENSCLSWADANECTKNPNFMHKMCKKSCKLCITKEPEKCTNQYDNLSCYVWSQTGECESNRKYMEKNCKKSCKFCGGSKMQTTTTPSLSVITMPSNETLCQNKYGDKYCEEFKSKGECTKNPDFMFIQCAKSCSKCKETKPGNDSLCKNIEKDNNCEQLKIRGECLRNVSYMRVNCAKTCFNCNAS+VDKPCVNSYMDSECDKWSKLGECQKNPNYMLLNCAKSCNNCDLIPSDGKDCFNIYRNDKCEKWSNAGECSKNPKFMLENCAKSCNNCKTSQQNDSNCVNINKNSECDKWSQMGECSKNPNYMLVNCAKSCNYCKFNKDLQKNCVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSCDS                                          ERECLNTHNDAECSKWSSMGECTKNPKYMLVNCAKSCNSCKSSNTDKGTCSNINSDKECENWSKRGECAKNPKYMLINCAKSCNSCESATQLPTACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVCKFNNETKGCRNLDPNSDCESWKQAGECLNNEKYMKVQCGKSCGRCNAKTYVDCKDIYQEDSCKAWKDLGECFKNPVFMLSKCSQTCGSCDMEKNPVVVETCKNIDSNENCNTWQTAGECEKNPNYMLVNCAKACKTCQKDDAKNVEKKCDDVYSDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTCDQLKNNQTMCQNAYNDAICTKWKNMGECTKNPNFMLIQCKESCGKCEKLPKNTNCINLDNDKNCEKWAGENECTKNSKYMLERCFKSCNNCSSSSSAKTPSEVCSNLANDTDCESWSKAGHCEKNVSYMLKFCAKSCKACNRLITTSLPSINCVNKLNDSTCETLKILGQCEKNSIFMIEKCGKSCGSCRPAKEKT ENKTCLNLYKDD CDLWKKAGYCHIYPKFMLSHCLKSCGQCSEYSECKNLYNNIVCDKWAAEGECLKNSKFMIQLCLKSCGRCYDLKNLKVNRTNSDGCENKYGDWSCEAWKQVGECERNPIFMNDQCSKSCGTCFKSTATSTSGPLRMSSVCKNFYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSCQNLKFSLKVKCQNILTKEKCLKLKKAGECEKNSKQMAELCAYTCHKCNLSFVKPMEINQNPTKMRSSKFKCDNRAGDFQCSYWARQKQCELNASYMRLFCQKSCGACLMEKPGQVSCVDKFATMKCFSWSMRGECDRNGKWMTENCAKSCLVCQNNY
Sbjct:    1 MELNCAKACGKCGTDSDGFLDPDKDDDCKDVYEENSCLSWADANECTKNPNFMHKMCKKSCKLCITKEPEKCTNQYDNLSCYVWSQTGECESNRKYMEKNCKKSCKFCGGSKMQTTTTPSLSVITMPSNETLCQNKYGDKYCEEFKSKGECTKNPDFMFIQCAKSCSKCKETKPGNDSLCKNIEKDNNCEQLKIRGECLRNVSYMRVNCAKTCFNCNASIVDKPCVNSYMDSECDKWSKLGECQKNPNYMLLNCAKSCNNCDLIPSDGKDCFNIYRNDKCEKWSNAGECSKNPKFMLENCAKSCNNCKTSQQNDSNCVNINKNSECDKWSQMGECSKNPNYMLVNCAKSCNYCKFNKDLQKNCVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSCDSDRECVNTHNDAECNKWSSMGECQKNPKYMLVNCAKSCKSCDSERECLNTHNDAECSKWSSMGECTKNPKYMLVNCAKSCNSCKSSNTDKGTCSNINSDKECENWSKRGECAKNPKYMLINCAKSCNSCESATQLPTACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVCKFNNETKGCRNLDPNSDCESWKQAGECLNNEKYMKVQCGKSCGRCNAKTYVDCKDIYQEDSCKAWKDLGECFKNPVFMLSKCSQTCGSCDMEKNPVVVETCKNIDSNENCNTWQTAGECEKNPNYMLVNCAKACKTCQKDDAKNVEKKCDDVYSDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTCDQLKNNQTMCQNAYNDAICTKWKNMGECTKNPNFMLIQCKESCGKCEKLPKNTNCINLDNDKNCEKWAGENECTKNSKYMLERCFKSCNNCSSSSSAKTPSEVCSNLANDTDCESWSKAGHCEKNVSYMLKFCAKSCKACNRLITTSLPSINCVNKLNDSTCETLKILGQCEKNSIFMIEKCGKSCGSCRPAKEKTSENKTCLNLYKDDACDLWKKAGYCHIYPKFMLSHCLKSCGQCSEYSECKNLYNNIVCDKWAAEGECLKNSKFMIQLCLKSCGRCYDLKNLKVNRTNSDGCENKYGDWSCEAWKQVGECERNPIFMNDQCSKSCGTCFKSTATSTSGPLRMSSVCKNFYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSCQNLKFSLKVKCQNILTKEKCLKLKKAGECEKNSKQMAELCAYTCHKCNLSFVKPMEINQNPTKMRSSKFKCDNRAGDFQCSYWARQKQCELNASYMRLFCQKSCGACLMEKPGQVSCVDKFATMKCFSWSMRGECDRNGKWMTENCAKSCLVCQNNY 1304          

HSP 2 Score: 738.799 bits (1906), Expect = 0.000e+0
Identity = 524/1333 (39.31%), Postives = 719/1333 (53.94%), Query Frame = -1
Query:  328 DESWCIEQQKKGHCELRNKYMSFNCRKTCEKCFKHRNRFVIPIKECKNLEKNETCDAWEKRGECKKNPRYMKFNCKQSCGLC--DKSTTTLAPKIE----------CKNIYGDDKCNLWEAVGDCQNNKLFMELNCAKACGKCGTXXXXXXXXXXXXXXXDVYEENSCLSWADANECTKNPNFMHKMCKKSCKLC---ITKEPEKCTNQYDNLSCYVWSQTGECESNRKYMEXXXXXXXXXXXXXKMQTTTTPSLSVITMPSNETLCQNKYGDKYCEEFKSKGECTKNPDFMFIQCAKSCSKCKETKPGNDSLCKNIEKDNNCEQLKIRGECLRNVSYMRVNCAKTCFNCNASV-VDKPCVNSYMDSECDKWSKLGECQKNPNYMLLNCAKSCNNCDLIPSDGKDCFNIYRNDKCEKWSNAGECSKNPKFMLENCAKSCNNCKTSQQNDSNCVNINKNSECDKWSQMGECSKNPNYMLVNCAKSCNYCKFNKDLQKNCVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSCDSERE----CLNTH-NDAECSKWSSMGECTKNPKYMLVNCAXXXXXXXXXNTDKGTCSNINSDKECENWSKRGECAKNPKYMLINCAKSCNSCESATQLPTACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVCKFNNE---TKGCRNLDPNSDCESWKQAGECLNNEKYMKVQCGKSCGRC---NAKTYV-DCKDIYQEDSCKAWKDLGECFKNPVFMLSKCSQTCGSCDMEKNPVVVETCKNIDSNENCNTWQTAGECEKNPNYMLVNCAKACKTCQKDDAKNVEKKCDDVYSDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTCDQLKNNQT---MCQNAYNDAICTKWKNMGECTKNPNFMLIQCKESCGKCEKLPKNT----NCINLDNDKNCEKWAGENECTKNSKYMLERCFKXXXXXXXXXSAKTPSEVCSNLANDTDCESWSKAGHCEKNVSYMLKFCAKSCKACNRLITTSLPSINCVNKLNDSTCETLKILGQCEKNSIFMIEKCGKSCGSCRPAKEKTFENKT----CLNLYKDDTCDLWKKAGYCHIYPKFMLSHCLKSCGQCSE------------YSECKNLYNNIVCDKWAAEGECLKNSKFMIQLCLKSCGRCYDLK-NLKVNRTNSDGCENKYGDWSCEAWKQVGECERNPIFMNDQCSKSCGTC---FKSTATSTSGPLRMSSV---CKNFYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSCQNLKFSLKVKCQNILTKEKCLKLKKAGECEKNSKQMAELCAYTCHKCNLSF 4152
            +E+ C+       C     +M   C+K+C+ C           ++C N   N +C  W + GEC+ N +YM+ NCK+SC  C   K  TT  P +           C+N YGD  C  +++ G+C  N  FM + CAK+C KC         P  D  CK++ ++N+C       EC +N ++M   C K+C  C   I  +P  C N Y +  C  WS+ GEC+ N  YM               +        +   +PS+   C N Y +  CE++ + GEC+KNP FM   CAKSC+ CK T   NDS C NI K++ C++    GEC +N +YM VNCAK+C  C  +  + K CVN++ DSEC+ WSK GECQKNP YML+NCAKSC +CD      ++C N + + +C KWS+ GEC KNPK+ML NCAKSC +C + ++    C+N + ++EC KWS MGEC+KNP YMLVNCAKSCN CK +   +  C N + D ECE+WSKRGEC KNPKYML+NCAKSC SC+S  +    C N H N+ EC KWS  GEC+KNP +ML NCAKSCN CK +N  KG C N++ + +CE+W + GEC  N KYM + C KSC  C + T +   C +I++ ED C+ W + GEC KNP FML  C+++C  C         + C+N+D N +C +W+ AGEC  N  YM V C K+C  C   +AK     C D+Y + SC  WK  G C K  + M  KCS+TCG+CD  KN   +  C+N  ++  C  W+  GEC KNPN+ML+ C ++C  C+K   KN    C ++ +D +C KW  E  C K S  M  +C K+C  C    + +T   +C N  ND  C  W   G C KN ++ML  C +SC  C +L   +    NC+N  ND  CE      +C KNS +M+E+C KSC +C  +    + ++ C NL  D  C+ W KAG+C     +ML  C KSC  C+           C N  N+  C+     G+C KNS FMI+ C KSCG C   K     N+T    C N Y D +C+ WK+ G C   P FM   C KSCG C +             S CKN Y+N +CD+W   G+C  NS FM   C +SC  C +LK +LKV       C+N      C   K+ GECE+N   M + C+ +C  C   F         P +M S    C N   +  C  W +   C+ N+ +MR+ C +SC +C  ++   +V C +     KC      GEC++N K M E CA +C  C  ++
Sbjct:   33 EENSCLSWADANECTKNPNFMHKMCKKSCKLCITKE------PEKCTNQYDNLSCYVWSQTGECESNRKYMEKNCKKSCKFCGGSKMQTTTTPSLSVITMPSNETLCQNKYGDKYCEEFKSKGECTKNPDFMFIQCAKSCSKC-----KETKPGNDSLCKNIEKDNNCEQLKIRGECLRNVSYMRVNCAKTCFNCNASIVDKP--CVNSYMDSECDKWSKLGECQKNPNYM---------------LLNCAKSCNNCDLIPSDGKDCFNIYRNDKCEKWSNAGECSKNPKFMLENCAKSCNNCK-TSQQNDSNCVNINKNSECDKWSQMGECSKNPNYMLVNCAKSCNYCKFNKDLQKNCVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSCD----SDRECVNTHNDAECNKWSSMGECQKNPKYMLVNCAKSCKSCDSERE----CLNTHNDAECSKWSSMGECTKNPKYMLVNCAKSCNSCKSSNTDKGTCSNINSDKECENWSKRGECAKNPKYMLINCAKSCNSCESATQLPTACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVCKFNNETKG-CRNLDPNSDCESWKQAGECLNNEKYMKVQCGKSCGRCNAKTYVD--CKDIYQ-EDSCKAWKDLGECFKNPVFMLSKCSQTCGSCDMEKNPVVVETCKNIDSNENCNTWQTAGECEKNPNYMLVNCAKACKTCQKDDAKNVEKKCDDVYSDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTCDQLKNNQTM--CQNAYNDAICTKWKNMGECTKNPNFMLIQCKESCGKCEK-LPKNTN--CINLDNDKNCEKWAGENECTKNSKYMLERCFKSCNNCSSSSSAKTPSEVCSNLANDTDCESWSKAGHCEKNVSYMLKFCAKSCKACNRLITTSLPSINCVNKLNDSTCETLKILGQCEKNSIFMIEKCGKSCGSCRPAKEKTSENKTCLNLYKDDACDLWKKAGYCHIYPKFMLSHCLKSCGQCSEYSE-------CKNLYNNIVCDKWAAEGECLKNSKFMIQLCLKSCGRCYDLKNLKV-NRTNSDGCENKYGDWSCEAWKQVGECERNPIFMNDQCSKSCGTCFKSTATSTSGPLRMSSVCKNFYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSCQNLKFSLKVK------CQNILTKEKCLKLKKAGECEKNSKQMAELCAYTCHKCNLSFVKPMEINQNPTKMRSSKFKCDNRAGDFQCSYWARQKQCELNASYMRLFCQKSCGACL-MEKPGQVSCVDKFATMKCFSWSMRGECDRNGKWMTENCAKSCLVCQNNY 1304          

HSP 3 Score: 732.25 bits (1889), Expect = 0.000e+0
Identity = 516/1371 (37.64%), Postives = 699/1371 (50.98%), Query Frame = -1
Query:  160 MSFNCRKTCEKCFKHRNRFVIPIKECKN--LEKNETCDAWEKRGECKKNPRYMKFNCKQSCGLCDKSTTTLAPKIECKNIYGDDKCNLWEAVGDCQNNKLFMELNCAKACGKCGTXXXXXXXXXXXXXXXDV---------YEENSCLSWADANECTKNPNFMHKMCKKSCKLCITKEP---EKCTNQYDNLSCYVWSQTGECESNRKYMEXXXXXXXXXXXXXKMQTTTTPSLSVITMPSNETLCQNKYGDKYCEEFKSKGECTKNPDFMFIQCAKSCSKCKETKPGNDSLCKNIEKDNNCEQLKIRGECLRNVSYMRVNCAKTCFNCNASVV-DKPCVNSYMDSECDKWSKLGECQKNPNYMLLNCAKSCNNCDLIPSDGKDCFNIYRNDKCEKWSNAGECSKNPKFMLENCAKSCNNCKTSQQNDSNCVNINKNSECDKWSQMGECSKNPNYMLVNCAKSCNYCKFNKDLQKNCVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSCDSER----ECLNTHNDAECSKWSSMGECTKNPKYMLVNCAXXXXXXXXXNTDKGTCSNINSDK-ECENWSKRGECAKNPKYMLINCAKSCNSCESATQLPTACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVCKFNNETKGCRNLDPNSDCESWKQAGECLNNEKYMKVQCGKSCGRC----NAKTYVDCKDIYQEDSCKAWKDLGECFKNPVFMLSKCSQTCGSCDMEKNPVVVETCKNIDSNENCNTWQTAGECEKNPNYMLVNCAKACKTCQKDDAKNVEKKCDDVYSDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTCDQLKNNQTMCQNAYNDAICTKWKNMGECTKNPNFMLIQC-----KESCGKCEKLPKNTNCINLDNDKNCEKWAGENECTKNSKYMLERCFKXXXXXXXXXSAKTPSEVCSNLANDTDCESWSKAGHCEKNVSYMLKFCAKSCKACNRLITTSLPSINCVNKLNDSTCETLKILGQCEKNSIFMIEKCGKSCGSCRPAKEKTFENKTCLNLYKDDTCDLWKKAGYCHIYPKFMLSHCLKSCGQCSEYSE----------CKNLYNNIVCDKWAAEGECLKNSKFMIQLCLKSCGRCYDLKNLKVNRTNSDG-------CENKYGDWSCEAWKQVGECERNPIFMNDQCSKSCGTCFKSTATSTSGPLRMSSVCKNFYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSCQNLKF--------------SLKVKCQNILTKEKCLKLKKAGECEKNSKQMAELCAYTCHKCNLSFVKPMEINQNPTKMRSSKFKCDNRAGDFQCSYWARQKQCELNASYMRLFCQKSCGAC 4092
            M  NC K C KC    + F+ P K+     + +  +C +W    EC KNP +M   CK+SC LC     T  P+ +C N Y +  C +W   G+C++N+ +ME NC K+C  CG                           Y +  C  +    ECTKNP+FM   C KSC  C   +P     C N   + +C      GEC  N  YM             +  +T    + S++  P     C N Y D  C+++   GEC KNP++M + CAKSC+ C +  P +   C NI +++ CE+    GEC +N  +M  NCAK+C NC  S   D  CVN   +SECDKWS++GEC KNPNYML+NCAKSCN C       K+C N +++ +CE WS  GEC KNPK+ML NCAKSC +C +    D  CVN + ++EC+KWS MGEC KNP YMLVNCAKSC  C    D ++ C+NTH D+EC  WS  GEC KNPKYMLVNCAKSC SC S       C N ++D EC  WS  GEC KNPKYML+NCAKSCNSC+S+      C+NI+ ++ EC  WS++GEC+KNP +ML NCAKSCN C+   +    C N+  N D C  W + GEC  N  +M   C KSC  C        C+++     C++WK  GEC  N  +M  +C ++CG C    N      CK+I   ++C  W+  GEC KNP +ML  C++ C +C  +    V + C ++ S+ +C  W+  G CEK    M V C+K C TC  D  KN +  C + Y+D  C KWK  G C K    M ++C ++CG C++L  N T C N  ND  C KW    ECTKN  +ML +C       S     K P    C NL ND +CE W+    C KN  YML+ C KSC  C+   +   PS  C N  ND+ CE+    G CEKN  +M++ C KSC +C      +  +  C+N   D  C+  K  G C     FM+  C KSCG C    E       C NLY +  CD W   G C    KFM+  CLKSCG+C +             C+N Y +  C+ W   GEC +N  FM   C KSCG C+     K   T++ G       C+N Y +  C+ W + G+C+ N  FM   C++SC +C        +    +   C+N  + + C +  K G+C+ NS  M   CA +C+ C NL F              S K KC N     +C    +  +CE N+  M   C  +C  C +   KP +++            C ++    +C  W+ + +C+ N  +M   C KSC  C
Sbjct:    1 MELNCAKACGKCGTDSDGFLDPDKDDDCKDVYEENSCLSWADANECTKNPNFMHKMCKKSCKLC----ITKEPE-KCTNQYDNLSCYVWSQTGECESNRKYMEKNCKKSCKFCGGSKMQTTTTPSLSVITMPSNETLCQNKYGDKYCEEFKSKGECTKNPDFMFIQCAKSCSKCKETKPGNDSLCKNIEKDNNCEQLKIRGECLRNVSYMR-----------VNCAKTCFNCNASIVDKP-----CVNSYMDSECDKWSKLGECQKNPNYMLLNCAKSCNNC-DLIPSDGKDCFNIYRNDKCEKWSNAGECSKNPKFMLENCAKSCNNCKTSQQNDSNCVNINKNSECDKWSQMGECSKNPNYMLVNCAKSCNYCKFNKDLQKNCVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSCDS----DRECVNTHNDAECNKWSSMGECQKNPKYMLVNCAKSCKSC----DSERECLNTHNDAECSKWSSMGECTKNPKYMLVNCAKSCNSCKSSNTDKGTCSNINSDKECENWSKRGECAKNPKYMLINCAKSCNSCESATQLPTACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVCKFNNETK-GCRNLDPNSD-CESWKQAGECLNNEKYMKVQCGKSCGRCNAKTYV-DCKDIYQEDSCKAWKDLGECFKNPVFMLSKCSQTCGSCDMEKNPVVVETCKNIDSNENCNTWQTAGECEKNPNYMLVNCAKACKTCQKDDAKNVEKKCDDVYSDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTC--DQLKNNQTMCQNAYNDAICTKWKNMGECTKNPNFMLIQCKESCGKCEKLPKN-TNCINLDNDKNCEKWAGENECTKNSKYMLERCFKSCNNCSSSSSAKTPSEV-CSNLANDTDCESWSKAGHCEKNVSYMLKFCAKSCKACNRLITTSLPSINCVNKLNDSTCETLKILGQCEKNSIFMIEKCGKSCGSCRPAKEKTSENKTCLNLYKDDACDLWKKAGYCHIYPKFMLSHCLKSCGQCSEYSE-------CKNLYNNIVCDKWAAEGECLKNSKFMIQLCLKSCGRCYDLKNLKVNRTNSDGCENKYGDWSCEAWKQVGECERNPIFMNDQCSKSCGTCF-----KSTATSTSGPLRMSSVCKNFYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSC-------QNLKFSLKVKCQNILTKEKCLKLKKAGECEKNSKQMAELCAYTCHKC-NLSFVKPMEINQNPTKMRSSKFKCDNRAGDFQCSYWARQKQCELNASYMRLFCQKSCGACLME--KPGQVS------------CVDKFATMKCFSWSMRGECDRNGKWMTENCAKSCLVC 1300          

HSP 4 Score: 706.442 bits (1822), Expect = 0.000e+0
Identity = 484/1288 (37.58%), Postives = 666/1288 (51.71%), Query Frame = -1
Query:  475 ESRRCQDKNDESWCIEQQKKGHCELRNKYMSFNCRKTCEKCFKHRNR---------FVIPIKE--CKNLEKNETCDAWEKRGECKKNPRYMKFNCKQSCGLCDKSTTTLAPKIECKNIYGDDKCNLWEAVGDCQNNKLFMELNCAKACGKCGTXXXXXXXXXXXXXXXDVYEENSCLSWADANECTKNPNFMHKMCKKSCKLC--ITKEPEKCTNQYDNLSCYVWSQTGECESNRKYMEXXXXXXXXXXXXXKMQTTTTPSLSVITMPSNETLCQNKYGDKYCEEFKSKGECTKNPDFMFIQCAKSCSKCKETKPGNDSLCKNIEKDNNCEQLKIRGECLRNVSYMRVNCAKTCFNCNASVVDKPCVNSYMDSECDKWSKLGECQKNPNYMLLNCAKSCNNCDLIPSDGKDCFNIYRNDKCEKWSNAGECSKNPKFMLENCAKSCNNCKTSQQNDSNCVNINKNSECDKWSQMGECSKNPNYMLVNCAKSCNYCKFNKDLQKNCVNTHK-DSECESWSKRGECQKNPKYMLVNCAKSCKSCDSERE---CLNTHNDAECSKWSSMGECTKNPKYMLVNCAXXXXXXXXXNTDKGTCSNINSDKECENWSKRGECAKNPKYMLINCAKSCNSC--ESATQLPTACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVCKFN---NETKGCRNLDPNSDCESWKQAGECLNNEKYMKVQCGKSCGRCNA--KTYVDCKDIYQEDSCKAWKDLGECFKNPVFMLSKCSQTCGSCDMEKNPVVVETCKNIDSNENCNTWQTAGECEKNPNYMLVNCAK-ACKTCQKDDAKNVEKKCDDVYSDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTCDQLKNNQTM---CQNAYNDAICTKWKNMGECTKNPNFMLIQCKESCGKC----EKLPKNTNCINLDNDKNCEKWAGENECTKNSKYMLERCFKXXXXXXXXXSAKTPSEVCSNLANDTDCESWSKAGHCEKNVSYMLKFCAKSCKACNRLITTSLPSIN---CVNKLNDSTCETLKILGQCEKNSIFMIEKCGKSCGSCRPAKEKTFE-----NKTCLNLYKDDTCDLWKKAGYCHIYPKFMLSHCLKSCGQC-----SEYSECKNLYNNIVCDKWAAEGECLKNSKFMIQLCLKSCGRC--YDLKNLKVN------RTNSDGCENKYGDWSCEAWKQVGECERNPIFMNDQCSKSCGTCFKSTATSTSGPLRMSSVCKNFYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSCQN 4179
            E  +C ++ D   C    + G CE   KYM  NC+K+C+ C   + +           +P  E  C+N   ++ C+ ++ +GEC KNP +M   C +SC  C +  T       CKNI  D+ C   +  G+C  N  +M +NCAK C  C          +        Y ++ C  W+   EC KNPN+M   C KSC  C  I  + + C N Y N  C  WS  GEC  N K+M               ++       +  T   N++ C N   +  C+++   GEC+KNP++M + CAKSC+ CK  K    + C N  KD+ CE    RGEC +N  YM VNCAK+C +C++   D+ CVN++ D+EC+KWS +GECQKNP YML+NCAKSC +CD      ++C N + + +C KWS+ GEC+KNPK+ML NCAKSCN+CK+S  +   C NIN + EC+ WS+ GEC+KNP YML+NCAKSCN C+    L   C N HK + EC  WS++GEC KNP +ML NCAKSC  C    E   C N   +++C  W   GEC  N KYM V C KSC  C +       C +I  +  C+ W   GEC KNP +ML  C+++C SC  E    +   C NI  NE+ C  W   GEC KNPN+ML NCAK+C  C+ +   N  K C ++  +  C  WK  G C      MKV+C K+CG C+        C++ Y +  C  WK++GEC KNP FML +C ++CG C  EK P     C N+D+++NC  W    EC KN  YML  C K          AK   + C ++ +D  C  W   G CEK    M   C+K+C  C++L         C N  ND+ C   K +G+C KN  FM+ +C +SCG C    EK  +N  C+NL  D  C+ W     C    K+ML  C KSC  C       +    C NL N+  C+ W+  G C KN  +M++ C KSC  C  L    +   N   C NK  D +CE  K +G+CE+N IFM ++C KSCG+C  +   +       +  C N Y +  CD W K G C     FM  +C +SC  C     S   +C+N+     C K    GEC KNSK M +LC  +C +C    +K +++N      R++   C+N+ GD+ C  W +  +CE N  +M   C KSCG C        S        C + ++   C  W+  G+C  N  +M  NCA+SC  CQN
Sbjct:   68 EPEKCTNQYDNLSCYVWSQTGECESNRKYMEKNCKKSCKFCGGSKMQTTTTPSLSVITMPSNETLCQNKYGDKYCEEFKSKGECTKNPDFMFIQCAKSCSKCKE--TKPGNDSLCKNIEKDNNCEQLKIRGECLRNVSYMRVNCAKTCFNCNASIVDKPCVNS-------YMDSECDKWSKLGECQKNPNYMLLNCAKSCNNCDLIPSDGKDCFNIYRNDKCEKWSNAGECSKNPKFM---------------LENCAKSCNNCKTSQQNDSNCVNINKNSECDKWSQMGECSKNPNYMLVNCAKSCNYCKFNKDLQKN-CVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSCDS---DRECVNTHNDAECNKWSSMGECQKNPKYMLVNCAKSCKSCD----SERECLNTHNDAECSKWSSMGECTKNPKYMLVNCAKSCNSCKSSNTDKGTCSNINSDKECENWSKRGECAKNPKYMLINCAKSCNSCESATQLPTACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVCKFNNETKGCRNLDPNSDCESWKQAGECLNNEKYMKVQCGKSCGRCNAKTY--VDCKDIYQEDSCKAWKDLGECFKNPVFMLSKCSQTCGSCDMEKNPVVVETCKNIDSNEN-CNTWQTAGECEKNPNYMLVNCAKACKTCQKDDAKNVEKKCDDVYSDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTCDQLKNNQTMCQNAYNDAICTKWKNMGECTKNPNFMLIQCKESCGKC--EKLPKNT-NCINLDNDKNCEKWAGENECTKNSKYMLERCFKSCNNCSSSSSAKTPSEVCSNLANDTDCESWSKAGHCEKNVSYMLKFCAKSCKACNRLITTSLPSINCVNKLNDSTCETLKILGQCEKNSIFMIEKCGKSCGSCRPAKEKTSENKTCLNLYKDDACDLWKKAGYCHIYPKFMLSHCLKSCGQC-------SEYSECKNLYNNIVCDKWAAEGECLKNSKFMIQLCLKSCGRCYDLKNLKVNRTNSDGCENKYGDWSCEAWKQVGECERNPIFMNDQCSKSCGTCFKSTATSTSGPLRMSSVCKNFYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSCQNLKFSLKVKCQNILTKEKCLKLKKAGECEKNSKQMAELCAYTCHKCNLSFVKPMEINQNPTKMRSSKFKCDNRAGDFQCSYWARQKQCELNASYMRLFCQKSCGACLMEKPGQVS--------CVDKFATMKCFSWSMRGECDRNGKWMTENCAKSCLVCQN 1302          

HSP 5 Score: 514.612 bits (1324), Expect = 5.533e-157
Identity = 380/1044 (36.40%), Postives = 526/1044 (50.38%), Query Frame = -1
Query: 1219 CHTPESFESRRCQDKNDESWCIEQQKKGHCELRNKYMSFNCRKTCEKCFKHRNRFVIPIKECKNLEKNETCDAWEKRGECKKNPRYMKFNCKQSCGLCDKSTTTLAPKIECKNIYGDDKCNLWEAVGDCQNNKLFMELNCAKACGKCGTXXXXXXXXXXXXXXXDVYEENSCLSWADANECTKNPNFMHKMCKKSCKLCITKEPEK--CTNQYDNLSCYVWSQTGECESNRKYMEXXXXXXXXXXXXXKMQTTTTPSLSVITMPSNETLCQNKY-GDKYCEEFKSKGECTKNPDFMFIQCAKSCSKCK---ETKPGNDSLCKNIEKDNNCEQLKIRGECLRNVSYMRVNCAKTCFNCNA-SVVDKPCVNSYMDSECDKWSKLGECQKNPNYMLLNCAKSCNNCDLI--PSDGKDCFNIYRNDKCEKWSNAGECSKNPKFMLENCAKSCNNCK--TSQQNDSNCVNINKNSECDKWSQMGECSKNPNYMLVNCAKSCNYCKFNKDLQKNCVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSCD---SERECLNTHNDAECSKWSSMGECTKNPKYMLVNC---AXXXXXXXXXNTDKGTCSNINSDKECENWSKRGECAKNPKYMLINCAKSCNSCES--ATQLPTACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVCKF----NNETKGCRNLDPNSDCESWKQAGECLNNEKYMKVQCGKSCGRCNAKTYVDCKDIYQEDSCKAWKDLGECFKNPVFMLSKCSQTCGSCDMEKNPVVVET----CKNIDSNENCNTWQTAGECEKNPNYMLVNCAKACKTCQKDDAKN------VEKKCDDVYSDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTCDQLKNN-QTMCQNAYNDAICTKWKNMGECTKNPNFMLIQCKESCGKC-----EKLPKNTN----------CINLDNDKNCEKWAGENECTKNSKYMLERCFKXXXXXXXXXSAKTPSEV-CSNLANDTDCESWSKAGHCEKNVSYMLKFCAKSCKAC 4200
            C T +  +S  C + N  S C +  + G C     YM  NC K+C  C  +++      K C N  K+  C++W KRGEC+KNP+YM  NC +SC  CD          EC N + D +CN W ++G+CQ N  +M +NCAK+C  C +          + +C + + +  C  W+   ECTKNP +M   C KSC  C +   +K  C+N   +  C  WS+ GEC  N KYM                  +     S   +P   T C N +  +  C ++  KGEC+KNP+FM   CAKSC+ CK   ETK      C+N++ +++CE  K  GECL N  YM+V C K+C  CNA + VD  C + Y +  C  W  LGEC KNP +ML  C+++C +CD+   P   + C NI  N+ C  W  AGEC KNP +ML NCAK+C  C+   ++  +  C ++  +  C KW   G C K    M V C+K+C  C   K+ Q  C N + D+ C  W   GEC KNP +ML+ C +SC  C+       C+N  ND  C KW+   ECTKN KYML  C     +C+S  S+ T    CSN+ +D +CE+WSK G C KN  YML  CAKSC +C     T LP+       N+  C      G+C KN  FM+E C KSC  C+      +E K C NL  +  C+ WK+AG C    K+M   C KSCG+C+   Y +CK++Y    C  W   GEC KN  FM+  C ++CG C   KN  V  T    C+N   + +C  W+  GECE+NP +M   C+K+C TC K  A +      +   C + YS+  C +W   G C+  S  M++ C+++C +C  LK + +  CQN      C K K  GEC KN   M   C  +C KC     + +  N N          C N   D  C  WA + +C  N+ YM   C K       +   + P +V C +      C SWS  G C++N  +M + CAKSC  C
Sbjct:  307 CKTSQQNDSN-CVNINKNSECDKWSQMGECSKNPNYMLVNCAKSCNYCKFNKDL----QKNCVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSCDSDR-------ECVNTHNDAECNKWSSMGECQKNPKYMLVNCAKSCKSCDS----------ERECLNTHNDAECSKWSSMGECTKNPKYMLVNCAKSCNSCKSSNTDKGTCSNINSDKECENWSKRGECAKNPKYM------------LINCAKSCNSCESATQLP---TACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVCKFNNETKG-----CRNLDPNSDCESWKQAGECLNNEKYMKVQCGKSCGRCNAKTYVD--CKDIYQEDSCKAWKDLGECFKNPVFMLSKCSQTCGSCDMEKNPVVVETCKNIDSNENCNTWQTAGECEKNPNYMLVNCAKACKTCQKDDAKNVEKKCDDVYSDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTCDQLKNNQTMCQNAYNDAICTKWKNMGECTKNPNFMLIQCKESCGKCEKLPKNTNCINLDNDKNCEKWAGENECTKNSKYMLERCFKSCNNCSSSSSAKTPSEVCSNLANDTDCESWSKAGHCEKNVSYMLKFCAKSCKACNRLITTSLPSINCVNKLNDSTCETLKILGQCEKNSIFMIEKCGKSCGSCRPAKEKTSENKTCLNLYKDDACDLWKKAGYCHIYPKFMLSHCLKSCGQCSE--YSECKNLYNNIVCDKWAAEGECLKNSKFMIQLCLKSCGRCYDLKNLKVNRTNSDGCENKYGDWSCEAWKQVGECERNPIFMNDQCSKSCGTCFKSTATSTSGPLRMSSVCKNFYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSCQNLKFSLKVKCQNILTKEKCLKLKKAGECEKNSKQMAELCAYTCHKCNLSFVKPMEINQNPTKMRSSKFKCDNRAGDFQCSYWARQKQCELNASYMRLFCQK----SCGACLMEKPGQVSCVDKFATMKCFSWSMRGECDRNGKWMTENCAKSCLVC 1300          

HSP 6 Score: 205.297 bits (521), Expect = 5.492e-53
Identity = 166/507 (32.74%), Postives = 235/507 (46.35%), Query Frame = -1
Query: 2728 DKNDESWCIEQQKKGHCELRNKYMSFNCRKTCEKCFKHRNRFV------IPIKECKNLEKNETCDAWEKRGECKKNPRYMKFNCKQSCGLCDKSTTTLAPKIECKNIYGDDKCNLWEAVGDCQNNKLFMELNCAKACGKCGTXXXXXXXXXXXXXXXDVYEENSCLSWADANECTKNPNFMHKMCKKSCKLCITKEPEKCTNQYDNLSCYVWSQTGECESNRKYMEXXXXXXXXXXXXXKMQTTTTPSLSVITMPSNETLCQNKYGDKYCEEFKSKGECTKNPDFMFIQCAKSCSKCKETKPGN-------DSLCKNIEKDNNCEQLKIRGECLRNVSYMRVNCAKTCFNCN--ASVVDKPCVNSYMDSECDKWSKLGECQKNPNYMLLNCAKSCNNCDL--------------IPSDGKDCFNIYRNDKCEKWSNAGECSKNPKFMLENCAKSCNNCKTSQQNDSNCVNINKNSECDKWSQMGECSKNPNYMLVNCAKSCNYCKFN 4161
            DKN E W  E +    C   +KYM        E+CFK  N          P + C NL  +  C++W K G C+KN  YM   C +SC  C++  TT  P I C N   D  C   + +G C+ N +FM   C K+CG C           ++  C ++Y++++C  W  A  C   P FM   C KSC  C   E  +C N Y+N+ C  W+  GEC  N K+M        + C  S  +     +L V    +N   C+NKYGD  CE +K  GEC +NP FM  QC+KSC  C ++   +        S+CKN   +  C++    G+C  N  +MR+NCA++C +C      +   C N     +C K  K GEC+KN   M   CA +C+ C+L              + S    C N   + +C  W+   +C  N  +M   C KSC  C   +    +CV+     +C  WS  GEC +N  +M  NCAKSC  C+ N
Sbjct:  822 DKNCEKWAGENE----CTKNSKYML-------ERCFKSCNNCSSSSSAKTPSEVCSNLANDTDCESWSKAGHCEKNVSYMLKFCAKSCKACNRLITTSLPSINCVNKLNDSTCETLKILGQCEKNSIFMIEKCGKSCGSCRP---AKEKTSENKTCLNLYKDDACDLWKKAGYCHIYPKFMLSHCLKSCGQC--SEYSECKNLYNNIVCDKWAAEGECLKNSKFM-------IQLCLKSCGRCYDLKNLKVNR--TNSDGCENKYGDWSCEAWKQVGECERNPIFMNDQCSKSCGTCFKSTATSTSGPLRMSSVCKNFYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSCQNLKFSLKVKCQNILTKEKCLKLKKAGECEKNSKQMAELCAYTCHKCNLSFVKPMEINQNPTKMRSSKFKCDNRAGDFQCSYWARQKQCELNASYMRLFCQKSCGACLMEKPGQVSCVDKFATMKCFSWSMRGECDRNGKWMTENCAKSCLVCQNN 1303          
BLAST of SMED30016458 vs. Planmine SMEST
Match: SMESG000074521.1 (SMESG000074521.1)

HSP 1 Score: 663.685 bits (1711), Expect = 0.000e+0
Identity = 326/342 (95.32%), Postives = 326/342 (95.32%), Query Frame = -1
Query: 3955 ILFPWNXXXXXXXXXIVFHDGTTRSKRAVVVKSADQWPDGVIPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQNCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSFINEKGEPSIQVINESMIHLLLEVHEKDLSFLDAKVVNLYYKCADRCFQNVTCSAGGYIDQYCQCHTPESFESRRCQDKNDESWCIEQQKKGHCELRNKYMSFNCRKTCEKCFKHRNRFVIPIKECKNLEKNETCDAWEKRGECKK 4980
            ILFPWNFLGLIFGFFIVFHDGTTRSKRAVVVKSADQWPDGVIPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQNCYSIVGMDYFAEQEVNLASPGCRH           YGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSFINEKGEPSIQVINESMIHLLLEVHEKDLSFLDAKVVNLYYKCADRCFQNVTCSAGGYIDQYCQCHTPESFESRRCQDKNDESWCIEQQKKGHCELRNKYMSFNCRKTCEKCFKHRNRFVIPIKECKNLEKNETCDAW   G  KK
Sbjct:    4 ILFPWNFLGLIFGFFIVFHDGTTRSKRAVVVKSADQWPDGVIPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQNCYSIVGMDYFAEQEVNLASPGCRH-----------YGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSFINEKGEPSIQVINESMIHLLLEVHEKDLSFLDAKVVNLYYKCADRCFQNVTCSAGGYIDQYCQCHTPESFESRRCQDKNDESWCIEQQKKGHCELRNKYMSFNCRKTCEKCFKHRNRFVIPIKECKNLEKNETCDAWANEGSAKK 334          
BLAST of SMED30016458 vs. Planmine SMEST
Match: SMESG000074509.1 (SMESG000074509.1)

HSP 1 Score: 485.723 bits (1249), Expect = 2.107e-153
Identity = 282/676 (41.72%), Postives = 402/676 (59.47%), Query Frame = -1
Query:   16 MLSKCSQTCGSCDMEKNPVVVETCKNIDSNENCNTWQTAGECEKNPNYMLVNCAKACKTCQKDDAKNVE-KKCDDVYSDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTCDQLKNNQTMCQNAYNDAICTKWKNMGECTKNPNFMLIQCKESCGKCEKLPKNTNCINLDNDKNCEKWAGENECTKNSKYMLERCFKXXXXXXXXXSAKTPSEVCSNLANDTDCESWSKAGHCEKNVSYMLKFCAKSCKACNRLITTSLPSINCVNKLNDSTCETLKILGQCEKNSIFMIEKCGKSCG-------SCRPAKEKTFENKT----------------CLNLYKDDTCDLWKKAGYCHIYPKFMLSHCLKSCGQCSEYSECKNLYNNIVCDKWAAEGECLKNSKFMIQLCLKSCGRCYDLKNLKVNRTN---SDGCENKYGDWSCEAWKQVGECERNPIFMNDQCSKSCGTCFKSTATSTSGPLRMSSVCKNFYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSCQNLKFSLKVKCQNILTKEKCLKLKKAGECEKNSKQMAELCAYTCHKCNLSFVKPMEINQNPTKMRSSKFKCDNRAGDFQCSYWARQKQCELNASYMRLFCQKSCGACLMEKPGQVSCVDKFATMKCFSWSMRGECDRNGKWMTENCAKSCLVCQN 1962
            ML +C+Q+CGSCD++   +    CKN+   + C  W+  GEC+ N  +M+ NC K C TCQ  +  N++   C++VYSD  C  WK EG C  +   +  KCSKTCG C+  K+    CQN YN A+C KWK  GEC KNPNFM +QC+++C  C+K  +  +C NL ND+ CE  A ++ C KNS YML+ C  +CNNCS  + +   +  C NL +   C+SW   G C KN  +MLK CAKSC  C   +T      NC N  N+S CE    +G+CEKN  +M+  C KSC        +C PA        T                C NL++DD C+ WKK G C    K M S C KSCG+CS+  EC+N+Y++  C+ WA +G+C KN KFM+ LC+KSCG+C  L N ++  +    ++ C+NK+GD++CE+++++GEC+++ +FM D+C+K+CG C ++  T+TS        CKN Y +K+C+EW ++G C++ S F+   C++SC +C     +   +CQN+   E C K K  G CE     M   CA +C KC+  F  P  ++ +      +   C N AGD QCSYWARQ QCE N SYMR+ C+K+CG C  EK  + +C DK++T++C +W+ RGEC+R   WM ENCAKSC +CQ+
Sbjct:    1 MLHQCAQSCGSCDLKFKGISNFVCKNVFDEKFCQLWKNDGECKTNREFMIENCGKTCGTCQTFNETNLDFGYCENVYSDRICNFWKTEGFCSAKYRNVLKKCSKTCGNCNMTKDK---CQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKVEKISCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNC---LTKPKNDRNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPQITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSKTLECQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKC-SLINFQIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLC-QANMTNTSIYSNKRMGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRFAQCQNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCD--FKSPTALSYSKPAKVINTANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTREKQQEGNCADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKICQD 666          

HSP 2 Score: 327.791 bits (839), Expect = 1.763e-96
Identity = 233/689 (33.82%), Postives = 333/689 (48.33%), Query Frame = -1
Query:  469 MLINCAKSCNSCESATQLPT--ACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVCKFNNETK----GCRNLDPNSDCESWKQAGECLNNEKYMKVQCGKSCGRCNAKTYVDCKDIYQEDSCKAWKDLGECFKNPVFMLSKCSQTCGSCDMEKNPVVVETCKNIDSNENCNTWQTAGECEKNPNYMLVNCAKACKTCQK-DDAKNVEKKCDDVYSDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTCDQLKNNQTMCQNAYNDAICTKWKNMGECTKNPNFMLIQCKESCGK---------------------------CEKLPKNTNCINLDNDKNCEKWAGENECTKNSKYMLERCFKXXXXXXXXXSAKTPSEVCSNLANDTDCESWSKAGHCEKNVSYMLKFCAKSCKACNRL---ITTSLPSIN--CVNKLNDSTCETLKILGQCEKNSIFMIEKCGKSCGSCRPAKEKT--FENKT--CLNLYKDDTCDLWKKAGYCHIYPKFMLSHCLKSCGQCS-----EYSECKNLYNNIVCDKWAAEGECLKNSKFMIQLCLKSCGRCYDLKNLKV-------NRTNSDGCENKYGDWSCEAWKQVGECERNPIFMNDQCSKSCGTCFKSTATSTSGPLRMSSVCKNFYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSCQNLK 2370
            ML  CA+SC SC+   +  +   C N+  +E  C+ W   GEC  N  FM+ENC K+C  C+  NET      C N+  +  C  WK  G C    + +  +C K+CG CN  T   C+++Y    C+ WK  GEC KNP FM  +C +TC  CD +   +   +CKN+ +++ C +      C+KN  YML  CA  C  C     +      C ++Y    C  W+ +G C K    M   C+K+CG C     N   C+N  N++ C +W  MGEC KNP +MLI C +SC K                            +K+P  +NC NL  D  CE+W     C KN K M  +C KSC  C       + +  C N+ +D  CE+W+K G CEKN+ +ML  C KSC  C+ +   I  S   +N  C NK  D TCE+ + +G+C+K+ +FM +KC K+CG C+     T  + NK   C N+YKD  C+ W ++G C     F+L+ C KSC  C+      +++C+N+  +  C KW + G C      M   C  SC +C D K+             N+  C N  GD  C  W +  +CE+NP +M   C K+CG C +          +    C + YS   C  W   G+C     +M  NCA+SC  CQ+ K
Sbjct:    1 MLHQCAQSCGSCDLKFKGISNFVCKNVF-DEKFCQLWKNDGECKTNREFMIENCGKTCGTCQTFNETNLDFGYCENVYSDRICNFWKTEGFCSAKYRNVLKKCSKTCGNCNM-TKDKCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKVEKI---SCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNCLTKPKNDRNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPQITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKC-------SKTLECQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKRMGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRFAQCQNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKC-DFKSPTALSYSKPAKVINTANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTREK--------QQEGNCADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKICQDFK 668          

HSP 3 Score: 325.479 bits (833), Expect = 1.395e-95
Identity = 226/661 (34.19%), Postives = 318/661 (48.11%), Query Frame = -1
Query: 1780 CTNQYDNLSCYVWSQTGECESNRKYMEXXXXXXXXXXXXXKMQTTTTPSLSVITMPSNETLCQNKYGDKYCEEFKSKGECTKNPDFMFIQCAKSCSKCKETKPGNDSLCKNIEKDNNCEQLKIRGECLRNVSYMRVNCAKTCFNCNASVVDKPCVNSYMDSECDKWSKLGECQKNPNYMLLNCAKSCNNCDLIPSDGK---DCFNIYRNDKCEKWSNAGECSKNPKFMLENCAKSCNNCKTSQQNDSNCVNINKNSECDKWSQMGECSKNPNYMLVNCAKSCN--------------------------YCKFNKDLQKNCVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSCDSERECLNTHNDAECSKWSSMGECTKNPKYMLVNCAX-----XXXXXXXXNTDKGT---CSNINSDKECENWSKRGECAKNPKYMLINCAKSCNSCES-------ATQLPTACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVC--KFNNETKGCRNLDPNSDCESWKQAGECLNNEKYMKVQCGKSCGRCNAKT--------------YVDCKDIYQEDSCKAWKDLGECFKNPVFMLSKCSQTCGSCDMEKNPVVVETCKNIDSNENCNTWQTAGECEKNPNYMLVNCAKACKTCQ 3582
            C N +D   C +W   GEC++NR++M                QT    +L           C+N Y D+ C  +K++G C+     +  +C+K+C  C  TK      C+N+     CE+ K  GEC +N ++M++ C KTC  C+  V    C N   D  C+  +K   C KN  YML  CA +CNNC L     K    C N+Y    C+ W   GEC KNPKFML++CAKSC NC T  +ND NC N+   S C++WS+MGEC KNP YML+NCAKSCN                          +      +  NC N  +D  CE W K G CQKN K M   C KSC  C    EC N ++D  C  W+  G+C KN K+ML+ C K     S  + +   ++K     C N   D  CE++ + GEC K+  +M   CAK+C  C++        +     C N++K++  C +W+E G C     F+L  C+KSC  C  K  N    C+N+  + +C+ WK  G C +    M+++C  SC +C+ K+                +C++I  +  C  W    +C KNP +M   C + CG C  EK       C +  S   C TW   GEC +   +M  NCAK+CK CQ
Sbjct:   24 CKNVFDEKFCQLWKNDGECKTNREFM-----IENCGKTCGTCQTFNETNLDF-------GYCENVYSDRICNFWKTEGFCSAKYRNVLKKCSKTCGNCNMTKDK----CQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKVEKISCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNCLTKPKNDRNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPQITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSKTLECQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKRMGCKNVYKDKI-CNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRFAQCQNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVINTANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTREKQQ--EGNCADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKICQ 665          

HSP 4 Score: 316.235 bits (809), Expect = 1.896e-92
Identity = 224/686 (32.65%), Postives = 329/686 (47.96%), Query Frame = -1
Query: 1039 MLENCAKSCNNCKTSQQNDSN--CVNINKNSECDKWSQMGECSKNPNYMLVNCAKSCNYCKFNKDLQKN---CVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSCDSERE-CLNTHNDAECSKWSSMGECTKNPKYMLVNCAXXXXXXXXXNTDKGTCSNINSDKECENWSKRGECAKNPKYMLINCAKSCNSCESATQ---LPTACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVCKFNNET-KGCRNLDPNSDCESWKQAGECLNNEKYMKVQCGKSCGR-------CNAKTYV---------------------DCKDIYQEDSCKAWKDLGECFKNPVFMLSKCSQTCGSCDMEKNPVVVETCKNIDSNENCNTWQTAGECEKNPNYMLVNCAKACKTCQ------KDDAKNVEKKCDDVYSDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTCDQLKNNQTM-------CQNAYNDAICTKWKNMGECTKNPNFMLIQCKESCGKC--EKLPKNTNCINLDNDKNCEKWAGENECTKNSKYMLERC--------FKXXXXXXXXXSAKTPSEV-CSNLANDTDCESWSKAGHCEKNVSYMLKFCAKSCKACNRLITTSLPSINCVNKLNDSTCETLKILGQCEKNSIFMIEKCGKSCGSCRPAKEKTFENK 2910
            ML  CA+SC +C    +  SN  C N+     C  W   GEC  N  +M+ NC K+C  C+   +   +   C N + D  C  W   G C    + +L  C+K+C +C+  ++ C N +N A C KW   GEC KNP +M + C +          +K +C N+ +D+ CE+ +K+  C KN  YML  CA +CN+C   T+      +C N++ +   C  W   GEC KNP FML++CAKSC  C    +  + C NL   S+CE W + GEC  N KYM + C KSC +       C+  T                       +C +++++D C+ WK +G C KN   M S+C ++CG C           C+N+  +++C  W   G+CEKN  +ML+ C K+C  C       ++  K+V  +C + + D +C  ++  G C+K  L MK KC+KTCG C     N ++       C+N Y D IC +W   G C     F+L  C +SC  C  + L +   C N+  D+NC+KW     C      M  +C        FKS    S S  AK  +   C N+A D  C  W++   CEKN SYM   C K+C  C R         NC +K +   C T    G+C +  ++M E C KSC  C+  K+  + N+
Sbjct:    1 MLHQCAQSCGSCDLKFKGISNFVCKNVFDEKFCQLWKNDGECKTNREFMIENCGKTCGTCQTFNETNLDFGYCENVYSDRICNFWKTEGFCSAKYRNVLKKCSKTCGNCNMTKDKCQNVYNSAVCEKWKRSGECEKNPNFMKLQC-RKTCRFCDKKVEKISCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLY-HYRMCDSWEIDGECIKNPKFMLKSCAKSCGNCLTKPKNDRNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPQITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSK------TLECQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKRMGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRFAQCQNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVINTANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTR---EKQQEGNCADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKICQDFKDLKYNNE 675          

HSP 5 Score: 300.056 bits (767), Expect = 6.997e-87
Identity = 226/687 (32.90%), Postives = 314/687 (45.71%), Query Frame = -1
Query:  772 MLVNCAKSCKSCD------SERECLNTHNDAECSKWSSMGECTKNPKYMLVNCAXXX---XXXXXXNTDKGTCSNINSDKECENWSKRGECAKNPKYMLINCAKSCNSCESATQLPTACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVCKFNNETKGCRNLDPNSDCESWKQAGECLNNEKYMKVQCGKSCGRCN-----AKTYVDCKDIYQEDSCKAWKDLGECFKNPVFMLSKCSQTCGSCDMEKNPVVVETCKNIDSNENCNTWQTAGECEKNPNYMLVNCAKAC------------------KTCQKDDAKNVEKK------CDDVYSDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTCDQLKNNQTMCQNAYNDAICTKWKNMGECTKNPNFMLIQCKESCGKCEKL---------PKNTNCINLDNDKNCEKWAGENECTKNSKYMLERCFKX----XXXXXXXXSAKTPSEVCSNLANDTDCESWSKAGHCEKNVSYMLKFCAKSCKACNRLITTSLPSINCVNKLNDSTCETLKILGQCEKNSIFMIEKCGKSCGSC-----------RPAKEKTFENKTCLNLYKDDTCDLWKKAGYCHIYPKFMLSHCLKSCGQCSEYSE----CKNLYNNIVCDKWAAEGECLKNSKFMIQLCLKSCGRCYDLKNLKVN 2634
            ML  CA+SC SCD      S   C N  ++  C  W + GEC  N ++M+ NC K+C    +   +N D G C N+ SD+ C  W   G C+   + +L  C+K+C +C         C N++ N   C KW   GEC KNPNFM   C K+C  C    E   C+NL  +  CES  +   C  N  YM   C  +C  C+      KT   C ++Y    C +W+  GEC KNP FML  C+++CG+C  +  P     C+N+ +  NC  W   GECEKNP YML+NCAK+C                       +   +V KK      C +++ D  C +WK  G C+K   +M  +C K+CG C +       CQN Y+D  C  W   G+C KN  FML+ C +SCGKC  +           N  C N   D  CE +    EC K+  +M ++C K+      N +++S        C N+  D  C  W+++G C    +++L  C+KSC  C   +        C N   D  C+  K  G CE     M  KC  SC  C           +PAK        C N+  D  C  W +   C   P +M   C K+CG C+   +    C + Y+ I C  WA  GEC +   +M + C KSC  C D K+LK N
Sbjct:    1 MLHQCAQSCGSCDLKFKGISNFVCKNVFDEKFCQLWKNDGECKTNREFMIENCGKTCGTCQTFNETNLDFGYCENVYSDRICNFWKTEGFCSAKYRNVLKKCSKTCGNC---NMTKDKCQNVY-NSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKVEKISCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNCLTK--PKNDRNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPQITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSKT----LECQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKRMGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRFAQ--CQNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAK--VINTANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTREKQQEGNCADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKICQDFKDLKYN 673          

HSP 6 Score: 282.722 bits (722), Expect = 5.461e-81
Identity = 223/693 (32.18%), Postives = 321/693 (46.32%), Query Frame = -1
Query: 2059 MKFNCKQSCGLCDKSTTTLAPKIECKNIYGDDKCNLWEAVGDCQNNKLFMELNCAKACGKCGTXXXXXXXXXXXXXXXDVYEENSCLSWADANECTKNPNFMHKMCKKSCKLC-ITKEPEKCTNQYDNLSCYVWSQTGECESNRKYMEXXXXXXXXXXXXXKMQTTTTPSLSVITMPSNETLCQNKYGDKYCEEFKSKGECTKNPDFMFIQCAKSCSKC----KETKPGNDSLCKNIEKDNNCEQLKIRGECLRNVSYMRVNCAKTCFNC-NASVVDKPCVNSYMDSECDKWSKLGECQKNPNYMLLNCAKSCN-------NCDLIPSDG-------------------KDCFNIYRNDKCEKWSNAGECSKNPKFMLENCAKSCNNCKTSQQNDSNCVNINKNSECDKWSQMGECSKNPNYMLVNCAKSCNYCKF--------NKDLQKNCVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSCDS-----------ERECLNTHNDAECSKWSSMGECTKNPKYMLVNCAXXXXXXXXXNTDK-GTCSNINSDKECENWSKRGECAKNPKYMLINCAKSCNSCE--SATQLPTA----------CTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVCKFNNETKG-CRNLDPNSDCESWKQAGECLNNEKYMKVQCGKSCGRC 3942
            M   C QSCG CD     ++  + CKN++ +  C LW+  G+C+ N+ FM  NC K CG C T             C++VY +  C  W     C+     + K C K+C  C +TK  +KC N Y++  C  W ++GECE N  +M+              +Q   T           +  C+N   D+ CE    K  C KN  +M   CA +C+ C    K  K  N   C N+     C+  +I GEC++N  +M  +CAK+C NC      D+ C N   +S C++WSK+GEC+KNP YML+NCAKSCN       NC    S                      +C N++R+D CE+W   G C KN K M   C KSC  C  + +    C N+  +  C+ W++ G+C KN  +ML+ C KSC  C           K +   C N   D  CES+ + GECQK+  +M   CAK+C  C +              C N + D  C++W+  G C     ++L  C+KSC +C     ++   C N+  D+ C+ W  RG C   P  M I CA SC  C+  S T L  +          C NI   + +C  W+ + +C KNP++M  +C K+C VC    + +G C +      C +W   GEC   + +M   C KSC  C
Sbjct:    1 MLHQCAQSCGSCDLKFKGISNFV-CKNVFDEKFCQLWKNDGECKTNREFMIENCGKTCGTCQT---FNETNLDFGYCENVYSDRICNFWKTEGFCSAKYRNVLKKCSKTCGNCNMTK--DKCQNVYNSAVCEKWKRSGECEKNPNFMK--------------LQCRKTCRF--CDKKVEKISCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNS--CVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNCLTKPKNDRNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPQITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSKTLE----CQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKRMGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRFAQCQNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVINTANCRNIA-GDLQCSYWARQDQCEKNPSYMRISCRKACGVCTREKQQEGNCADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKIC 664          

HSP 7 Score: 263.848 bits (673), Expect = 1.574e-74
Identity = 209/694 (30.12%), Postives = 313/694 (45.10%), Query Frame = -1
Query: 2278 CQDKNDESWCIEQQKKGHCELRNKYMSFNCRKTCEKCFKHRNRFVIPIKECKNLEKNETCDAWEKRGECKKNPRYMKFNCKQSCGLCDKSTTTLAPKIECKNIYGDDKCNLWEAVGDCQNNKLFMELNCAKACGKCGTXXXXXXXXXXXXXXXDVYEENSCLSWADANECTKNPNFMHKMCKKSCKLCI-----TKEPEKCTNQYDNLSCYVWSQTGECESNRKYMEXXXXXXXXXXXXXKMQTTTTPSLSVITMPSNETLCQNKYGDKYCEEFKSKGECTKNPDFMFIQCAKSCSKCKET----KPGNDSL---------------------CKNIEKDNNCEQLKIRGECLRNVSYMRVNCAKTCFNCNASVVDKPCVNSYMDSECDKWSKLGECQKNPNYMLLNCAKSCNNCDLIPSDGKD--------CFNIYRNDKCEKWSNAGECSKNPKFMLENCAKSCNNCKTSQQNDS-------NCVNINKNSECDKWSQMGECSKNPNYMLVNCAKSCNYCK---FNKDLQKNCVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSCD----------------SERECLNTHNDAECSKWSSMGECTKNPKYMLVNCAXXXXXXXXXNTDKGTCSNINSDKECENWSKRGECAKNPKYMLINCAKSCNSCESATQLPTACTNIHKNEDE 4167
            C++  DE +C   +  G C+   ++M  NC KTC  C +  N   +    C+N+  +  C+ W+  G C    R +   C ++CG C+ +      K +C+N+Y    C  W+  G+C+ N  FM+L C K C  C           +   CK++  +  C S A  + C KN  +M +MC  +C  C       K    C N Y    C  W   GEC  N K+M               +++      + +T P N+  C+N   +  CE +   GEC KNP +M I CAKSC+K K T     P   ++                     C N+ +D+ CE+ K  G C +N   M   C K+C  C+ ++    C N Y D  C+ W+K G+C+KN  +ML+ C KSC  C LI    ++        C N + +  CE +   GEC K+  FM + CAK+C  C+ +  N S        C N+ K+  C++W++ G C     ++L  C+KSC  C     N+  Q  C N   D  C+ W  RG C+  P  M + CA SC+ CD                +   C N   D +CS W+   +C KNP YM ++C K+C  C      +G C++  S  +C  W+ RGEC +   +M  NCAKSC  C+    L       + NED+
Sbjct:   24 CKNVFDEKFCQLWKNDGECKTNREFMIENCGKTCGTC-QTFNETNLDFGYCENVYSDRICNFWKTEGFCSAKYRNVLKKCSKTCGNCNMT------KDKCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCD-------KKVEKISCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRMCDSWEIDGECIKNPKFM---------------LKSCAKSCGNCLTKPKNDRNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPQITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSKTL---ECQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKRMGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRFAQ--CQNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVINTANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTREKQQEGNCADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKICQDFKDLK------YNNEDQ 677          

HSP 8 Score: 263.077 bits (671), Expect = 3.125e-74
Identity = 193/618 (31.23%), Postives = 287/618 (46.44%), Query Frame = -1
Query: 2491 CQCHTPESFESRRCQDKNDESWCIEQQKKGHCELRNKYMSFNCRKTCEKCFKHRNRFVIPIKECKNLEKNETCDAWEKRGECKKNPRYMKFNCKQSCGLCDKSTTTLAPKIECKNIYGDDKCNLWEAVGDCQNNKLFMELNCAKACGKCGTXXXXXXXXXXXXXXXDVYEENSCLSWADANECTKNPNFMHKMCKKSCKLCITKEP--EKCTNQYDNLSCYVWSQTGECESNRKYMEXXXXXXXXXXXXXKMQTTTTPSLSVITMPSNETL-----------CQNKYGDKYCEEFKSKGECTKNPDFMFIQCAKSCSKCKETKPGNDSLCKNIEKDNNCEQLKIRGECLRNVSYMRVNCAKTCFNCNA---------SVVDKPCVNSYMDSECDKWSKLGECQKNPNYMLLNCAKSCNNCD-------LIPSDGKDCFNIYRNDKCEKWSNAGECSKNPKFMLENCAKSCNNCKTSQQND-SNCVNINKNSECDKWSQMGECSKNPNYMLVNCAKSCNYCKFNKDLQ------------KNCVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSCDSERE----CLNTHNDAECSKWSSMGECTKNPKYMLVNCA 4206
            CQ     + +   C++   +  C   + +G C  + + +   C KTC  C   +++       C+N+  +  C+ W++ GEC+KNP +MK  C+++C  CDK       KI CKN+  D  C        C  N  +M   CA  C  C            ++ C ++Y    C SW    EC KNP FM K C KSC  C+TK      C N  +  +C  WS+ GECE N KYM  NC KSC     + +  +   S     + SN  L           C N + D  CEE+K  G C KN   MF QC KSC KC +T       C+N+  D +CE    +G+C +N+ +M + C K+C  C+            V+  C N + D  C+ + ++GECQK+  +M   CAK+C  C        +  +    C N+Y++  C +W+ +G C     F+L  C+KSC NC     N  + C N+  +  C KW   G C   PN M + CA SC  C F                  NC N   D +C  W+++ +C+KNP YM ++C K+C  C  E++    C + ++  +C  W++ GEC +   +M  NCA
Sbjct:   60 CQTFNETNLDFGYCENVYSDRICNFWKTEGFCSAKYRNVLKKCSKTCGNCNMTKDK-------CQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKK----VEKISCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSL---FTKSIKTNNSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNCLTKPKNDRNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPQITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSKTLE-----CQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKRMGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRFAQCQNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVINTANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTREKQQEGNCADKYSTIQCRTWANRGECNRQKVWMNENCA 658          

HSP 9 Score: 213.386 bits (542), Expect = 1.688e-57
Identity = 152/477 (31.87%), Postives = 221/477 (46.33%), Query Frame = -1
Query:   13 VCSNLANDTDCESWSKAGHCEKNVSYMLKFCAKSCKACNRLITTSLPSINCVNKLNDSTCETLKILGQCEKNSIFMIEKCGKSCGSCRPAKEKTFENKTCLNLYKDDTCDLWKKAGYCHIYPKFMLSHCLKSCGQCSEYSE---CKNLYNNIVCDKWAAEGECLKNSKFMIQLCLKSCGRCYDL-KNLKVNRTNSDGCENKYGDWSCEAWKQVGECERNPIFMNDQCSKSCGTCFKSTATSTSGPLRMSSVCKNFYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSCQNL-------------------------KFSLKVKCQNILTKEKCLKLKKAGECEKNSKQMAELCAYTCHKCNLSFVKPMEINQNPTKMRSSKFKCDNRAGDFQCSYWARQKQCELNASYMRLFCQKSCGACLM--------EKPGQVSCVDKFATMKCFSWSMRGECDRNGKWMTENCAKSCLVCQNN 1332
            VC N+ ++  C+ W   G C+ N  +M++ C K+C  C     T+L    C N  +D  C   K  G C      +++KC K+CG+C   K+K      C N+Y    C+ WK++G C   P FM   C K+C  C +  E   CKNL N+ VC+  A +  C KNS +M+Q+C  +C  C    K++K N    + C N Y    C++W+  GEC +NP FM   C+KSCG C        +        C+N  +   C+ W+K G+C+ N  +M INCA+SCN  +N                          K  +   C N+   + C + KK G C+KN K M   C  +C KC                  S   +C N   D  C  WA++ +CE N  +M + C KSCG C +        EK     C +KF    C S+   GEC ++  +M + CAK+C +CQ N
Sbjct:   23 VCKNVFDEKFCQLWKNDGECKTNREFMIENCGKTCGTCQTFNETNLDFGYCENVYSDRICNFWKTEGFCSAKYRNVLKKCSKTCGNCNMTKDK------CQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKVEKISCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTN----NSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNCLTKPKNDRN--------CENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPQITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKC------------------SKTLECQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQAN 463          
BLAST of SMED30016458 vs. Planmine SMEST
Match: SMESG000074510.1 (SMESG000074510.1)

HSP 1 Score: 439.113 bits (1128), Expect = 1.050e-137
Identity = 239/554 (43.14%), Postives = 338/554 (61.01%), Query Frame = -1
Query: 3280 GTTRSKRAVVVKSADQWPDGVIPYYIDRNAFNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQNCYSIVGMDYFAEQEVNLASPGCRHVRYFSWI*KREYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSFINEKGEPSIQVINESMIHLLLEVHEKDLSFLDAKVVNLYYKCADRCFQNVTCSAGGYIDQYCQCHTPESFESRRCQDKNDESWCIEQQKKGHCELRNKYMSFNCRKTCEKCFKHRNRFVIPIKECKNLEKNETCDAWEKRGECKKNPRYMKFNCKQSCGLCDKSTTTLAPKIECKNIYGDDKCNLWEAVGDCQNNKLFMELNCAKACGKCGTXXXXXXXXXXXXXXXDVYEENSCLSWADANECTKNPNFMHKMCKKSCKLCITKEPEK-------CTNQYDNLSCYVWSQTGECESNRKYMEXXXXXXXXXXXXXKMQTTTTPSLSVITMPSNETLCQNKYGDKYCEEFKSKGECTKNPDFMFIQCAKSCSKCKET 4920
             + R KRAV+   A +W +  IPYYID + FN EE++ L DAI+ WN ETCV FR K   D NWVKITGG  C+S VGM+   EQ ++LASP CR            YG YLHELGH +GL HEH R  R+ ++ +  + IQ  + + + +N+ S+   +++P+DLQS+MHYG  SF    G+P+I V N S+ HLL EV  KDLSFLD K++NL+YKCAD C + V+C   GY+D++CQCH PE+FE+RRC++KN++ WC +Q+K G+CE  +KYMS NCRKTC+KC+K++  F    K C+N EK++TC+ W KRGEC++NP YM   CK+SCG+C +  TT   +I+C+N   ++KC+   + G C  NK +M++NC K CG C + +  F      + C D   E +C  WA  NEC  N   M KMC+K+CK C   EP+K       C N Y++  C   S   +C ++  +M+  CKK+C+         +   +   IT P     C++ Y ++ C+  KSKG C + P    I C ++  K  E 
Sbjct:   24 SSIRDKRAVISTQATKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRKKVNDDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRF-----------YGTYLHELGHVLGLLHEHTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFSGHDGQPTINVKNSSLTHLLEEVDAKDLSFLDVKIINLHYKCADLCERKVSCPLNGYVDKFCQCHIPETFENRRCRNKNEDDWCTDQKKLGNCEYNSKYMSVNCRKTCDKCYKYKAIFDKGKKICRNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGICVEEMTTPMTQIDCRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCDSKTLIFTSTQSPELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNC---EPKKDKIQKPLCRNVYNDSICE--SMKAKCHTDAPFMKLRCKKTCE-------MCSKGQNSKFITSPP----CKDIYSNEKCKSLKSKGHCERYP----ILCLRNVLKLVEI 546          

HSP 2 Score: 128.642 bits (322), Expect = 2.587e-30
Identity = 107/317 (33.75%), Postives = 150/317 (47.32%), Query Frame = -1
Query:  388 AGHCEKNVS-----YMLKFCAKSCKACNRLITTSLPSINCVNKLNDSTCETLKILGQCEKNSIFMIEKCGKSCGSCRPAKEKTFEN--KTCLNLYKDDTCDLWKKAGYCHIYPKFMLSHCLKSCGQCSE-------YSECKNLYNNIVCDKWAAEGECLKNSKFMIQLCLKSCGRCYDLKNLKVNRTNS-DGCENKYGDWSCEAWKQVGECERNPIFMNDQCSKSCGTCFKSTATSTSGPLRMSSVCKNFYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSC---QNLKFSLKVKCQNILTKEKCLKLKKAGECEK 1284
            A  CE+ VS     Y+ KFC      C+  I  +  +  C NK  D  C   K LG CE NS +M   C K+C  C   K   F+   K C N  KD TC+ W K G C   P +M   C KSCG C E         +C+N      CD+  + G+C +N  +M   C K+CG C D K L    T S + C +K  + +C+ W +  ECE N   M   C K+C  C +        PL     C+N Y++ +C+  +    C +++ FM++ C ++C  C   QN KF     C++I + EKC  LK  G CE+
Sbjct:  232 ADLCERKVSCPLNGYVDKFCQ-----CH--IPETFENRRCRNKNEDDWCTDQKKLGNCEYNSKYMSVNCRKTCDKCYKYKA-IFDKGKKICRNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGICVEEMTTPMTQIDCRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFC-DSKTLIFTSTQSPELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNC-EPKKDKIQKPL-----CRNVYNDSICE--SMKAKCHTDAPFMKLRCKKTCEMCSKGQNSKFITSPPCKDIYSNEKCKSLKSKGHCER 531          

HSP 3 Score: 126.716 bits (317), Expect = 1.389e-29
Identity = 95/285 (33.33%), Postives = 135/285 (47.37%), Query Frame = -1
Query: 1798 RECLNTHNDAECSKWSSMGECTKNPKYMLVNCAXX--XXXXXXXNTDKG--TCSNINSDKECENWSKRGECAKNPKYMLINCAKSCNSCESATQLPTACTNI----HKNEDECRKWSEKGECSKNPNFMLENCAKSCNVC-------KFNNETKGCRNLDPNSDCESWKQAGECLNNEKYMKVQCGKSCGRCNAK----TYVDCKDIYQEDSCKAWKDLGECFKNPVFMLSKCSQTCGSCDMEKNPVVVET--CKNIDSNENCNTWQTAGECEKNPNYMLVNCAK 2589
            R C N + D  C+    +G C  N KYM VNC K+        +  DKG   C N   DK CENW+KRGEC +NP YM I C KSC  C    ++ T  T I       E++C +    G+C +N N+M  NC K+C  C             + C +      C+ W +  EC  N K M+  C K+C  C  K        C+++Y +  C++ K   +C  +  FM  +C +TC  C   +N   + +  CK+I SNE C + ++ G CE+ P   L N  K
Sbjct:  262 RRCRNKNEDDWCTDQKKLGNCEYNSKYMSVNCRKTCDKCYKYKAIFDKGKKICRNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGIC--VEEMTTPMTQIDCRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCDSKTLIFTSTQSPELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCEPKKDKIQKPLCRNVYNDSICESMK--AKCHTDAPFMKLRCKKTCEMCSKGQNSKFITSPPCKDIYSNEKCKSLKSKGHCERYPILCLRNVLK 542          

HSP 4 Score: 123.635 bits (309), Expect = 1.163e-28
Identity = 89/281 (31.67%), Postives = 135/281 (48.04%), Query Frame = -1
Query: 2614 CQNKYGDKYCEEFKSKGECTKNPDFMFIQCAKSCSKCKETKPGNDS---LCKNIEKDNNCEQLKIRGECLRNVSYMRVNCAKTCFNC----NASVVDKPCVNSYMDSECDKWSKLGECQKNPNYMLLNCAKSCNNCD---LIPSDGKD---CFNIYRNDKCEKWSNAGECSKNPKFMLENCAKSCNNC--KTSQQNDSNCVNINKNSECDKWSQMGECSKNPNYMLVNCAKSCNYCKFNKD----LQKNCVNTHKDSECESWSKRGECQKNPKYMLVNCAK 3399
            C+NK  D +C + K  G C  N  +M + C K+C KC + K   D    +C+N EKD  CE    RGEC RN  YM + C K+C  C       +    C N   + +CD+    G+C +N NYM +NC K+C  CD   LI +  +    CF+      C++W+   EC  N K M + C K+C NC  K  +     C N+  +S C+  S   +C  +  +M + C K+C  C   ++        C + + + +C+S   +G C++ P   L N  K
Sbjct:  264 CRNKNEDDWCTDQKKLGNCEYNSKYMSVNCRKTCDKCYKYKAIFDKGKKICRNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGICVEEMTTPMTQIDCRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCDSKTLIFTSTQSPELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCEPKKDKIQKPLCRNVYNDSICE--SMKAKCHTDAPFMKLRCKKTCEMCSKGQNSKFITSPPCKDIYSNEKCKSLKSKGHCERYPILCLRNVLK 542          

HSP 5 Score: 122.865 bits (307), Expect = 1.869e-28
Identity = 96/279 (34.41%), Postives = 138/279 (49.46%), Query Frame = -1
Query: 1957 KNCVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSC--------DSERECLNTHNDAECSKWSSMGECTKNPKYMLVNCAXXXXXXXXXNTDKGT---CSNINSDKECENWSKRGECAKNPKYMLINCAKSCNSCES------ATQLPTACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVC---KFNNETKGCRNLDPNSDCESWKQAGECLNNEKYMKVQCGKSCGRC----NAK--TYVDCKDIYQEDSCKAWKDLGECFKNPVFML 2715
            + C N ++D  C    K G C+ N KYM VNC K+C  C          ++ C N   D  C  W+  GEC +NP YM + C KSC  C    T   T   C N   +++C+     G+C +N  YM +NC K+C  C+S      +TQ P  C +   +E  C++W++  EC  N   M + C K+C  C   K   +   CRN+  +S CES K   +C  +  +MK++C K+C  C    N+K  T   CKDIY  + CK+ K  G C + P+  L
Sbjct:  262 RRCRNKNEDDWCTDQKKLGNCEYNSKYMSVNCRKTCDKCYKYKAIFDKGKKICRNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGICVEEMTTPMTQIDCRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCDSKTLIFTSTQSPELCFD-KLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCEPKKDKIQKPLCRNVYNDSICESMK--AKCHTDAPFMKLRCKKTCEMCSKGQNSKFITSPPCKDIYSNEKCKSLKSKGHCERYPILCL 537          

HSP 6 Score: 122.094 bits (305), Expect = 3.624e-28
Identity = 101/349 (28.94%), Postives = 157/349 (44.99%), Query Frame = -1
Query: 1186 ETKGCRNLDPNSDCESWKQAGECLNNEKYMKVQCGKSCGRC-NAKTYVD-----CKDIYQEDSCKAWKDLGECFKNPVFMLSKCSQTCGSCDME-KNPVVVETCKNIDSNENCNTWQTAGECEKNPNYMLVNCAKACKTCQKDDAKNV-------EKKCDDVYSDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTCDQLKN--NQTMCQNAYNDAICTKWKNMGECTKNPNFMLIQCKESCGKCEKLPKNTNCINLDNDKNCEKWAGENECTKNSKYMLERCFKXXXXXXXXXSAKTPSEVCSNLANDTDCESWSKAGHCEKNVSYMLKFCAKSCKACNRLITTS-LPSI 2181
            E + CRN + +  C   K+ G C  N KYM V C K+C +C   K   D     C++  ++ +C+ W   GEC +NP +M  KC ++CG C  E   P+    C+N    E C+   + G+C +N NYM VNC K C  C   D+K +        + C D  S+ +C +W     CE  S +M+  C KTC  C+  K+   + +C+N YND+IC   K   +C  +  FM ++CK++C  C K                          +NSK++                    S  C ++ ++  C+S    GHCE+     L+   K  +   RL+    LP++
Sbjct:  260 ENRRCRNKNEDDWCTDQKKLGNCEYNSKYMSVNCRKTCDKCYKYKAIFDKGKKICRNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGICVEEMTTPMTQIDCRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFC---DSKTLIFTSTQSPELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCEPKKDKIQKPLCRNVYNDSICESMK--AKCHTDAPFMKLRCKKTCEMCSK-------------------------GQNSKFI-------------------TSPPCKDIYSNEKCKSLKSKGHCERYPILCLRNVLKLVEIAVRLLKLKILPTV 559          

HSP 7 Score: 118.627 bits (296), Expect = 5.571e-27
Identity = 92/278 (33.09%), Postives = 132/278 (47.48%), Query Frame = -1
Query: 2497 CKNIEKDNNCEQLKIRGECLRNVSYMRVNCAKTCFNCNA--SVVDKP---CVNSYMDSECDKWSKLGECQKNPNYMLLNCAKSCNNCD---LIPSDGKDCFNIYRNDKCEKWSNAGECSKNPKFMLENCAKSCNNCK------TSQQNDSNCVNINKNSECDKWSQMGECSKNPNYMLVNCAKSCNYCKFNKD-LQKN-CVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSCD--------SERECLNTHNDAECSKWSSMGECTKNPKYMLVN 3258
            C+N  +D+ C   K  G C  N  YM VNC KTC  C    ++ DK    C N   D  C+ W+K GECQ+NP YM + C KSC  C      P    DC N    +KC++  + G+C +N  +M  NC K+C  C       TS Q+   C +      C +W++  EC  N   M   C K+C  C+  KD +QK  C N + DS CES   + +C  +  +M + C K+C+ C         +   C + +++ +C    S G C + P   L N
Sbjct:  264 CRNKNEDDWCTDQKKLGNCEYNSKYMSVNCRKTCDKCYKYKAIFDKGKKICRNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGICVEEMTTPMTQIDCRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCDSKTLIFTSTQSPELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCEPKKDKIQKPLCRNVYNDSICESM--KAKCHTDAPFMKLRCKKTCEMCSKGQNSKFITSPPCKDIYSNEKCKSLKSKGHCERYPILCLRN 539          

HSP 8 Score: 115.931 bits (289), Expect = 3.278e-26
Identity = 92/270 (34.07%), Postives = 131/270 (48.52%), Query Frame = -1
Query: 2113 CVNINKNSECDKWSQMGECSKNPNYMLVNCAKSCNYCKFNKDL----QKNCVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSCDSER-------ECLNTHNDAECSKWSSMGECTKNPKYMLVNCAXX------XXXXXXXNTDKGTCSNINSDKECENWSKRGECAKNPKYMLINCAKSCNSCES---ATQLPTACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVCKFNNETK-----GCRNLDPNSDCESWKQAGEC 2847
            C N N++  C    ++G C  N  YM VNC K+C+ C   K +    +K C N  KD  CE+W+KRGECQ+NP YM + C KSC  C  E        +C N   + +C +  S G+C +N  YM VNC K+           +S      C +  S++ C+ W+K  EC  N K M   C K+C +CE      Q P  C N++ N+  C   S K +C  +  FM   C K+C +C     +K      C+++  N  C+S K  G C
Sbjct:  264 CRNKNEDDWCTDQKKLGNCEYNSKYMSVNCRKTCDKCYKYKAIFDKGKKICRNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGICVEEMTTPMTQIDCRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCDSKTLIFTSTQSPELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCEPKKDKIQKP-LCRNVY-NDSICE--SMKAKCHTDAPFMKLRCKKTCEMCSKGQNSKFITSPPCKDIYSNEKCKSLKSKGHC 529          

HSP 9 Score: 114.775 bits (286), Expect = 9.526e-26
Identity = 90/281 (32.03%), Postives = 132/281 (46.98%), Query Frame = -1
Query:  679 KNTNCINLDNDKNCEKWAGENECTKNSKYMLERCFKXXXX-XXXXXSAKTPSEVCSNLANDTDCESWSKAGHCEKNVSYMLKFCAKSCKACNRLITTSLPSINCVNKLNDSTCETLKILGQCEKNSIFMIEKCGKSCGSCRPAKEKTFEN----KTCLNLYKDDTCDLWKKAGYCHIYPKFMLSHCLKSCGQCSEYSE------CKNLYNNIVCDKWAAEGECLKNSKFMIQLCLKSCGRCYDLKNLKVNRTNSDGCENKYGDWSCEAWKQVGECERNPIF 1488
            +N  C N + D  C        C  NSKYM   C K+C+      +      ++C N   D  CE+W+K G C++N  YM   C KSC  C   +TT +  I+C NKL +  C+ L   G+C +N  +M   C K+CG C  +K   F +    + C +   + TC  W K   C I  K M   C K+C  C    +      C+N+YN+ +C+   A  +C  ++ FM   C K+C  C   +N K     S  C++ Y +  C++ K  G CER PI 
Sbjct:  260 ENRRCRNKNEDDWCTDQKKLGNCEYNSKYMSVNCRKTCDKCYKYKAIFDKGKKICRNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGICVEEMTTPMTQIDCRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFC-DSKTLIFTSTQSPELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCEPKKDKIQKPLCRNVYNDSICESMKA--KCHTDAPFMKLRCKKTCEMCSKGQNSKF--ITSPPCKDIYSNEKCKSLKSKGHCERYPIL 535          

HSP 10 Score: 114.39 bits (285), Expect = 1.023e-25
Identity = 94/297 (31.65%), Postives = 137/297 (46.13%), Query Frame = -1
Query:   70 EYSECKNLYNNIVCDKWAAEGECLKNSKFMIQLCLKSCGRCYDLKNLKVNRTNSDGCENKYGDWSCEAWKQVGECERNPIFMNDQCSKSCGTCFKSTATSTSGPLRMSSV-CKNFYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSC--QNLKFSLKVK---CQNILTKEKCLKLKKAGECEKNSKQMAELCAYTCHKCNLSFVKPMEINQNPTKMRSSKFKCDNRAGDFQCSYWARQKQCELNASYMRLFCQKSCGACLMEKPGQVS-------CVDKFATMKCFSWSMRGECDR 921
            E   C+N   +  C      G C  NSK+M   C K+C +CY  K   +       C N   D +CE W + GEC+RNP +MN +C KSCG C +   T       M+ + C+N    + CD    NG C  N ++M++NC ++C  C  + L F+       C + L++  C +  K  ECE NSK M ++C  TC  C             P K +  K  C N   D  C   + + +C  +A +M+L C+K+C  C     GQ S       C D ++  KC S   +G C+R
Sbjct:  260 ENRRCRNKNEDDWCTDQKKLGNCEYNSKYMSVNCRKTCDKCYKYK--AIFDKGKKICRNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGICVEEMTTP------MTQIDCRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCDSKTLIFTSTQSPELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCE------------PKKDKIQKPLCRNVYNDSICE--SMKAKCHTDAPFMKLRCKKTCEMC---SKGQNSKFITSPPCKDIYSNEKCKSLKSKGHCER 531          

HSP 11 Score: 114.39 bits (285), Expect = 1.108e-25
Identity = 85/284 (29.93%), Postives = 134/284 (47.18%), Query Frame = -1
Query: 2350 DKPCVNSYMDSECDKWSKLGECQKNPNYMLLNCAKSCNNC----DLIPSDGKDCFNIYRNDKCEKWSNAGECSKNPKFMLENCAKSCNNC---KTSQQNDSNCVNINKNSECDKWSQMGECSKNPNYMLVNCAKSCNYCKFNKDLQKN------CVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSCDSERE------CLNTHNDAECSKWSSMGECTKNPKYMLVNCAXX----XXXXXXXNTDKGTCSNINSDKECENWSKRGECAKNPKYMLINCAK 3132
            ++ C N   D  C    KLG C+ N  YM +NC K+C+ C     +     K C N  ++  CE W+  GEC +NP +M   C KSC  C    T+     +C N  +  +CD+    G+C +N NYM VNC K+C +C     +  +      C +   +  C+ W+K  EC+ N K M   C K+CK+C+ +++      C N +ND+ C   S   +C  +  +M + C K+         S       C +I S+++C++   +G C + P   L N  K
Sbjct:  261 NRRCRNKNEDDWCTDQKKLGNCEYNSKYMSVNCRKTCDKCYKYKAIFDKGKKICRNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGICVEEMTTPMTQIDCRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCDSKTLIFTSTQSPELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCEPKKDKIQKPLCRNVYNDSICE--SMKAKCHTDAPFMKLRCKKTCEMCSKGQNSKFITSPPCKDIYSNEKCKSLKSKGHCERYPILCLRNVLK 542          

HSP 12 Score: 110.538 bits (275), Expect = 1.943e-24
Identity = 88/285 (30.88%), Postives = 136/285 (47.72%), Query Frame = -1
Query:  940 KKCDDVYSDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTCDQLK----NNQTMCQNAYNDAICTKWKNMGECTKNPNFMLIQCKESCGKC-EKLP---KNTNCINLDNDKNCEKWAGENECTKNSKYMLERCFKX----XXXXXXXXSAKTPSEVCSNLANDTDCESWSKAGHCEKNVSYMLKFCAKSCKACNRLITTSLPSINCVNKLNDSTCETLKILGQCEKNSIFMIEKCGKSCGSCRPAKEKTF-ENKTCLNLYKDDTCDLWKKAGYCHIYPKFMLSHCLK 1755
            ++C +   D  C   K  G CE  S  M V C KTC  C + K      + +C+N   D  C  W   GEC +NP +M I+CK+SCG C E++       +C N   ++ C++     +C +N  YM   C K+     +     +S ++P E+C +  ++  C+ W+K   CE N   M K C K+CK C       +    C N  NDS CE++K   +C  ++ FM  +C K+C  C   +   F  +  C ++Y ++ C   K  G+C  YP   L + LK
Sbjct:  262 RRCRNKNEDDWCTDQKKLGNCEYNSKYMSVNCRKTCDKCYKYKAIFDKGKKICRNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGICVEEMTTPMTQIDCRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCDSKTLIFTSTQSP-ELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCEPK-KDKIQKPLCRNVYNDSICESMK--AKCHTDAPFMKLRCKKTCEMCSKGQNSKFITSPPCKDIYSNEKCKSLKSKGHCERYPILCLRNVLK 542          

HSP 13 Score: 110.538 bits (275), Expect = 2.104e-24
Identity = 94/295 (31.86%), Postives = 135/295 (45.76%), Query Frame = -1
Query:  775 CQNAYNDAICTKWKNMGECTKNPNFMLIQCKESCGKCEKLPKNTN-----CINLDNDKNCEKWAGENECTKNSKYMLERCFKXXXXXXXXXSAKTPSEVCSNLANDTDCESWSKAGHCEKNVSYMLKFCAKSCKACNR--LITTSLPSIN-CVNKLNDSTCETLKILGQCEKNSIFMIEKCGKSCGSCRPAKEKTFENKTCLNLYKDDTCDLWKKAGYCHIYPKFMLSHCLKSCGQCSE--------YSECKNLYNNIVCDKWAAEGECLKNSKFMIQLCLKSCGRCYDLKNLKV 1611
            C+N   D  CT  K +G C  N  +M + C+++C KC K     +     C N + DK CE WA   EC +N  YM  +C KSC  C    +       C N   +  C+     G C +N +YM   C K+C  C+   LI TS  S   C +KL++ TC+      +CE NS  M + C K+C +C P K+K  +   C N+Y D  C+  K    CH    FM   C K+C  CS+           CK++Y+N  C    ++G C +     ++  LK       L  LK+
Sbjct:  264 CRNKNEDDWCTDQKKLGNCEYNSKYMSVNCRKTCDKCYKYKAIFDKGKKICRNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGICVEEMTTPMTQIDCRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCDSKTLIFTSTQSPELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCEPKKDK-IQKPLCRNVYNDSICESMK--AKCHTDAPFMKLRCKKTCEMCSKGQNSKFITSPPCKDIYSNEKCKSLKSKGHCERYPILCLRNVLKLVEIAVRLLKLKI 555          

HSP 14 Score: 107.071 bits (266), Expect = 2.681e-23
Identity = 86/290 (29.66%), Postives = 128/290 (44.14%), Query Frame = -1
Query: 2197 DGKDCFNIYRNDKCEKWSNAGECSKNPKFMLENCAKSCNNC----KTSQQNDSNCVNINKNSECDKWSQMGECSKNPNYMLVNCAKSCNYC---KFNKDLQKNCVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSCDSE----------RECLNTHNDAECSKWSSMGECTKNPKYMLVNCAXXXX--XXXXXNTDKGTCSNINSDKECENWSKRGECAKNPKYMLINCAKSCNSCE----SATQLPTACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNV 2997
            + + C N   +D C      G C  N K+M  NC K+C+ C        +    C N  K+  C+ W++ GEC +NP YM + C KSC  C         Q +C N  ++ +C+     G+C +N  YM VNC K+C  CDS+            C +  ++  C +W+   EC  N K M   C K+C     K     K  C N+ +D  CE  S + +C  +  +M + C K+C  C     S       C +I+ NE +C+    KG C + P   L N  K   +
Sbjct:  260 ENRRCRNKNEDDWCTDQKKLGNCEYNSKYMSVNCRKTCDKCYKYKAIFDKGKKICRNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGICVEEMTTPMTQIDCRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCDSKTLIFTSTQSPELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCEPKKDKIQKPLCRNVYNDSICE--SMKAKCHTDAPFMKLRCKKTCEMCSKGQNSKFITSPPCKDIYSNE-KCKSLKSKGHCERYPILCLRNVLKLVEI 546          

HSP 15 Score: 102.064 bits (253), Expect = 1.035e-21
Identity = 73/246 (29.67%), Postives = 116/246 (47.15%), Query Frame = -1
Query:   22 CENKYGDWSCEAWKQVGECERNPIFMNDQCSKSCGTCFKSTATSTSGPLRMSSVCKNFYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSC--QNLKFSLKVKCQNILTKEKCLKLKKAGECEKNSKQMAELCAYTCHKCNLSFVKPMEINQNPTKMRSSKFKCDNRAGDFQCSYWARQKQCELNASYMRLFCQKSCGACLMEKPGQVSCVDKFATMKCFSWSMRGECDRNGKWMTENCAKSCLVC 753
            C NK  D  C   K++G CE N  +M+  C K+C  C+K  A    G      +C+NF  +K C+ W K G+C+ N  +M I C +SC  C  +      ++ C+N L +EKC +L   G+C +N   M   C  TC  C+ S        Q+P         C ++  +  C  WA+  +CE+N+  M+  C+K+C  C  +K      + +         SM+ +C  +  +M   C K+C +C
Sbjct:  264 CRNKNEDDWCTDQKKLGNCEYNSKYMSVNCRKTCDKCYKYKAIFDKG----KKICRNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGICVEEMTTPMTQIDCRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCD-SKTLIFTSTQSPEL-------CFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCEPKKDKIQKPLCRNVYNDSICESMKAKCHTDAPFMKLRCKKTCEMC 497          

HSP 16 Score: 94.3597 bits (233), Expect = 2.296e-19
Identity = 84/292 (28.77%), Postives = 136/292 (46.58%), Query Frame = -1
Query: 3028 CKNIYGDDKCNLWEAVGDCQNNKLFMELNCAKACGKCGTXXXXXXXXXXXXXXXDVYEENSCLSWADANECTKNPNFMHKMCKKSCKLCITKEPEK-----CTNQYDNLSCYVWSQTGECESNRKYMEXXXXXXXXXXXXXKMQTTTTPSLSVITMPSNETLCQNKYGDKYCEEFKSKGECTKNPDFMFIQCAKSCSKCKETKPG-NDSLCKNIEKDNNCEQLKIRGECLRNVSYMRVNCAKTCFNCNAS-----VVDKPCVNSYMDSECDKWSKLGECQKNPNYMLLNCAK 3870
            C+N   DD C   + +G+C+ N  +M +NC K C KC       +       C++  ++ +C +WA   EC +NP +M+  CKKSC +C+ +         C N+ +   C      G+C  N+ YM+ NC+K+C FC    +  T+T S           LC +K  ++ C+ +    EC  N   M   C K+C  C+  K      LC+N+  D+ CE +K   +C  +  +M++ C KTC  C+       +   PC + Y + +C      G C++ P   L N  K
Sbjct:  264 CRNKNEDDWCTDQKKLGNCEYNSKYMSVNCRKTCDKC--YKYKAIFDKGKKICRNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGICVEEMTTPMTQIDCRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCDSKTLIFTSTQS---------PELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCEPKKDKIQKPLCRNVYNDSICESMK--AKCHTDAPFMKLRCKKTCEMCSKGQNSKFITSPPCKDIYSNEKCKSLKSKGHCERYPILCLRNVLK 542          

HSP 17 Score: 75.8702 bits (185), Expect = 1.644e-13
Identity = 58/200 (29.00%), Postives = 90/200 (45.00%), Query Frame = -1
Query:   19 CKNFYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSCQNLKFSL---KVKCQNILTKEKCLKLKKAGECEKNSKQMAELCAYTCHKCNLSFVKPMEINQNPTKMRSSKFKCDNRAGDFQCSYWARQKQCELNASYMRLFCQKSCGAC----LMEKPGQVS--CVDKFATMKCFSWSMRGECDRNGKWMTENCAKSCLVCQ 591
            C+N   +  C +  K G+C+ NS +M +NC ++C+ C   K      K  C+N    + C    K GEC++N   M   C  +C  C      PM           ++  C N+  + +C       +C  N +YM++ CQK+CG C    L+    Q    C DK +   C  W+   EC+ N K M + C K+C  C+
Sbjct:  264 CRNKNEDDWCTDQKKLGNCEYNSKYMSVNCRKTCDKCYKYKAIFDKGKKICRNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGICVEEMTTPM-----------TQIDCRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCDSKTLIFTSTQSPELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCE 452          

HSP 18 Score: 67.0106 bits (162), Expect = 9.636e-11
Identity = 52/147 (35.37%), Postives = 69/147 (46.94%), Query Frame = -1
Query:   22 KCQNILTKEKCLKLKKAGECEKNSKQMAELCAYTCHKCNLSFVKPMEINQNPTKMRSSKFKCDNRAGDFQCSYWARQKQCELNASYMRLFCQKSCGACL--MEKP-GQVSCVDKFATMKCFSWSMRGECDRNGKWMTENCAKSCLVC 453
            +C+N    + C   KK G CE NSK M+  C  TC KC     K   I     K+      C N   D  C  WA++ +C+ N  YM + C+KSCG C+  M  P  Q+ C +K    KC      G+C  N  +M  NC K+C  C
Sbjct:  263 RCRNKNEDDWCTDQKKLGNCEYNSKYMSVNCRKTCDKC----YKYKAIFDKGKKI------CRNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGICVEEMTTPMTQIDCRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFC 399          
BLAST of SMED30016458 vs. Planmine SMEST
Match: SMESG000074509.1 (SMESG000074509.1)

HSP 1 Score: 407.912 bits (1047), Expect = 3.395e-126
Identity = 235/558 (42.11%), Postives = 334/558 (59.86%), Query Frame = -1
Query:   16 CQNAYNDAICTKWKNMGECTKNPNFMLIQCKESCGKCEKLPKNTNCINLDNDKNCEKWAGENECTKNSKYMLERCFKXXXXXXXXXSAKTPSEVCSNLANDTDCESWSKAGHCEKNVSYMLKFCAKSCKACNRLITTSLPSINCVNKLNDSTCETLKILGQCEKNSIFMIEKCGKSCG-------SCRPAKEKTFENKT----------------CLNLYKDDTCDLWKKAGYCHIYPKFMLSHCLKSCGQCSEYSECKNLYNNIVCDKWAAEGECLKNSKFMIQLCLKSCGRCYDLKNLKVNRTN---SDGCENKYGDWSCEAWKQVGECERNPIFMNDQCSKSCGTCFKSTATSTSGPLRMSSVCKNFYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSCQNLKFSLKVKCQNILTKEKCLKLKKAGECEKNSKQMAELCAYTCHKCNLSFVKPMEINQNPTKMRSSKFKCDNRAGDFQCSYWARQKQCELNASYMRLFCQKSCGACLMEKPGQVSCVDKFATMKCFSWSMRGECDRNGKWMTENCAKSCLVCQN 1611
            CQN YN A+C KWK  GEC KNPNFM +QC+++C  C+K  +  +C NL ND+ CE  A ++ C KNS YML+ C  +CNNCS  + +   +  C NL +   C+SW   G C KN  +MLK CAKSC  C   +T      NC N  N+S CE    +G+CEKN  +M+  C KSC        +C PA        T                C NL++DD C+ WKK G C    K M S C KSCG+CS+  EC+N+Y++  C+ WA +G+C KN KFM+ LC+KSCG+C  L N ++  +    ++ C+NK+GD++CE+++++GEC+++ +FM D+C+K+CG C ++  T+TS        CKN Y +K+C+EW ++G C++ S F+   C++SC +C     +   +CQN+   E C K K  G CE     M   CA +C KC+  F  P  ++ +      +   C N AGD QCSYWARQ QCE N SYMR+ C+K+CG C  EK  + +C DK++T++C +W+ RGEC+R   WM ENCAKSC +CQ+
Sbjct:    6 CQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKVEKISCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNC---LTKPKNDRNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPQITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSKTLECQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKC-SLINFQIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLC-QANMTNTSIYSNKRMGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRFAQCQNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCD--FKSPTALSYSKPAKVINTANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTREKQQEGNCADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKICQD 556          

HSP 2 Score: 295.434 bits (755), Expect = 1.651e-86
Identity = 198/553 (35.80%), Postives = 273/553 (49.37%), Query Frame = -1
Query: 1780 CKNIEKDNNCEQLKIRGECLRNVSYMRVNCAKTCFNCNASVVDKPCVNSYMDSECDKWSKLGECQKNPNYMLLNCAKSCNNCDLIPSDGK---DCFNIYRNDKCEKWSNAGECSKNPKFMLENCAKSCNNCKTSQQNDSNCVNINKNSECDKWSQMGECSKNPNYMLVNCAKSCN--------------------------YCKFNKDLQKNCVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSCDSERECLNTHNDAECSKWSSMGECTKNPKYMLVNCAX-----XXXXXXXXNTDKGT---CSNINSDKECENWSKRGECAKNPKYMLINCAKSCNSCES-------ATQLPTACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVC--KFNNETKGCRNLDPNSDCESWKQAGECLNNEKYMKVQCGKSCGRCNAKT--------------YVDCKDIYQEDSCKAWKDLGECFKNPVFMLSKCSQTCGSCDMEKNPVVVETCKNIDSNENCNTWQTAGECEKNPNYMLVNCAKACKTCQ 3258
            C+N+     CE+ K  GEC +N ++M++ C KTC  C+  V    C N   D  C+  +K   C KN  YML  CA +CNNC L     K    C N+Y    C+ W   GEC KNPKFML++CAKSC NC T  +ND NC N+   S C++WS+MGEC KNP YML+NCAKSCN                          +      +  NC N  +D  CE W K G CQKN K M   C KSC  C    EC N ++D  C  W+  G+C KN K+ML+ C K     S  + +   ++K     C N   D  CE++ + GEC K+  +M   CAK+C  C++        +     C N++K++  C +W+E G C     F+L  C+KSC  C  K  N    C+N+  + +C+ WK  G C +    M+++C  SC +C+ K+                +C++I  +  C  W    +C KNP +M   C + CG C  EK       C +  S   C TW   GEC +   +M  NCAK+CK CQ
Sbjct:    6 CQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKVEKISCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNCLTKPKNDRNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPQITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSKTLECQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKRMGCKNVYKDKI-CNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRFAQCQNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVINTANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTREKQQ--EGNCADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKICQ 555          

HSP 3 Score: 275.404 bits (703), Expect = 1.602e-79
Identity = 191/572 (33.39%), Postives = 275/572 (48.08%), Query Frame = -1
Query:  469 CKDIYQEDSCKAWKDLGECFKNPVFMLSKCSQTCGSCDMEKNPVVVETCKNIDSNENCNTWQTAGECEKNPNYMLVNCAKACKTCQK-DDAKNVEKKCDDVYSDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTCDQLKNNQTMCQNAYNDAICTKWKNMGECTKNPNFMLIQCKESCGK---------------------------CEKLPKNTNCINLDNDKNCEKWAGENECTKNSKYMLERCFKXXXXXXXXXSAKTPSEVCSNLANDTDCESWSKAGHCEKNVSYMLKFCAKSCKACNRL---ITTSLPSIN--CVNKLNDSTCETLKILGQCEKNSIFMIEKCGKSCGSCRPAKEKT--FENKT--CLNLYKDDTCDLWKKAGYCHIYPKFMLSHCLKSCGQCS-----EYSECKNLYNNIVCDKWAAEGECLKNSKFMIQLCLKSCGRCYDLKNLK-------VNRTNSDGCENKYGDWSCEAWKQVGECERNPIFMNDQCSKSCGTCFKSTATSTSGPLRMSSVCKNFYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSCQNLK 2037
            C+++Y    C+ WK  GEC KNP FM  +C +TC  CD +   +   +CKN+ +++ C +      C+KN  YML  CA  C  C     +      C ++Y    C  W+ +G C K    M   C+K+CG C     N   C+N  N++ C +W  MGEC KNP +MLI C +SC K                            +K+P  +NC NL  D  CE+W     C KN K M  +C KSC  C       + +  C N+ +D  CE+W+K G CEKN+ +ML  C KSC  C+ +   I  S   +N  C NK  D TCE+ + +G+C+K+ +FM +KC K+CG C+     T  + NK   C N+YKD  C+ W ++G C     F+L+ C KSC  C+      +++C+N+  +  C KW + G C      M   C  SC +C D K+             N+  C N  GD  C  W +  +CE+NP +M   C K+CG C +          +    C + YS   C  W   G+C     +M  NCA+SC  CQ+ K
Sbjct:    6 CQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKVEKI---SCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNCLTKPKNDRNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPQITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKC-------SKTLECQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKRMGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRFAQCQNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKC-DFKSPTALSYSKPAKVINTANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTREK--------QQEGNCADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKICQDFK 558          

HSP 4 Score: 270.781 bits (691), Expect = 5.769e-78
Identity = 189/572 (33.04%), Postives = 276/572 (48.25%), Query Frame = -1
Query: 1039 ECLNTHNDAECSKWSSMGECTKNPKYMLVNCAXXXXXXXXXNTDKGTCSNINSDKECENWSKRGECAKNPKYMLINCAKSCNSCESATQ---LPTACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVCKFNNET-KGCRNLDPNSDCESWKQAGECLNNEKYMKVQCGKSCGR-------CNAKTYV---------------------DCKDIYQEDSCKAWKDLGECFKNPVFMLSKCSQTCGSCDMEKNPVVVETCKNIDSNENCNTWQTAGECEKNPNYMLVNCAKACKTCQ------KDDAKNVEKKCDDVYSDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTCDQLKNNQTM-------CQNAYNDAICTKWKNMGECTKNPNFMLIQCKESCGKC--EKLPKNTNCINLDNDKNCEKWAGENECTKNSKYMLERC--------FKXXXXXXXXXSAKTPSEV-CSNLANDTDCESWSKAGHCEKNVSYMLKFCAKSCKACNRLITTSLPSINCVNKLNDSTCETLKILGQCEKNSIFMIEKCGKSCGSCRPAKEKTFENK 2586
            +C N +N A C KW   GEC KNP +M + C +          +K +C N+ +D+ CE+ +K+  C KN  YML  CA +CN+C   T+      +C N++ +   C  W   GEC KNP FML++CAKSC  C    +  + C NL   S+CE W + GEC  N KYM + C KSC +       C+  T                       +C +++++D C+ WK +G C KN   M S+C ++CG C           C+N+  +++C  W   G+CEKN  +ML+ C K+C  C       ++  K+V  +C + + D +C  ++  G C+K  L MK KC+KTCG C     N ++       C+N Y D IC +W   G C     F+L  C +SC  C  + L +   C N+  D+NC+KW     C      M  +C        FKS    S S  AK  +   C N+A D  C  W++   CEKN SYM   C K+C  C R         NC +K +   C T    G+C +  ++M E C KSC  C+  K+  + N+
Sbjct:    5 KCQNVYNSAVCEKWKRSGECEKNPNFMKLQC-RKTCRFCDKKVEKISCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLY-HYRMCDSWEIDGECIKNPKFMLKSCAKSCGNCLTKPKNDRNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPQITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSK------TLECQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKRMGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRFAQCQNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVINTANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTR---EKQQEGNCADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKICQDFKDLKYNNE 565          

HSP 5 Score: 261.922 bits (668), Expect = 5.067e-75
Identity = 201/572 (35.14%), Postives = 280/572 (48.95%), Query Frame = -1
Query:  340 VVVETCKNIDSNENCNTWQTAGECEKNPNYMLVNCAKACKTCQKDDAKNVEK-KCDDVYSDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTCD----QLKNNQTMCQNAYNDAICTKWKNMGECTKNPNFMLIQCKESCGKCEKLPKN-TNCINLDNDKNCEKWAGENECTKNSKYMLERCFKXXXXXXXXXSAKTPSEV-----------------------CSNLANDTDCESWSKAGHCEKNVSYMLKFCAKSCKACNRLITTSLPSINCVNKLNDSTCETLKILGQCEKNSIFMIEKCGKSCGSCRPAKEKTFE-----NKTCLNLYKDDTCDLWKKAGYCHIYPKFMLSHCLKSCGQC-------SEYSE----CKNLYNNIVCDKWAAEGECLKNSKFMIQLCLKSCGRCYDLKNLKVNRTNSDGCENKYGDWSCEAWKQVGECERNPIFMNDQCSKSCGTC-FKS-TATSTSGPLRM--SSVCKNFYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSCQNLKFSLKVKCQNILTKEKCLKLKKAGECEKNSKQMAELCAYTCHKC 1908
            +  + C+N+ ++  C  W+ +GECEKNPN+M + C K C+ C K     VEK  C ++ +D  C     + LC+K S  M   C+ TC  C      +K N + C N Y+  +C  W+  GEC KNP FML  C +SCG C   PKN  NC NL N+ NCE+W+   EC KN KYML  C KSCN   ++    +P+                         C+NL  D  CE W K G C+KN   M   C KSC  C++       ++ C N  +D +CE     G+CEKN  FM+  C KSCG C     +  E     N  C N + D TC+ +++ G C     FM   C K+CG C       S YS     CKN+Y + +C++WA  G C   S F++ +C KSC  C       +NR     C+N  GD +C+ WK  G CE  P  M  +C+ SC  C FKS TA S S P ++  ++ C+N   +  C  W +   C+ N  +MRI+C ++C  C   K   +  C +  +  +C      GEC +    M E CA +C  C
Sbjct:    1 MTKDKCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKK----VEKISCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNS-CVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNCLTKPKNDRNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPQITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSK-------TLECQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKRMGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNC---TGKVLNRFAQ--CQNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVINTANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTREK-QQEGNCADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKIC 554          

HSP 6 Score: 256.914 bits (655), Expect = 2.821e-73
Identity = 187/569 (32.86%), Postives = 257/569 (45.17%), Query Frame = -1
Query:  772 CTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVCKFNNETKGCRNLDPNSDCESWKQAGECLNNEKYMKVQCGKSCGRCN-----AKTYVDCKDIYQEDSCKAWKDLGECFKNPVFMLSKCSQTCGSCDMEKNPVVVETCKNIDSNENCNTWQTAGECEKNPNYMLVNCAKAC------------------KTCQKDDAKNVEKK------CDDVYSDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTCDQLKNNQTMCQNAYNDAICTKWKNMGECTKNPNFMLIQCKESCGKCEKL---------PKNTNCINLDNDKNCEKWAGENECTKNSKYMLERCFKX----XXXXXXXXSAKTPSEVCSNLANDTDCESWSKAGHCEKNVSYMLKFCAKSCKACNRLITTSLPSINCVNKLNDSTCETLKILGQCEKNSIFMIEKCGKSCGSC-----------RPAKEKTFENKTCLNLYKDDTCDLWKKAGYCHIYPKFMLSHCLKSCGQCSEYSE----CKNLYNNIVCDKWAAEGECLKNSKFMIQLCLKSCGRCYDLKNLKVN 2307
            C N++ N   C KW   GEC KNPNFM   C K+C  C    E   C+NL  +  CES  +   C  N  YM   C  +C  C+      KT   C ++Y    C +W+  GEC KNP FML  C+++CG+C  +  P     C+N+ +  NC  W   GECEKNP YML+NCAK+C                       +   +V KK      C +++ D  C +WK  G C+K   +M  +C K+CG C +       CQN Y+D  C  W   G+C KN  FML+ C +SCGKC  +           N  C N   D  CE +    EC K+  +M ++C K+      N +++S        C N+  D  C  W+++G C    +++L  C+KSC  C   +        C N   D  C+  K  G CE     M  KC  SC  C           +PAK        C N+  D  C  W +   C   P +M   C K+CG C+   +    C + Y+ I C  WA  GEC +   +M + C KSC  C D K+LK N
Sbjct:    6 CQNVY-NSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKVEKISCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNCLTK--PKNDRNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPQITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSKT----LECQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKRMGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRFAQ--CQNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAK--VINTANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTREKQQEGNCADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKICQDFKDLKYN 563          

HSP 7 Score: 240.736 bits (613), Expect = 1.145e-67
Identity = 179/593 (30.19%), Postives = 270/593 (45.53%), Query Frame = -1
Query: 2491 RCQDKNDESWCIEQQKKGHCELRNKYMSFNCRKTCEKCFKHRNRFVIPIKECKNLEKNETCDAWEKRGECKKNPRYMKFNCKQSCGLCDKSTTTLAPKIECKNIYGDDKCNLWEAVGDCQNNKLFMELNCAKACGKCGTXXXXXXXXXXXXXXXDVYEENSCLSWADANECTKNPNFMHKMCKKSCKLCITKEPEKCTNQYDNLSCYVWSQTGECESNRKYMEXXXXXXXXXXXXXKMQTTTTPSLSVITMPSNETLCQNKYGDKYCEEFKSKGECTKNPDFMFIQCAKSCSKCKETKPGNDSLCKNIEKDNNCEQLKIRGECLRNVSYMRVNCAKTCFNCNA---------SVVDKPCVNSYMDSECDKWSKLGECQKNPNYMLLNCAKSCN-------NCDLIPSDGKDCFNIYRNDKCEKWSNAGECSKNPKFMLENCAKSCNNCKTSQQND-SNCVNINKNSECDKWSQMGECSKNPNYMLVNCAKSCNYCKFNKDLQ------------KNCVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSCDSERE----CLNTHNDAECSKWSSMGECTKNPKYMLVNCA 4170
            +CQ+  + + C + ++ G CE    +M   CRKTC  C K   +       CKNL+ ++ C++  K+  C KN  YM   C  +C  C   T ++     C N+Y    C+ WE  G+C  N  FM  +CAK+CG C T       P  D +C+++  E++C  W+   EC KNP +M   C KSC       P  C+     +S                                 Q T+   L V       + C N + D  CEE+K  G C KN   MF QC KSC KC +T       C+N+  D +CE    +G+C +N+ +M + C K+C  C+            V+  C N + D  C+ + ++GECQK+  +M   CAK+C        N  +  +    C N+Y++  C +W+ +G C     F+L  C+KSC NC     N  + C N+  +  C KW   G C   PN M + CA SC  C F                  NC N   D +C  W+++ +C+KNP YM ++C K+C  C  E++    C + ++  +C  W++ GEC +   +M  NCA
Sbjct:    5 KCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKVEKI-----SCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNCLT------KPKNDRNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCNK-RKNTPVNCSPATSTMS--------------------------------PQITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSKTLE-----CQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKRMGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRFAQCQNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVINTANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTREKQQEGNCADKYSTIQCRTWANRGECNRQKVWMNENCA 548          

HSP 8 Score: 234.572 bits (597), Expect = 1.104e-65
Identity = 184/598 (30.77%), Postives = 269/598 (44.98%), Query Frame = -1
Query: 2278 KIECKNIYGDDKCNLWEAVGDCQNNKLFMELNCAKACGKCGTXXXXXXXXXXXXXXXDVYEENSCLSWADANECTKNPNFMHKMCKKSCKLCI-----TKEPEKCTNQYDNLSCYVWSQTGECESNRKYMEXXXXXXXXXXXXXKMQTTTTPSLSVITMPSNETLCQNKYGDKYCEEFKSKGECTKNPDFMFIQCAKSCSKCKET----KPGNDSL---------------------CKNIEKDNNCEQLKIRGECLRNVSYMRVNCAKTCFNCNASVVDKPCVNSYMDSECDKWSKLGECQKNPNYMLLNCAKSCNNCDLIPSDGKD--------CFNIYRNDKCEKWSNAGECSKNPKFMLENCAKSCNNCKTSQQNDS-------NCVNINKNSECDKWSQMGECSKNPNYMLVNCAKSCNYCK---FNKDLQKNCVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSCD----------------SERECLNTHNDAECSKWSSMGECTKNPKYMLVNCAXXXXXXXXXNTDKGTCSNINSDKECENWSKRGECAKNPKYMLINCAKSCNSCESATQLPTACTNIHKNEDE 3879
            K +C+N+Y    C  W+  G+C+ N  FM+L C K C  C           +   CK++  +  C S A  + C KN  +M +MC  +C  C       K    C N Y    C  W   GEC  N K+M               +++      + +T P N+  C+N   +  CE +   GEC KNP +M I CAKSC+K K T     P   ++                     C N+ +D+ CE+ K  G C +N   M   C K+C  C+ ++    C N Y D  C+ W+K G+C+KN  +ML+ C KSC  C LI    ++        C N + +  CE +   GEC K+  FM + CAK+C  C+ +  N S        C N+ K+  C++W++ G C     ++L  C+KSC  C     N+  Q  C N   D  C+ W  RG C+  P  M + CA SC+ CD                +   C N   D +CS W+   +C KNP YM ++C K+C  C      +G C++  S  +C  W+ RGEC +   +M  NCAKSC  C+    L       + NED+
Sbjct:    3 KDKCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCD-------KKVEKISCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRMCDSWEIDGECIKNPKFM---------------LKSCAKSCGNCLTKPKNDRNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPQITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSKTL---ECQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKRMGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRFAQ--CQNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVINTANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTREKQQEGNCADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKICQDFKDLK------YNNEDQ 567          

HSP 9 Score: 196.438 bits (498), Expect = 1.029e-52
Identity = 151/474 (31.86%), Postives = 231/474 (48.73%), Query Frame = -1
Query: 2872 ESWCIEQQKKGHCELRNKYMSFNCRKTCEKCF-KHRNRFVIPIKECKNLEKNETCDAWEKRGECKKNPRYMKFNCKQSCGL-------CDKSTTTLAPKIE----------------CKNIYGDDKCNLWEAVGDCQNNKLFMELNCAKACGKCGTXXXXXXXXXXXXXXXDVYEENSCLSWADANECTKNPNFMHKMCKKSCKLCI-----TKEPEK-----CTNQYDNLSCYVWSQTGECESNRKYMEXXXXXXXXXXXXXKMQTTTTPSLSVITMPSNETL-CQNKYGDKYCEEFKSKGECTKNPDFMFIQCAKSCSKCKETKPGNDSLCKNIEKDNNCEQLKIRGECLRNVSYMRVNCAKTCFNCN-----ASVVDKP--------CVNSYMDSECDKWSKLGECQKNPNYMLLNCAKSCNNCDLIPSDGKDCFNIYRNDKCEKWSNAGECSKNPKFMLENCAKSCNNCK 4149
            +SW I+    G C    K+M  +C K+C  C  K +N      + C+NL     C+ W K GEC+KNP+YM  NC +SC         C  +T+T++P+I                 C N++ DD C  W+ +G CQ N   M   C K+CGKC           K  +C++VY++ SC +WA   +C KN  FM  +C KSC  C       +E EK     C N++ + +C  + + GEC+ +  +M+  C K+C              +++  ++ SN+ + C+N Y DK C E+   G C     F+   C+KSC+ C        + C+N+  D NC++ K RG C    + MR+ CA +C  C+     A    KP        C N   D +C  W++  +C+KNP+YM ++C K+C  C        +C + Y   +C  W+N GEC++   +M ENCAKSC  C+
Sbjct:  110 DSWEID----GECIKNPKFMLKSCAKSCGNCLTKPKND-----RNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPQITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCS----------KTLECQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTC---------GLCQANMTNTSIYSNKRMGCKNVYKDKICNEWAESGMCRNTSTFILTVCSKSCTNCTGKVLNRFAQCQNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVINTANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTREKQQEGNCADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKICQ 555          

HSP 10 Score: 170.244 bits (430), Expect = 6.880e-44
Identity = 122/378 (32.28%), Postives = 174/378 (46.03%), Query Frame = -1
Query:   13 CLNLYKDDTCDLWKKAGYCHIYPKFMLSHCLKSCGQCSEYSE---CKNLYNNIVCDKWAAEGECLKNSKFMIQLCLKSCGRCYDL-KNLKVNRTNSDGCENKYGDWSCEAWKQVGECERNPIFMNDQCSKSCGTCFKSTATSTSGPLRMSSVCKNFYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSCQNL-------------------------KFSLKVKCQNILTKEKCLKLKKAGECEKNSKQMAELCAYTCHKCNLSFVKPMEINQNPTKMRSSKFKCDNRAGDFQCSYWARQKQCELNASYMRLFCQKSCGACLM--------EKPGQVSCVDKFATMKCFSWSMRGECDRNGKWMTENCAKSCLVCQNN 1035
            C N+Y    C+ WK++G C   P FM   C K+C  C +  E   CKNL N+ VC+  A +  C KNS +M+Q+C  +C  C    K++K N    + C N Y    C++W+  GEC +NP FM   C+KSCG C        +        C+N  +   C+ W+K G+C+ N  +M INCA+SCN  +N                          K  +   C N+   + C + KK G C+KN K M   C  +C KC                  S   +C N   D  C  WA++ +CE N  +M + C KSCG C +        EK     C +KF    C S+   GEC ++  +M + CAK+C +CQ N
Sbjct:    6 CQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKVEKISCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTN----NSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNCLTKPKNDRN--------CENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPQITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKC------------------SKTLECQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQAN 353          

HSP 11 Score: 160.614 bits (405), Expect = 1.004e-40
Identity = 127/432 (29.40%), Postives = 197/432 (45.60%), Query Frame = -1
Query: 3013 RRCQDKNDESWCIEQQKKGHCELRNKYMSFNCRKTCEK----------------------CFKHRNRFVIPIKECKNLEKNETCDAWEKRGECKKNPRYMKFNCKQSCGLCDKSTTTLAPKIECKNIYGDDKCNLWEAVGDCQNNKLFMELNCAKACGKCGTXXXXXXXXXXXXXX--XDVYEENSCLSWADANECTKNPNFMHKMCKKSCKLC---------ITKEPEKCTNQYDNLSCYVWSQTGECESNRKYMEXXXXXXXXXXXXXKMQTTTTPSLSVITMPSNETLCQNKYGDKYCEEFKSKGECTKNPDFMFIQCAKSCSKC-----------KETKPGNDSLCKNIEKDNNCEQLKIRGECLRNVSYMRVNCAKTCFNCNASVVDKP-CVNSYMDSECDKWSKLGECQKNPNYMLLNCAKSCNNC 4173
            R C++  +ES C    K G CE   KYM  NC K+C K                         H  + +  +  C NL +++ C+ W+K G C+KN + M   C++SCG C K+       +EC+N+Y D  C  W   G C+ N  FM + C K+CGKC   +    + +K  +   ++ + + +C S+ +  EC K+  FM   C K+C LC          + +   C N Y +  C  W+++G C +   ++                ++ T  +  V+   +    CQN  GD+ C+++KS+G C   P+ M I+CA SC KC           K  K  N + C+NI  D  C     + +C +N SYMR++C K C  C      +  C + Y   +C  W+  GEC +   +M  NCAKSC  C
Sbjct:  144 RNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPQITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKCSKT-------LECQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKCSLINFQIEESEKHVNNRCQNKFGDFTCESYREIGECQKSFLFMKDKCAKTCGLCQANMTNTSIYSNKRMGCKNVYKDKICNEWAESGMCRNTSTFI-----------LTVCSKSCTNCTGKVLNRFAQ---CQNVAGDENCKKWKSRGHCESYPNSMRIKCALSCQKCDFKSPTALSYSKPAKVINTANCRNIAGDLQCSYWARQDQCEKNPSYMRISCRKACGVCTREKQQEGNCADKYSTIQCRTWANRGECNRQKVWMNENCAKSCKIC 554          

HSP 12 Score: 106.686 bits (265), Expect = 3.691e-23
Identity = 89/298 (29.87%), Postives = 124/298 (41.61%), Query Frame = -1
Query:   22 DGCENKYGDWSCEAWKQVGECERNPIFMNDQCSKSCGTCFKSTATSTSGPLRMSSVCK----------------------------------------NFYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSCQNLKFSLKVKCQNILTKEKCLKLKKAGECEKNSKQMAELCAYTCHKCNLSFV--KPMEINQNP----------TKMRSSKFKCDNRAGDFQCSYWARQKQCELNASYMRLFCQKSCGACLMEKPGQVSCVDKFATMKCFSWSMRGECDRNGKWMTENCAKSCLVC 759
            D C+N Y    CE WK+ GECE+NP FM  QC K+C  C K     +   L+   VC+                                        N Y  ++CD W  +G+C  N  FM  +CA+SC +C   K      C+N+  +  C +  K GECEKN K M   CA +C+K   + V   P     +P          TK       C N   D  C  W +   C+ N   M   C+KSCG C       + C + +    C +W+ +G+C++N K+M   C KSC  C
Sbjct:    4 DKCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCDKKVEKISCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNCL-TKPKNDRNCENLGNESNCERWSKMGECEKNPKYMLINCAKSCNKRKNTPVNCSPATSTMSPQITSNTLLHVTKKIPILSNCTNLFRDDICEEWKKMGSCQKNHKLMFSQCRKSCGKC----SKTLECQNVYDDQSCENWAKKGKCEKNMKFMLMLCMKSCGKC 296          

HSP 13 Score: 70.0922 bits (170), Expect = 9.081e-12
Identity = 52/149 (34.90%), Postives = 71/149 (47.65%), Query Frame = -1
Query:   22 KVKCQNILTKEKCLKLKKAGECEKNSKQMAELCAYTCHKCNLSFVKPMEINQNPTKMRSSKFKCDNRAGDFQCSYWARQKQCELNASYMRLFCQKSCGAC-LMEKPGQV--SCVDKFATMKCFSWSMRGECDRNGKWMTENCAKSCLVC 459
            K KCQN+     C K K++GECEKN   M   C  TC  C+                +  K  C N   D  C   A++  C+ N++YM   C  +C  C L  K  +   SCV+ +    C SW + GEC +N K+M ++CAKSC  C
Sbjct:    3 KDKCQNVYNSAVCEKWKRSGECEKNPNFMKLQCRKTCRFCD---------------KKVEKISCKNLQNDQVCESLAKKDLCDKNSAYMLQMCANTCNNCSLFTKSIKTNNSCVNLYHYRMCDSWEIDGECIKNPKFMLKSCAKSCGNC 136          
The following BLAST results are available for this feature:
BLAST of SMED30016458 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TLL11.265e-1531.43tolloid like 1 [Source:HGNC Symbol;Acc:HGNC:11843][more]
TLL12.137e-1531.43tolloid like 1 [Source:HGNC Symbol;Acc:HGNC:11843][more]
TLL12.181e-1531.43tolloid like 1 [Source:HGNC Symbol;Acc:HGNC:11843][more]
TLL25.435e-1529.94tolloid like 2 [Source:HGNC Symbol;Acc:HGNC:11844][more]
BMP15.910e-1531.18bone morphogenetic protein 1 [Source:HGNC Symbol;A... [more]
back to top
BLAST of SMED30016458 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tyr-38.103e-2335.02Putative tyrosinase-like protein tyr-3 [Source:Un... [more]
tyr-41.754e-2238.22TYRosinase [Source:UniProtKB/TrEMBL;Acc:O01497][more]
nas-131.526e-2125.00Zinc metalloproteinase nas-13 [Source:UniProtKB/S... [more]
hch-13.609e-2128.90Zinc metalloproteinase nas-34 [Source:UniProtKB/S... [more]
nas-334.334e-2125.26Zinc metalloproteinase nas-33 [Source:UniProtKB/S... [more]
back to top
BLAST of SMED30016458 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG57151.550e-2830.49gene:FBgn0039180 transcript:FBtr0084634[more]
CG67631.161e-2437.14gene:FBgn0039069 transcript:FBtr0084378[more]
CG67631.161e-2437.14gene:FBgn0039069 transcript:FBtr0334497[more]
CG66964.730e-2030.86gene:FBgn0030947 transcript:FBtr0074611[more]
CG152553.979e-1829.36gene:FBgn0028950 transcript:FBtr0080785[more]
back to top
BLAST of SMED30016458 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tll12.636e-1833.14tolloid-like 1 [Source:NCBI gene;Acc:474335][more]
tll12.636e-1833.14tolloid-like 1 [Source:NCBI gene;Acc:474335][more]
tll12.636e-1833.14tolloid-like 1 [Source:NCBI gene;Acc:474335][more]
c6ast31.407e-1731.47six-cysteine containing astacin protease 3 [Source... [more]
c6ast31.407e-1731.47six-cysteine containing astacin protease 3 [Source... [more]
back to top
BLAST of SMED30016458 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000006820.13.964e-1931.58astacin-like metalloendopeptidase [Source:NCBI gen... [more]
ENSXETT00000006778.14.241e-1931.58astacin-like metalloendopeptidase [Source:NCBI gen... [more]
astl2c6.656e-1830.32astacin-like metallo-endopeptidase 2 gene c [Sourc... [more]
astl2c7.117e-1830.32astacin-like metallo-endopeptidase 2 gene c [Sourc... [more]
astl2c7.834e-1830.32astacin-like metallo-endopeptidase 2 gene c [Sourc... [more]
back to top
BLAST of SMED30016458 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tll12.130e-1531.03tolloid-like [Source:MGI Symbol;Acc:MGI:106923][more]
Tll23.852e-1530.11tolloid-like 2 [Source:MGI Symbol;Acc:MGI:1346044][more]
Tll24.340e-1530.11tolloid-like 2 [Source:MGI Symbol;Acc:MGI:1346044][more]
Bmp16.958e-1531.76bone morphogenetic protein 1 [Source:MGI Symbol;Ac... [more]
Astl1.552e-1330.48astacin-like metalloendopeptidase (M12 family) [So... [more]
back to top
BLAST of SMED30016458 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P42674|BP10_PARLI7.722e-2529.50Blastula protease 10 OS=Paracentrotus lividus OX=7... [more]
sp|P98068|SPAN_STRPU4.922e-2328.57Protein SpAN OS=Strongylocentrotus purpuratus OX=7... [more]
sp|P0DJJ2|ASTL_CHICK8.120e-2232.13Astacin-like metalloendopeptidase OS=Gallus gallus... [more]
sp|A0FKN6|VMPA_LOXIN1.014e-2131.42Astacin-like metalloprotease toxin 1 OS=Loxosceles... [more]
sp|Q19673|TYR3_CAEEL1.031e-2135.02Putative tyrosinase-like protein tyr-3 OS=Caenorha... [more]
back to top
BLAST of SMED30016458 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3H5F63.190e-13830.46Metalloendopeptidase OS=Lingula unguis OX=7574 GN=... [more]
A0A2C9KD441.030e-12530.15Metalloendopeptidase OS=Biomphalaria glabrata OX=6... [more]
A0A1S3H8W22.397e-10132.37protein draper-like OS=Lingula unguis OX=7574 GN=L... [more]
A0A068Y1M81.571e-8742.21Metalloendopeptidase OS=Echinococcus multiloculari... [more]
A0A068WRN11.360e-8642.07Metalloendopeptidase OS=Echinococcus granulosus OX... [more]
back to top
BLAST of SMED30016458 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tll14.320e-1832.20tolloid-like 1 [Source:NCBI gene;Acc:474335][more]
c6ast15.013e-1831.12low choriolytic enzyme-like [Source:NCBI gene;Acc:... [more]
tll16.042e-1832.20tolloid-like 1 [Source:NCBI gene;Acc:474335][more]
c6ast31.101e-1734.09six-cysteine containing astacin protease 3 [Source... [more]
ENSAMXT00000033223.11.348e-1729.80high choriolytic enzyme 1-like [Source:NCBI gene;A... [more]
back to top
BLAST of SMED30016458 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000007253.11.461e-1731.25pep scaffold:Pmarinus_7.0:GL476910:54360:144194:-1... [more]
ENSPMAT00000004913.11.053e-1136.00pep scaffold:Pmarinus_7.0:GL478359:22377:26907:1 g... [more]
back to top
BLAST of SMED30016458 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016458 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO472612.962e-3326.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431327.057e-2829.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO301942.117e-2733.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424217.876e-2635.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO396271.735e-2431.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30016458 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000018637.22.890e-2030.65pep primary_assembly:ASM223467v1:3:32702055:327050... [more]
hce9.094e-2031.16Oryzias latipes protease (hce), mRNA. [Source:RefS... [more]
ENSORLT00000018649.22.765e-1833.76pep primary_assembly:ASM223467v1:3:32704054:327079... [more]
tll16.684e-1832.20tolloid like 1 [Source:NCBI gene;Acc:101160961][more]
tll18.416e-1832.20tolloid like 1 [Source:NCBI gene;Acc:101160961][more]
back to top
BLAST of SMED30016458 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074522.15.533e-15796.55SMESG000074522.1[more]
SMESG000074521.10.000e+095.32SMESG000074521.1[more]
SMESG000074509.12.107e-15341.72SMESG000074509.1[more]
SMESG000074510.11.050e-13743.14SMESG000074510.1[more]
SMESG000074509.13.395e-12642.11SMESG000074509.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016458 ID=SMED30016458|Name=SMED30016458|organism=Schmidtea mediterranea sexual|type=transcript|length=4980bp
ATGAAATTAATAATTGTTTTGACAAACCAAACAAGACTTAGCACAATTTT
CTGTCATCCATTTACCGTTTCTATCACATTCTCCTCTCATGGACCAACTG
AAACATTTCATTGTTGCAAACTTATCAACGCACGAGACTTGACCAGGCTT
TTCCATTAAGCACGCTCCACAAGACTTCTGACAAAATAATCTCATATAGG
ATGCGTTGAGCTCACATTGTTTCTGGCGCGCCCAATACGAACATTGAAAA
TCACCGGCACGATTGTCACATTTAAATTTACTGGATCTCATTTTCGTGGG
GTTTTGATTAATTTCCATGGGCTTGACAAAACTTAGGTTACATTTATGAC
AAGTATAAGCGCACAATTCTGCCATTTGCTTTGAATTCTTTTCACATTCT
CCAGCTTTTTTAAGTTTCAAACATTTCTCTTTGGTAAGGATATTTTGACA
TTTTACTTTCAAAGAAAACTTTAAGTTTTGACAACTATTGCAGGACCGAG
CACAATTGATTCTCATAAAGTCCGAGTTTGATTTACAGTCTCCGTTTTTT
GTCCATTCGTCGCATAATTTATTACTGTAGAAATTTTTGCAGACACTGCT
CATTCTCAAAGGACCACTTGTTGAGGTTGCCGTTGATTTGAAACAAGTTC
CACAACTTTTACTGCACTGATCATTCATAAAAATCGGATTTCTTTCACAT
TCTCCCACTTGTTTCCATGCTTCACAAGACCAATCGCCGTACTTATTTTC
ACAACCATCGGAGTTTGTTCTATTGACCTTTAGATTTTTTAAATCATAAC
ATCTTCCGCAGGACTTTAAACATAACTGAATCATGAATTTACTATTCTTC
AAGCACTCTCCTTCGGCTGCCCATTTATCACATACGATATTATTATACAG
ATTTTTACATTCCGAATATTCACTGCATTGACCGCAAGATTTGAGACAAT
GTGACAGCATAAATTTCGGATATATATGACAGTATCCAGCTTTTTTCCAT
AAATCACAGGTATCGTCTTTATATAAATTCAAACAAGTTTTATTTTCAAA
GGTCTTCTCCTTCGCTGGCCTACAAGATCCGCATGATTTTCCACACTTTT
CTATCATAAAAATTGAATTTTTTTCACATTGTCCCAGGATCTTTAACGTT
TCACACGTAGAATCATTCAATTTATTAACGCAGTTTATTGATGGCAAAGA
GGTCGTGATCAACCTGTTGCAAGCTTTACAAGATTTCGCACAGAACTTTA
ACATATAACTGACATTCTTTTCACAGTGACCAGCTTTACTCCAACTTTCA
CAATCGGTATCATTTGCAAGATTCGAGCATACTTCGGAAGGTGTTTTCGC
AGATGAACTACTTGAACAATTATTGCAAGATTTGAAGCATCTTTCTAACA
TATATTTGGAATTTTTTGTGCACTCGTTTTCTCCTGCCCATTTTTCACAG
TTCTTATCATTGTCAAGATTGATACAATTTGTATTCTTTGGTAATTTTTC
ACATTTTCCGCACGACTCCTTACATTGAATCAGCATGAAATTTGGATTTT
TTGTGCATTCACCCATATTTTTCCATTTAGTACAAATGGCATCATTGTAA
GCATTTTGACACATTGTTTGATTGTTTTTCAACTGGTCACAAGTGCCACA
GGTCTTTGAGCATTTCACTTTCATCACCAGAGACTGTTTTTCACACAATC
CTTCAGCTTTCCATTTCAAACACGATACGTCACTGTAAACGTCATCACAT
TTTTTTTCGACATTTTTCGCATCGTCTTTTTGACAAGTTTTGCAAGCTTT
GGCGCAATTTACCAACATATAATTTGGATTCTTTTCACATTCACCGGCAG
TTTGCCAAGTGTTGCAATTCTCATTGGAATCAATGTTTTTGCAGGTTTCA
ACAACCACTGGATTCTTTTCCATGTCACAACTTCCACAAGTCTGTGAACA
TTTCGATAGCATAAAAACTGGATTCTTGAAACATTCTCCTAAATCTTTCC
ACGCTTTACAAGAATCCTCCTGATATATATCTTTACAATCAACATACGTT
TTCGCGTTACATCTTCCGCAAGATTTCCCGCATTGAACTTTCATATACTT
TTCATTGTTCAAACATTCTCCAGCTTGCTTCCATGACTCACAGTCACTAT
TTGGGTCTAGATTCCTGCAGCCTTTTGTCTCGTTGTTAAATTTACAGACA
TTGCAAGACTTTGCACAGTTTTCCAACATGAAATTTGGATTTTTAGAACA
CTCTCCCTTTTCACTCCATTTTCGACATTCGTCTTCGTTTTTATGAATAT
TGGTACAAGCAGTTGGTAGCTGCGTTGCCGATTCACAGCTGTTGCATGAT
TTAGCACAGTTTATCAGCATATACTTTGGATTCTTTGCGCATTCTCCTCT
TTTACTCCAATTTTCACATTCTTTGTCGCTGTTTATGTTGGAACAAGTTC
CCTTATCTGTATTCGAGGACTTGCAACTATTACAGGATTTAGCACAATTC
ACTAACATATATTTAGGGTTTTTTGTGCATTCTCCCATGCTACTCCACTT
ACTACATTCTGCGTCATTATGCGTATTTAGACATTCTCTTTCTGAATCGC
AACTCTTACATGACTTGGCACAGTTTACCAACATATATTTCGGATTCTTT
TGGCATTCGCCTCTTTTGCTCCATGACTCACATTCACTGTCTTTGTGAGT
ATTGACGCAGTTCTTTTGTAGGTCTTTATTAAATTTGCAATAGTTACAAG
ACTTTGCGCAGTTCACCAACATATAATTTGGATTCTTAGAACATTCTCCC
ATTTGACTCCATTTGTCACATTCGCTATTCTTGTTGATATTGACACAATT
CGAATCATTTTGTTGACTGGTTTTACAATTATTGCATGACTTAGCACAAT
TCTCCAACATAAATTTTGGGTTTTTCGAACACTCTCCTGCGTTACTCCAT
TTTTCACACTTATCGTTTCGATATATATTGAAACAGTCTTTCCCATCGGA
TGGGATAAGATCACAATTATTGCAGGACTTGGCGCAATTCAGAAGCATGT
AATTTGGATTTTTTTGGCATTCTCCGAGTTTGCTCCATTTGTCACATTCG
CTATCCATGTAAGAATTGACGCAAGGTTTGTCGACTACACTCGCGTTGCA
ATTGAAGCAAGTCTTTGCACAATTCACTCGCATGTAACTGACATTTCTTA
GACATTCTCCTCTGATTTTTAGTTGTTCACAATTATTGTCTTTTTCAATA
TTTTTACAAAGAGAATCATTGCCGGGTTTTGTCTCTTTGCATTTTGAGCA
TGATTTTGCACACTGTATGAACATGAAATCAGGATTTTTTGTGCACTCCC
CTTTGGACTTGAATTCTTCACAATATTTATCTCCATATTTATTTTGGCAA
AGTGTTTCATTTGAAGGCATTGTAATCACCGAAAGACTTGGAGTTGTTGT
GGTTTGCATTTTGCTTCCGCCGCAAAACTTGCAGGATTTCTTACAATTCT
TTTCCATATATTTTCGATTGCTTTCACATTCACCTGTCTGTGACCATACA
TAGCATGACAAATTGTCATATTGGTTGGTACACTTTTCTGGTTCTTTCGT
GATACACAATTTACAAGATTTTTTACACATTTTATGCATAAAATTCGGAT
TTTTAGTACATTCATTAGCATCTGCCCACGACAAGCAAGAATTTTCTTCA
TAAACATCCTTGCAATCATCATCTTTATCTGGATCTAAAAAACCATCTGA
ATCAGTTCCACATTTCCCGCAAGCTTTAGCGCAATTTAGCTCCATAAATA
GCTTATTGTTCTGACAATCGCCAACAGCCTCCCATAAGTTACATTTATCA
TCGCCGTATATATTTTTACATTCGATTTTCGGAGCCAGAGTTGTTGTCGA
TTTGTCGCATAATCCACACGATTGTTTGCAATTAAATTTCATGTAGCGAG
GGTTTTTTTTGCACTCCCCTCGTTTTTCCCAAGCATCACAGGTTTCATTT
TTTTCCAAATTTTTGCATTCTTTTATTGGGATGACAAACCGGTTTCGGTG
TTTGAAACATTTTTCACAAGTTTTACGGCAATTAAATGACATATACTTAT
TCCTTAACTCACAGTGACCTTTTTTCTGTTGCTCGATGCACCAGGATTCA
TCGTTCTTGTCTTGACATCGTCGAGATTCAAAAGACTCGGGCGTATGACA
TTGACAGTATTGGTCAATGTACCCGCCAGCCGAACAAGTTACATTTTGAA
AGCAACGATCTGCACACTTGTAATACAAGTTCACAACTTTTGCGTCCAAA
AATGACAAATCCTTTTCATGAACTTCTAGAAGAAGATGTATCATAGATTC
GTTTATTACTTGTATTGAAGGTTCGCCTTTTTCATTGATAAATGATAATG
GTCCATAGTGCATGATAGATTGCAGGTCAAATGGCATATCGAAATCGAGG
GTATCCGATTTGTTATTCTTTTTAAATAAATCAACATTTTCGGCTTGTAT
ATTTTCTTCTACAATTTTTAAGTAATCATCTCTAATTGAACGCAGGTGCT
CATGATCAAGACCAATGGCGTGTCCGAGTTCATGCAGATAAAGTCCATAT
TCTCTTTTTTATATCCATGAAAAATATCTCACATGTCTACAGCCAGGTGA
AGCTAGGTTAACTTCTTGTTCAGCAAAATAATCCATGCCGACAATAGAAT
AACAGTTTTGTCCACCAGTGATCTTAACCCAGTTCCTATCACTTTCTCGC
TTTAATCTAAAATGAACGCAAGTTTCAAAGTTCCAAGTGTTGATAGCATC
CTGAAGGGATGAAACTTCTTCCTCGTTAAAAGCATTTCGGTCAATATAGT
ACGGAATCACTCCGTCCGGCCATTGGTCCGCAGATTTGACAACCACAGCC
CGCTTACTTCGAGTTGTCCCATCATGAAAGACGATAAAAAACCCAAAAAT
CAGCCCTAAAAAATTCCATGGAAATAAAAT
back to top

protein sequence of SMED30016458-orf-1

>SMED30016458-orf-1 ID=SMED30016458-orf-1|Name=SMED30016458-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=124bp
ILFPWNFLGLIFGFFIVFHDGTTRSKRAVVVKSADQWPDGVIPYYIDRNA
FNEEEVSSLQDAINTWNFETCVHFRLKRESDRNWVKITGGQNCYSIVGMD
YFAEQEVNLASPGCRHVRYFSWI*
back to top

protein sequence of SMED30016458-orf-2

>SMED30016458-orf-2 ID=SMED30016458-orf-2|Name=SMED30016458-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1477bp
MPFDLQSIMHYGPLSFINEKGEPSIQVINESMIHLLLEVHEKDLSFLDAK
VVNLYYKCADRCFQNVTCSAGGYIDQYCQCHTPESFESRRCQDKNDESWC
IEQQKKGHCELRNKYMSFNCRKTCEKCFKHRNRFVIPIKECKNLEKNETC
DAWEKRGECKKNPRYMKFNCKQSCGLCDKSTTTLAPKIECKNIYGDDKCN
LWEAVGDCQNNKLFMELNCAKACGKCGTDSDGFLDPDKDDDCKDVYEENS
CLSWADANECTKNPNFMHKMCKKSCKLCITKEPEKCTNQYDNLSCYVWSQ
TGECESNRKYMEKNCKKSCKFCGGSKMQTTTTPSLSVITMPSNETLCQNK
YGDKYCEEFKSKGECTKNPDFMFIQCAKSCSKCKETKPGNDSLCKNIEKD
NNCEQLKIRGECLRNVSYMRVNCAKTCFNCNASVVDKPCVNSYMDSECDK
WSKLGECQKNPNYMLLNCAKSCNNCDLIPSDGKDCFNIYRNDKCEKWSNA
GECSKNPKFMLENCAKSCNNCKTSQQNDSNCVNINKNSECDKWSQMGECS
KNPNYMLVNCAKSCNYCKFNKDLQKNCVNTHKDSECESWSKRGECQKNPK
YMLVNCAKSCKSCDSERECLNTHNDAECSKWSSMGECTKNPKYMLVNCAK
SCNSCKSSNTDKGTCSNINSDKECENWSKRGECAKNPKYMLINCAKSCNS
CESATQLPTACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVCKF
NNETKGCRNLDPNSDCESWKQAGECLNNEKYMKVQCGKSCGRCNAKTYVD
CKDIYQEDSCKAWKDLGECFKNPVFMLSKCSQTCGSCDMEKNPVVVETCK
NIDSNENCNTWQTAGECEKNPNYMLVNCAKACKTCQKDDAKNVEKKCDDV
YSDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTCDQLKNNQTMCQNAYNDA
ICTKWKNMGECTKNPNFMLIQCKESCGKCEKLPKNTNCINLDNDKNCEKW
AGENECTKNSKYMLERCFKSCNNCSSSSSAKTPSEVCSNLANDTDCESWS
KAGHCEKNVSYMLKFCAKSCKACNRLITTSLPSINCVNKLNDSTCETLKI
LGQCEKNSIFMIEKCGKSCGSCRPAKEKTFENKTCLNLYKDDTCDLWKKA
GYCHIYPKFMLSHCLKSCGQCSEYSECKNLYNNIVCDKWAAEGECLKNSK
FMIQLCLKSCGRCYDLKNLKVNRTNSDGCENKYGDWSCEAWKQVGECERN
PIFMNDQCSKSCGTCFKSTATSTSGPLRMSSVCKNFYSNKLCDEWTKNGD
CKSNSDFMRINCARSCNSCQNLKFSLKVKCQNILTKEKCLKLKKAGECEK
NSKQMAELCAYTCHKCNLSFVKPMEINQNPTKMRSSKFKCDNRAGDFQCS
YWARQKQCELNASYMRLFCQKSCGACLMEKPGQVSCVDKFATMKCFSWSM
RGECDRNGKWMTENCAKSCLVCQNNY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0002075pigment cell
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
PLANA:0007528glial cell
Vocabulary: INTERPRO
TermDefinition
IPR001506Peptidase_M12A
IPR024079MetalloPept_cat_dom_sf
IPR003582ShKT_dom
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
Vocabulary: molecular function
TermDefinition
GO:0004222metalloendopeptidase activity
GO:0008237metallopeptidase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003582ShKT domainSMARTSM00254ShkT_1coord: 756..794
e-value: 1.9E-6
score: 37.4
coord: 543..581
e-value: 1.8E-5
score: 34.2
coord: 649..687
e-value: 1.6E-4
score: 31.1
coord: 354..392
e-value: 1.3E-4
score: 31.3
coord: 167..205
e-value: 0.0012
score: 28.1
coord: 263..301
e-value: 1.2E-4
score: 31.4
coord: 309..347
e-value: 3.2E-6
score: 36.7
coord: 501..539
e-value: 8.0E-4
score: 28.7
coord: 452..490
e-value: 8.5E-5
score: 31.9
coord: 123..161
e-value: 1.2E-9
score: 48.0
coord: 595..633
e-value: 1.6E-7
score: 41.0
coord: 802..840
e-value: 4.1E-5
score: 33.0
coord: 403..441
e-value: 4.8E-8
score: 42.7
coord: 696..734
e-value: 0.068
score: 22.3
coord: 77..116
e-value: 6.1E-7
score: 39.0
coord: 31..69
e-value: 5.4E-8
score: 42.6
coord: 215..253
e-value: 1.3E-7
score: 41.3
IPR003582ShKT domainPFAMPF01549ShKcoord: 507..538
e-value: 0.0012
score: 19.3
coord: 802..839
e-value: 4.4E-5
score: 23.9
coord: 2..22
e-value: 0.024
score: 15.2
coord: 452..489
e-value: 2.4E-4
score: 21.6
coord: 78..115
e-value: 7.5E-7
score: 29.6
coord: 650..686
e-value: 3.3E-6
score: 27.5
coord: 544..580
e-value: 4.4E-5
score: 23.9
coord: 355..391
e-value: 0.005
score: 17.4
coord: 757..793
e-value: 1.9E-4
score: 21.9
coord: 215..252
e-value: 1.4E-5
score: 25.6
coord: 310..346
e-value: 4.3E-5
score: 24.0
coord: 263..300
e-value: 4.5E-5
score: 23.9
coord: 31..68
e-value: 9.2E-6
score: 26.1
coord: 124..160
e-value: 1.4E-9
score: 38.3
coord: 408..440
e-value: 2.8E-5
score: 24.5
coord: 697..733
e-value: 0.0012
score: 19.4
coord: 168..204
e-value: 8.4E-5
score: 23.0
coord: 596..632
e-value: 9.9E-6
score: 26.0
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 502..538
score: 9.676
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 650..686
score: 9.927
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 216..252
score: 11.114
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 310..346
score: 9.091
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 124..160
score: 11.822
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 803..839
score: 8.647
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 697..733
score: 8.191
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 32..68
score: 10.67
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 453..489
score: 8.307
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 82..115
score: 9.512
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 168..204
score: 8.6
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 355..391
score: 9.904
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 264..300
score: 9.764
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 596..632
score: 9.524
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 404..440
score: 10.103
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 1..22
score: 9.202
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 544..580
score: 9.325
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 757..793
score: 8.886
NoneNo IPR availablePANTHERPTHR11474TYROSINASE FAMILY MEMBERcoord: 751..808
NoneNo IPR availablePANTHERPTHR11474:SF73TYROSINASE-LIKE PROTEIN TYR-1-RELATEDcoord: 751..808