SMED30016453

Overview
NameSMED30016453
Smed IDSMED30016453
Length (bp)2498
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30016453 (SMED30016453) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30016453 (SMED30016453) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30016453 (SMED30016453) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30016453 (SMED30016453) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of SMED30016453 vs. TrEMBL
Match: K1QJE9 (Uncharacterized protein OS=Crassostrea gigas OX=29159 GN=CGI_10014990 PE=4 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 5.351e-46
Identity = 168/638 (26.33%), Postives = 282/638 (44.20%), Query Frame = 2
Query:   92 MGIRGLYSY-FAFDMKAYTIFNLVQKAKVVKNMEILVDFSSFRRDLDEIILRKIINDFDNDFLSISCVECDIFSKAYLEFHRMFAEIGIKLVWIYDGIKGLDEVVHNEKSETWSYRINKYSNLVDTLLECCKNKMPVKDLG-NVISRAYSL--TTLENLKASGVEVIKLLQGGSDEFIASEFH-RRQSYAIFSNDTDFLVFKDCRVIFPRILRDIYQDELPFMDTENPGNFFKRPTKLNCPIVTQSDVFRPLQFSTHEEIIILSILKGNDNTHNY-SQNLLYALGIAESLDRWPHISRVAKYIKSNHVNRNNLFDLDGMSTFLNENPEFKNTVNFCFDFYTLRHFERASGKTLINFDPGSADGSLTSFLQRKLSKMEISDSLYISHFGRYSCVFWIEKPIDAFATITTVMSEIRSRIYPYVLHADLDHVTEFKRRDAEGILINVVHSPFKSNLIISKPDPESERQNGVKYGIDIFEEIWSHLESQDSLNFVYQFGLEKGFLCYILRYLYKVTHGLNIEMTAKEFDAIFAMVFYRYRLSINMPFRTNLNQDIFLGMKICPTEKCLTIFSWFMEIYSTAKYFCGGALNLLKDFPKAENVMSSTVFIAFYENNVNDINKRVD-HLDESVIGMIQDLENEIL 1984
            MGIRGL S+      +     +LV  AK    +EI+VDF SF   +     + + +  +N FL I   E          F  +F ++ I  V+I D  KG  E    +K +TW  R +K    ++ ++  C+ +  + +L   + +R   L    +E L + G E+I+ + G +D  IA   H R +++AI+SND+DF VF  CR I P  L DIY      +  E P     +P  + C I++   V   L F +   ++ LSI+ GND T  Y S  L   + I   +     +   A+++K      N+      ++  ++ N  F   V     FY L+           N +     G  +  L  K+S ++    L   H   Y      E            ++E+R+ IY  VL    + V E+ R   + + I  V +    NL    P     +++ + + ++ F  I SH E  +   +  ++G + GF+ Y LRY   +  G N+++  +EF A+ A+VF R R            ++ +  ++I PT +C++I +WF+++Y  A  F G  L L  +FP  E + S +V+  FY    +D          + V+  IQD  N ++
Sbjct:    1 MGIRGLLSHCLRRREECVDEVDLVALAKSRGGIEIIVDFYSFEHMVVPKFWKGLSSLRNNQFLKILGGEYKSLETFIKRFIEIFRQLKISFVFIKDATKGCSEANSQQKLDTWMKRHHKEVENLNEVINVCRGRKEMSNLDEQMFTRPVCLEIQIVETLMSCGCEIIQSVTGEADFMIAKALHDREKAFAIWSNDSDFCVFDKCRFI-PNDLFDIYNGLQMGLPIEVP----VKPESVWCGIISSEKVRFSLGFQSPHLMVELSIIAGNDFTSQYVSTGLNRQIDIRGRIG----VETFAEWVKRYRGIENHPM----LNREMSRNVSFARAVEHSRMFYCLQS----------NPEEIVHKGYFSKLLAEKISSLKYPSHLMAMHNNFYWHRLLQEDTTRGQPCAEEALTELRALIYRIVLPRRENLVNEYGRSPWDTLRIEGVLAIDDPNL----PALHKIQEDKIFWNLNSFHYIMSHQEPVERPKWFDRYGRKNGFIVYCLRYFLLLNWGRNLQLQQQEFLALCALVFARPR------------EEHYQQIQIRPTPRCVSIGNWFLDVYRHAFLFLGKLLYLTHEFPLPEEIYSGSVWTCFYMCCKDDTYYAASRQTTQEVLSWIQDQMNAVI 599          
BLAST of SMED30016453 vs. TrEMBL
Match: A0A1S3HAE6 (uncharacterized protein LOC106153553 OS=Lingula unguis OX=7574 GN=LOC106153553 PE=4 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 3.322e-40
Identity = 153/613 (24.96%), Postives = 264/613 (43.07%), Query Frame = 2
Query:   92 MGIRGLYSYFAFDM-KAYTIFNLVQKAKVVKNMEILVDFSSFRRDLDEIILRKIINDFDNDFLSISCVECDIFSKAYLEFHRMFAEIGIKLVWIYDGIKGLDEVVHNEKSETWSYRINKYSNLVDTLLECCKNKMPVKDLG---NVISRAYSLTTLENLKASGVEVIKLLQGGSDEFIASEF-HRRQSYAIFSNDTDFLVFKDCRVIFPRILRDIYQDELPFMDTENPGNFFKRPTKLNCPIVTQSDVFRPLQFSTHEEIIILSILKGNDNTHNYSQNLLYALGI--AESLDRWPHISRVAKYIKSNHVNRNNLFDLDGMSTFLNENPEFKNTVNFCFDFYTLRHFERASGKTLINFDPGSADGSLTSFLQRKLSKMEISDSLYISHFGRYSCVFWIEKPIDAFATITTVMSEIRSRIYPYVLHADLDHVTEFKR---RDAEGILINVVHS--PFKSNLIISKPDPESERQNGVKYGIDIFEEIWSHLESQDSLNFVYQFGLEKGFLCYILRYLYKVTHGLNIEMTAKEFDAIFAMVFYRYRLSINMPFRTNLNQDIFLGMKICPTEKCLTIFSWFMEIYSTAKYFCGGALNLLKDFPKAENVMSSTVFIAFY 1894
            MG+RGL SY   +  +    ++L+++A     +EIL+D+ SF++ +     + +     N +L +   E         +  +    +GI +V+  DG KG       +K ETW  R  K    +  L + CK  M ++ L    NV      +  L  LK    E+I+   G +D  IA    HR +++A+ SND+DF + ++ R I P  L D+       +         ++P  L   ++T   V +   F +H  ++ LSI+ GND T +Y ++L   L +  A+ ++ +    R  K I+++ +          ++  L  NP+F   V     FYTL              D  +    L+ +L++ +    +  ++   H   Y   F +E            +  +R+ IY  VL    ++V E+ R    D + I ++  H+  P  SN+   KPD   E        + +F  I  H E    LNF  ++G + GF+  ILRY   +  G N+ +T  EF ++ A  F             +     +  + I P+ +C+TI +WF  +Y  A  F G  L L ++FP    + +   + AFY
Sbjct:    1 MGVRGLLSYCLCNQEQCVEYYDLIEEANRKGGLEILIDYYSFQQMILTNFWKSLRAVKHNPYLRLEGGEYSTLDAYLSKLVQDLQSLGIHMVFYIDGAKGSSYFSTQQKLETWKSRHYKELRTLKQLTDVCKGVMDIQALPDDVNVRPVLLEVQVLGTLKKCNCEIIQNSCGEADFVIAEGLIHRPKAFAVLSNDSDFCIMQNSRFI-PNELFDLDNA----IQLGQASLLPQKPISLKVGVITTERVLQLFGFRSHRLLVDLSIVNGNDFTAHYMKSLYNLLDVRGAKKVENFAGWMRHYKGIENHPI----------LARELQYNPQFATAVMTSRQFYTLTAPP----------DRPTMKCPLSEYLEQAVQHGALPSNIMAMHSNFYWHRFLLEDSTPGLPCAEVALQSLRTFIYRMVLPRYENYVYEYGRTPDSDLKTIQVHAAHASLPPVSNI---KPDRTFE-------SLKLFHRIMMHQEPDFELNFFQRYGRKSGFIFCILRYFLVLNWGQNLYITPVEFLSVLATAF----------GWEHHKDQWYQNIAIRPSSRCVTIGNWFQALYRYAYNFLGQMLYLNQEFPPPHEIFAGARWTAFY 568          
BLAST of SMED30016453 vs. TrEMBL
Match: A0A0L8GFX0 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22034150mg PE=4 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 1.605e-39
Identity = 165/660 (25.00%), Postives = 295/660 (44.70%), Query Frame = 2
Query:   92 MGIRGLYSYFAFDMKAYTIF-NLVQKAKVVKNMEILVDFSSFRRDLDEIILRKIINDFDNDFLSISCVECDIFSKAYLEFHRMFAEIGIKLVWIYDGIKGLDEVVHNEKSETWSYRINKYSNLVDTLLECCKNKMPVKD-LGNVISRAY--SLTTLENLKASGVEVIKLLQGGSDEFIASEFHRRQSYAIFSNDTDFLVFKDCRVIFPRILRDIYQDELPFMDTENPGNFFKRPTKLNCPIVTQSDVFRPLQFSTHEEIIILSILKGNDNTHNY---SQNLLYALGIAESLDRWPHISRVAKYIKS-NHVNRNNLFDLDGMSTFLNENPEFKNTVNFCFDFYTLRHFERASGKTLINFDPGSADGSLTSFLQRKLSKMEISDSLYISHFGRYSCVFWIEKPIDAFATITTVMSEIRSRIYPYVLHADLDHVTEFKRRDAEGILINVVHSPFKSNLIISKPDPESERQNGVKYGIDIFEEIWSHLE----SQD-SLNFVYQFGLEKGFLCYILRYLYKVTHGLNIEMTAKEFDAIFAMVFYRYRLSINMPFRTNLNQDIFLGMKICPTEKCLTIFSWFMEIYSTAKYFCGGALNLLKDFPKAENVMSSTVFIAFY-----ENNVNDINKRVDHLDESVIGMIQDL---ENEILECL-DGPY 2005
            MG++GL+SY   + K    F +LV+ A+  K +EILVD+  F   + +  +  ++N   N +L +   E    S       +    + I L ++ DG +G  +     +  TW  R  K    +  +L    N++ ++D L + I R     +     L   G +V+    G +D+ +A +    +++AIFS D+DF +FKDC  I P++  DI+ D    M+ E  G   K+P  L   +++   V      S+ +E+I L+I+ GND T +Y   +Q LLY L I E   R   +  +  ++KS   +  + L D +     +  N EF   V     FY L          L+     +  GSLT  +  +L    +   +  +H G Y      E   + +  I T++S +RS IY  +L  +   V ++    +  I+ + V       L    P  E  ++  + + + IF +I +  E    +QD   N+  ++G   GF+ Y LRY   +    N+ +T +EF  +  ++F            T+  +  +    + PT +C+TI +W  +I+  A  + G  L L ++FP+   + S + ++ +Y     EN+   +N     L E     + D+   +  +++CL DG +
Sbjct:    1 MGVQGLFSYCLKNQKQCCTFVDLVEVAREQKGIEILVDYYCFANWVYDKFMTNLLNINKNKYLLLYGGEYSSLSLYVTALIKNLQSVDIHLTFLIDGARGSCKETTKRRLNTWLSRSQKDMRKIKNMLSVFYNEISIEDLLCDDIVRPVLRDMIFTSALTECGCKVVN-CSGEADDMMAKQLLDSKAFAIFSYDSDFCLFKDCCCIPPKLF-DIHND----MELEYCGEVPKKPLHLQIGLISTERVSHMFGLSS-DELIELAIVCGNDLTSHYMRNNQTLLYKLDIRE---RKNQLENIVAWVKSYKRIENHPLLDNE-----MRNNSEFALAVQLSRSFYKLE---------LVQDYDDNNKGSLTELVIERLKTKTLHPKMLGAHHGLYWQKVLFEDLYNYWPGIETLLSNLRSCIYRILLPLNEMGVIDYGWDQSLTIMPHTVSVAKWKWL----PQFEEIKKENISHNLKIFHKIITQQEPGWKTQDWPRNYFIRYGRHNGFIFYCLRYFLLLNWQHNLFITEREFLTLICLLF------------THKEEKQYQRYPLTPTSRCITINNWMQDIFHHAYGYLGTLLFLTEEFPRPATLFSGSTWVVYYWCFCSENSPAQLNSEQRKLFEETRHKLNDIIYEKRHMIKCLVDGVF 620          
BLAST of SMED30016453 vs. TrEMBL
Match: A0A210QAR5 (Uncharacterized protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT01511 PE=4 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 7.375e-39
Identity = 156/610 (25.57%), Postives = 265/610 (43.44%), Query Frame = 2
Query:   92 MGIRGLYSYFAFDMKAYTI-FNLVQKAKVVKNMEILVDFSSFRRDLDEIILRKIINDFDNDFLSISCVE---CDIFSKAYLEFHRMFAEIGIKLVWIYDGIKGLDEVVHNEKSETWSYRINKYSNLVDTLLECCKNKMPVKDLG-NVISRAYSLTTLENLKASGVEVIKLLQGGSDEFIASEFHRRQ-SYAIFSNDTDFLVFKDCRVIFPRILRDIYQDELPFMDTENPGNFFKRPTKLNCPIVTQSDVFRPLQFSTHEEIIILSILKGNDNTHNYSQNLLYALGIAESLD-RWPHISRVAKYIKSNHVNRNNLFDLDGMSTFLNENPEFKNTVNFCFDFYTLRHFERASGKTLINFDPGSADGSLTSFLQRKLSKMEISDSLYISHFGRYSCVFWIEKPIDAFATITTVMSEIRSRIYPYVLHADLDHVTEFKRRDAEGILINVVHSPFKSNLIISKPDPESERQNGVKYGIDIFEEIWSHLESQ--DSLNFVYQFGLEKGFLCYILRYLYKVTHGLNIEMTAKEFDAIFAMVFYRYRLSINMPFRTNLNQDIFLGMKICPTEKCLTIFSWFMEIYSTAKYFCGGALNLLKDFPKAENVMSSTVFIAFY 1894
            MG+RGL S       A     +L+Q A+    +EILVD+ SF   + E     + +   ND+L I   E    D++ K  ++       +GI+LV+  DG +G       EK +TW  R ++    +  ++  C   MP+ +L  NV +          L+    EV +   G +D  IA   H+R+ +YA+FSND+DF +F+DC  I PR   D+  D       + P     +P +L   ++T   V   L    H+ ++ LSI+ GND T  Y    ++  G+ + L+ +   I  VA +I+ + V   +       +  +  N  F+  V    +FY L          +    P S  G L+  L++ + +      +   H   Y     +E   +        ++ +R+ +Y  VL      V E+ R   E +    V +   SN+    P     + + + + +  F  I SH+E +      +  ++G + GF  Y+LRY   +  G N+ +T  EF A+ AM       S+  P         + G+ + PT +C+T+ SW+ ++Y  A  F G  L++  +FP      S  V+  FY
Sbjct:    1 MGVRGLLSACMRQRNACVHEVDLIQVARERGGIEILVDYYSFELFVMEQFWFSLCHHQHNDYLWILGGEYASLDVYLKKLIQH---LKALGIQLVFFVDGARGASTETTREKLDTWIERHHRELGKIRDIMSVCCGFMPITELQENVRATLQEEQFKHTLRQCDCEVYQDPAGEADCVIAQALHQREKAYAVFSNDSDFCIFRDCTFI-PRTQFDLMGDLQLGAVCDMP----IKPERLMVGVITTDRVMAILGLPRHDLLVELSIVGGNDFTGQY----IHKGGLQQKLEIKGRGIEGVADWIRDHTVPETHPV----FAQEMRHNMGFRGAVVHSRNFYNL---------GVPPLKP-SKTGHLSQILEKGIREGHFVARVMGMHNNFYWHRAVVEDLSEGQPCAEVALAPLRAHVYRIVLQRHESMVEEYGRSPWEPMRTAGVLAVEDSNI----PSIHRIQPDKIFWNLKHFHYIMSHMERRTGSESKWFERYGRKTGFSVYLLRYFLLLNWGRNLFVTENEFLALLAM-------SLGRPSAAK-----YQGICVRPTPRCVTLGSWYQDLYYHAYCFLGKLLSISHEFPLPCEAYSGAVWTVFY 568          
BLAST of SMED30016453 vs. TrEMBL
Match: A0A2T7PUB9 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_04002 PE=4 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 6.993e-34
Identity = 158/619 (25.53%), Postives = 265/619 (42.81%), Query Frame = 2
Query:   92 MGIRGLYSYFA-FDMKAYTIFNLVQKAKVVKNMEILVDFSSFRRDLDEIILRKIINDFD-NDFLSISCVECDIFSKAYLEFHRMFAEIGIKLVWIYDGIKGLDEVVHNEKSETWSYRINKYSNLVDTLLECCKNKMPVKDL---GNVISRAYSLTTLENLKASGVEVIKLLQGGSDEFIASEF-HRRQSYAIFSNDTDFLVFKDCRVIFPRILRDIYQDELPFMDTENPGNFFKRPTKLNCPIVTQSDVFRPLQFSTHEEIIILSILKGNDNTHNYSQNLLYALGIAESLD--RWPHISRVAKYIKSN-HVNRNNLFDLDGMSTFLNENPEFKNTVNFCFDFYTLRHFERASGKTLINFDPGSADGSLTSFLQRKLSKMEISDSLYISHF-GRYSCVFWIEKPID---AFATITTVMSEIRSRIYPYVLHADLDHVTEFK---RRDAEGILINVVHSPFKSNLIISKPDPESERQNGVKYGIDIFEEIWSHLESQDSLNFVY--QFGLEKGFLCYILRYLYKVTHGLNIEMTAKEFDAIFAMVFYRYRLSINMPFRTNLNQDIFLGMKICPTEKCLTIFSWFMEIYSTAKYFCGGALNLLKDFPKAENVMSSTVFIAFY 1894
            MGIRGL S       +     NL++ A     +E++VDF SF   +    L K +  F  N+ L I   E         +       +GI  V++ DG KG        K +TW  R          +LE C     + +L     +      +  ++ L+ +G EVI++ +G +D  IA +F  R ++YA+ SND+DF +FK+   I P+ L DI  D         P    ++PT+L C +V    V + L+F   E ++ LSI+ GND T  +  +     G A+ L    +  I   A +++ +  V  N +F  + M      N    N V     FY+L          LI       DG + + +  +     +    Y ++F   Y C +W    +D     A    +++ +R+ +Y  +L      VTE+    R+D + +    V+     NL    P     R+N +   + +F  I + LE   +    +  ++G + GF+ YILRY   +  G  + +T  EF A+ A  F   +            +  +  +++CP  +CLTI + F +IY  A  F G  L+L  +FP  + + S +++   Y
Sbjct:    1 MGIRGLMSVIQKHSSECSQTVNLIEIAHEKGGIELVVDFYSFEHLVITDSLWKSLGSFKMNESLRIMGAEYATIDAYISKLITDLKSLGISFVFVLDGSKGSSYADTRHKIDTWKRRHRNDVQRKRDILEMCSGHKLMTELQEDAAIRPVLLEIQVVQALRDAGCEVIQVAEGEADLIIAKQFAEREKAYAVLSNDSDFCIFKNTCFI-PKCLFDINGDLGLGQSLALP----QKPTQLICGVVASQRVQQFLKFPAVEMLVELSIVAGNDFTGPHMPH-----GFADRLQVANYRSILSYADWVRQHVQVENNQVFKQEMM-----RNRNLANAVEHSRKFYSL-------DADLIG--EAGKDGYIFNLIVDR-----VKSGQYPANFVSIYRCFYWYRYILDDKYLCAPAEELLAPLRADLYAILLPRHKAFVTEYGQTMRQDFQQMQNYAVND---KNL----PSLNHIRENQIFRNMRLFHYIMTRLEPGQAPEKTWFDKYGRKTGFIFYILRYFLLLNWGQCLNVTEAEFLALVATAFGASK------------ESSWQELRVCPDPRCLTIAALFQDIYRHAFLFLGSVLHLKHEFPLPKEIFSGSMWTVLY 571          
BLAST of SMED30016453 vs. Planmine SMEST
Match: SMESG000033479.1 (SMESG000033479.1)

HSP 1 Score: 1243.8 bits (3217), Expect = 0.000e+0
Identity = 601/612 (98.20%), Postives = 605/612 (98.86%), Query Frame = 2
Query:  185 MEILVDFSSFRRDLDEIILRKIINDFDNDFLSISCVECDIFSKAYLEFHRMFAEIGIKLVWIYDGIKGLDEVVHNEKSETWSYRINKYSNLVDTLLECCKNKMPVKDLGNVISRAYSLTTLENLKASGVEVIKLLQGGSDEFIASEFHRRQSYAIFSNDTDFLVFKDCRVIFPRILRDIYQDELPFMDTENPGNFFKRPTKLNCPIVTQSDVFRPLQFSTHEEIIILSILKGNDNTHNYSQNLLYALGIAESLDRWPHISRVAKYIKSNHVNRNNLFDLDGMSTFLNENPEFKNTVNFCFDFYTLRHFERASGKTLINFDPGSADGSLTSFLQRKLSKMEISDSLYISHFGRYSCVFWIEKPIDAFATITTVMSEIRSRIYPYVLHADLDHVTEFKRRDAEGILINVVHSPFKSNLIISKPDPESERQNGVKYGIDIFEEIWSHLESQDSLNFVYQFGLEKGFLCYILRYLYKVTHGLNIEMTAKEFDAIFAMVFYRYRLSINMPFRTNLNQDIFLGMKICPTEKCLTIFSWFMEIYSTAKYFCGGALNLLKDFPKAENVMSSTVFIAFYENNVNDINKRVDHLDESVIGMIQDLENEILECLDGPYQAITK 2020
            MEILVDFSSFRR LDEIILRKIINDFDNDFLSISCVECDIFSKAYLEFHRMFAEIGIKLVWIYDGIKGLDEVVHNEKSETWSYRINKYSN VD +LECCKNKMPVK+  +VIS AYSLT LENLKASGVEVIKLLQGGSDEFIASEFHRRQSYAIFSNDTDFLVFKDCRVIFPRILRDIYQDELPFMDTENPGNFFKRPTKLNCPIVTQSDVFRPLQFSTHEEIIILSILKGNDNTHNYS+NLLYALGIAESLDRWPHISRVAKYIKSNHVNRNNLFDLDGMSTFLNENPEFKNTVNFCFDFYTLRHFERASGKTLINFDPGSADGSLTSFLQRKLSKMEISDSLYISHFGRYSCVFWIEKPIDAFATITTVMSEIRSRIYPYVLHADLDHVTEFKRRDAEGILINVVHSPFKSNLIISKPDPESERQNGVKYGIDIFEEIWSHLESQDSLNFVYQFGLEKGFLCYILRYLYKVTHGLNIEMTAKEFDAIFAMVFYRYRLSINMPFRTNLNQDIFLGMKICPTEKCLTIFSWFMEIYSTAKYFCGGALNLLKDFPKAENVMSSTVFIAFYENNVNDINKRVDHLDESVIGMIQDLENEILECLDGPYQAITK
Sbjct:    1 MEILVDFSSFRRGLDEIILRKIINDFDNDFLSISCVECDIFSKAYLEFHRMFAEIGIKLVWIYDGIKGLDEVVHNEKSETWSYRINKYSNSVDAVLECCKNKMPVKNFKDVISWAYSLTALENLKASGVEVIKLLQGGSDEFIASEFHRRQSYAIFSNDTDFLVFKDCRVIFPRILRDIYQDELPFMDTENPGNFFKRPTKLNCPIVTQSDVFRPLQFSTHEEIIILSILKGNDNTHNYSKNLLYALGIAESLDRWPHISRVAKYIKSNHVNRNNLFDLDGMSTFLNENPEFKNTVNFCFDFYTLRHFERASGKTLINFDPGSADGSLTSFLQRKLSKMEISDSLYISHFGRYSCVFWIEKPIDAFATITTVMSEIRSRIYPYVLHADLDHVTEFKRRDAEGILINVVHSPFKSNLIISKPDPESERQNGVKYGIDIFEEIWSHLESQDSLNFVYQFGLEKGFLCYILRYLYKVTHGLNIEMTAKEFDAIFAMVFYRYRLSINMPFRTNLNQDIFLGMKICPTEKCLTIFSWFMEIYSTAKYFCGGALNLLKDFPKAENVMSSTVFIAFYENNVNDINKRVDHLDESVIGMIQDLENEILECLDGPYQAITK 612          
BLAST of SMED30016453 vs. Planmine SMEST
Match: SMESG000033479.1 (SMESG000033479.1)

HSP 1 Score: 1231.47 bits (3185), Expect = 0.000e+0
Identity = 598/612 (97.71%), Postives = 603/612 (98.53%), Query Frame = 2
Query:  185 MEILVDFSSFRRDLDEIILRKIINDFDNDFLSISCVECDIFSKAYLEFHRMFAEIGIKLVWIYDGIKGLDEVVHNEKSETWSYRINKYSNLVDTLLECCKNKMPVKDLGNVISRAYSLTTLENLKASGVEVIKLLQGGSDEFIASEFHRRQSYAIFSNDTDFLVFKDCRVIFPRILRDIYQDELPFMDTENPGNFFKRPTKLNCPIVTQSDVFRPLQFSTHEEIIILSILKGNDNTHNYSQNLLYALGIAESLDRWPHISRVAKYIKSNHVNRNNLFDLDGMSTFLNENPEFKNTVNFCFDFYTLRHFERASGKTLINFDPGSADGSLTSFLQRKLSKMEISDSLYISHFGRYSCVFWIEKPIDAFATITTVMSEIRSRIYPYVLHADLDHVTEFKRRDAEGILINVVHSPFKSNLIISKPDPESERQNGVKYGIDIFEEIWSHLESQDSLNFVYQFGLEKGFLCYILRYLYKVTHGLNIEMTAKEFDAIFAMVFYRYRLSINMPFRTNLNQDIFLGMKICPTEKCLTIFSWFMEIYSTAKYFCGGALNLLKDFPKAENVMSSTVFIAFYENNVNDINKRVDHLDESVIGMIQDLENEILECLDGPYQAITK 2020
            MEILVDFSSFRR LDEIILRKIINDFDNDFLSISCVECDIFSKAYLEFHRMFAEIGIKLVWIYDGIKGLDEVVHNEKSETWSYRINKYSN VD +LECCKNKMPVK+  +VIS AYSLT LENLKASGVEVIKLLQGGSDEFIASEFHRRQSYAIFSNDTDFLVFKDCRVIFPRILRDIYQDELPFMDTENPGNFFKRPTKLNCPIVTQSDVFRPLQFSTHEEIIILSILKGNDNTHNYS+NLLYALGIAESLDRWPHISRVAKYIKSNHVNRNNLFDLDGMSTFLNENPEFKNTVNFCFDFYTLRHFERASGKTLINFDPGSADGSLTSFLQRKLSKMEISDSLYISHFGRYSCVFWIEKPIDAFATITTVMSEIRSRIYPYVLHADLDHVTEFKRRDAEGILINVVHSPFKSNLIISKPDPESERQNGVKYGIDIFEEIWSHLE  +SLNFVYQFGLEKGFLCYILRYLYKVTHGLNIEMTAKEFDAIFAMVFYRYRLSINMPFRTNLNQDIFLGMKICPTEKCLTIFSWFMEIYSTAKYFCGGALNLLKDFPKAENVMSSTVFIAFYENNVNDINKRVDHLDESVIGMIQDLENEILECLDGPYQAITK
Sbjct:    1 MEILVDFSSFRRGLDEIILRKIINDFDNDFLSISCVECDIFSKAYLEFHRMFAEIGIKLVWIYDGIKGLDEVVHNEKSETWSYRINKYSNSVDAVLECCKNKMPVKNFKDVISWAYSLTALENLKASGVEVIKLLQGGSDEFIASEFHRRQSYAIFSNDTDFLVFKDCRVIFPRILRDIYQDELPFMDTENPGNFFKRPTKLNCPIVTQSDVFRPLQFSTHEEIIILSILKGNDNTHNYSKNLLYALGIAESLDRWPHISRVAKYIKSNHVNRNNLFDLDGMSTFLNENPEFKNTVNFCFDFYTLRHFERASGKTLINFDPGSADGSLTSFLQRKLSKMEISDSLYISHFGRYSCVFWIEKPIDAFATITTVMSEIRSRIYPYVLHADLDHVTEFKRRDAEGILINVVHSPFKSNLIISKPDPESERQNGVKYGIDIFEEIWSHLE--NSLNFVYQFGLEKGFLCYILRYLYKVTHGLNIEMTAKEFDAIFAMVFYRYRLSINMPFRTNLNQDIFLGMKICPTEKCLTIFSWFMEIYSTAKYFCGGALNLLKDFPKAENVMSSTVFIAFYENNVNDINKRVDHLDESVIGMIQDLENEILECLDGPYQAITK 610          
BLAST of SMED30016453 vs. Planmine SMEST
Match: SMESG000033479.1 (SMESG000033479.1)

HSP 1 Score: 1082.01 bits (2797), Expect = 0.000e+0
Identity = 523/534 (97.94%), Postives = 527/534 (98.69%), Query Frame = 2
Query:  185 MEILVDFSSFRRDLDEIILRKIINDFDNDFLSISCVECDIFSKAYLEFHRMFAEIGIKLVWIYDGIKGLDEVVHNEKSETWSYRINKYSNLVDTLLECCKNKMPVKDLGNVISRAYSLTTLENLKASGVEVIKLLQGGSDEFIASEFHRRQSYAIFSNDTDFLVFKDCRVIFPRILRDIYQDELPFMDTENPGNFFKRPTKLNCPIVTQSDVFRPLQFSTHEEIIILSILKGNDNTHNYSQNLLYALGIAESLDRWPHISRVAKYIKSNHVNRNNLFDLDGMSTFLNENPEFKNTVNFCFDFYTLRHFERASGKTLINFDPGSADGSLTSFLQRKLSKMEISDSLYISHFGRYSCVFWIEKPIDAFATITTVMSEIRSRIYPYVLHADLDHVTEFKRRDAEGILINVVHSPFKSNLIISKPDPESERQNGVKYGIDIFEEIWSHLESQDSLNFVYQFGLEKGFLCYILRYLYKVTHGLNIEMTAKEFDAIFAMVFYRYRLSINMPFRTNLNQDIFLGMKICPTEKCLTIFSWFM 1786
            MEILVDFSSFRR LDEIILRKIINDFDNDFLSISCVECDIFSKAYLEFHRMFAEIGIKLVWIYDGIKGLDEVVHNEKSETWSYRINKYSN VD +LECCKNKMPVK+  +VIS AYSLT LENLKASGVEVIKLLQGGSDEFIASEFHRRQSYAIFSNDTDFLVFKDCRVIFPRILRDIYQDELPFMDTENPGNFFKRPTKLNCPIVTQSDVFRPLQFSTHEEIIILSILKGNDNTHNYS+NLLYALGIAESLDRWPHISRVAKYIKSNHVNRNNLFDLDGMSTFLNENPEFKNTVNFCFDFYTLRHFERASGKTLINFDPGSADGSLTSFLQRKLSKMEISDSLYISHFGRYSCVFWIEKPIDAFATITTVMSEIRSRIYPYVLHADLDHVTEFKRRDAEGILINVVHSPFKSNLIISKPDPESERQNGVKYGIDIFEEIWSHLESQDSLNFVYQFGLEKGFLCYILRYLYKVTHGLNIEMTAKEFDAIFAMVFYRYRLSINMPFRTNLNQDIFLGMKICPTEKCLTIFSWFM
Sbjct:    1 MEILVDFSSFRRGLDEIILRKIINDFDNDFLSISCVECDIFSKAYLEFHRMFAEIGIKLVWIYDGIKGLDEVVHNEKSETWSYRINKYSNSVDAVLECCKNKMPVKNFKDVISWAYSLTALENLKASGVEVIKLLQGGSDEFIASEFHRRQSYAIFSNDTDFLVFKDCRVIFPRILRDIYQDELPFMDTENPGNFFKRPTKLNCPIVTQSDVFRPLQFSTHEEIIILSILKGNDNTHNYSKNLLYALGIAESLDRWPHISRVAKYIKSNHVNRNNLFDLDGMSTFLNENPEFKNTVNFCFDFYTLRHFERASGKTLINFDPGSADGSLTSFLQRKLSKMEISDSLYISHFGRYSCVFWIEKPIDAFATITTVMSEIRSRIYPYVLHADLDHVTEFKRRDAEGILINVVHSPFKSNLIISKPDPESERQNGVKYGIDIFEEIWSHLESQDSLNFVYQFGLEKGFLCYILRYLYKVTHGLNIEMTAKEFDAIFAMVFYRYRLSINMPFRTNLNQDIFLGMKICPTEKCLTIFSWFM 534          
BLAST of SMED30016453 vs. Planmine SMEST
Match: SMESG000033476.1 (SMESG000033476.1)

HSP 1 Score: 1045.8 bits (2703), Expect = 0.000e+0
Identity = 508/569 (89.28%), Postives = 529/569 (92.97%), Query Frame = 2
Query:   92 MGIRGLYSYFAFDMKAYTIFNLVQKAKVVKNMEILVDFSSFRRDLDEIILRKIINDFDNDFLSISCVECDIFSKAYLEFHRMFAEIGIKLVWIYDGIKGLDEVVHNEKSETWSYRINKYSNLVDTLLECCKNKMPVKDLGNVISRAYSLTTLENLKASGVEVIKLLQGGSDEFIASEFHRRQSYAIFSNDTDFLVFKDCRVIFPRILRDIYQDELPFMDTENPGNFFKRPTKLNCPIVTQSDVFRPLQFSTHEEIIILSILKGNDNTHNYSQNLLYALGIAESLDRWPHISRVAKYIKSNHVNRNNLFDLDGMSTFLNENPEFKNTVNFCFDFYTLRHFERASGKTLINFDPGSADGSLTSFLQRKLSKMEISDSLYISHFGRYSCVFWIEKPIDAFATITTVMSEIRSRIYPYVLHADLDHVTEFKRRDAEGILINVVHSPFKSNLIISKPDPESERQNGVKYGIDIFEEIWSHLESQDSLNFVYQFGLEKGFLCYILRYLYKVTHGLNIEMTAKEFDAIFAMVFYRYRLSINMPFRTNLNQDIFLGMKICPTEKCLTIFSWFMEIYS 1798
            MGIRGLYSYFAFDMKAYTIFNLVQKAKVVK+MEILVDF SFRRDLD++ILRKII DFDN++LSISCVECDIF KAYLEFH+MFAEIGIKLVWIYDGI  LDEV+  +KSETW  RI  YSNLVD  LECC+NKMP KDLGNV S    LT LENLKASG EVIKLLQGGSDEFIASEFHRRQSYAIFSNDTDFLVFKDCRVIFPRILRDIY D+LPFMDTENPG FFK+PTK +CPIVTQSDVFRPLQFSTHEEIIILSILKGNDNTHNYSQNLLYALGIAESLDRWPHISRVAKYIKSNHVNRNNLFDLDGMSTFLNENPEFKNTVNFCFDFYTLRHFERASGKTLINFDPGSADGSLTSFLQRKLS MEI D LY SHFG Y+    IEKPI A  T+  V+SEIRS+IYPYVL+ADL+H+TEFKRRDAEGILINVVHSPFKSNLIISKPDPESERQNGVKYGIDIFEEIWSHLESQDSLNFVYQFGLEKGFLCYILRYLYKVT+GLNIEMTAKEFDAIFAMVFYRYRLSINMPFRTNLNQDIFLGMKICPTEKCLTIFSWFM  Y+
Sbjct:    1 MGIRGLYSYFAFDMKAYTIFNLVQKAKVVKDMEILVDFRSFRRDLDKLILRKIIKDFDNNYLSISCVECDIFGKAYLEFHKMFAEIGIKLVWIYDGINSLDEVMCYQKSETWDCRIKNYSNLVDKFLECCQNKMPFKDLGNVRSMFNVLTALENLKASGAEVIKLLQGGSDEFIASEFHRRQSYAIFSNDTDFLVFKDCRVIFPRILRDIYHDKLPFMDTENPGKFFKKPTKFDCPIVTQSDVFRPLQFSTHEEIIILSILKGNDNTHNYSQNLLYALGIAESLDRWPHISRVAKYIKSNHVNRNNLFDLDGMSTFLNENPEFKNTVNFCFDFYTLRHFERASGKTLINFDPGSADGSLTSFLQRKLSNMEILDPLYGSHFGMYTYKLVIEKPIVASLTVGAVLSEIRSKIYPYVLNADLNHITEFKRRDAEGILINVVHSPFKSNLIISKPDPESERQNGVKYGIDIFEEIWSHLESQDSLNFVYQFGLEKGFLCYILRYLYKVTNGLNIEMTAKEFDAIFAMVFYRYRLSINMPFRTNLNQDIFLGMKICPTEKCLTIFSWFMVRYN 569          
BLAST of SMED30016453 vs. Planmine SMEST
Match: SMESG000033476.1 (SMESG000033476.1)

HSP 1 Score: 1018.45 bits (2632), Expect = 0.000e+0
Identity = 495/556 (89.03%), Postives = 516/556 (92.81%), Query Frame = 2
Query:  131 MKAYTIFNLVQKAKVVKNMEILVDFSSFRRDLDEIILRKIINDFDNDFLSISCVECDIFSKAYLEFHRMFAEIGIKLVWIYDGIKGLDEVVHNEKSETWSYRINKYSNLVDTLLECCKNKMPVKDLGNVISRAYSLTTLENLKASGVEVIKLLQGGSDEFIASEFHRRQSYAIFSNDTDFLVFKDCRVIFPRILRDIYQDELPFMDTENPGNFFKRPTKLNCPIVTQSDVFRPLQFSTHEEIIILSILKGNDNTHNYSQNLLYALGIAESLDRWPHISRVAKYIKSNHVNRNNLFDLDGMSTFLNENPEFKNTVNFCFDFYTLRHFERASGKTLINFDPGSADGSLTSFLQRKLSKMEISDSLYISHFGRYSCVFWIEKPIDAFATITTVMSEIRSRIYPYVLHADLDHVTEFKRRDAEGILINVVHSPFKSNLIISKPDPESERQNGVKYGIDIFEEIWSHLESQDSLNFVYQFGLEKGFLCYILRYLYKVTHGLNIEMTAKEFDAIFAMVFYRYRLSINMPFRTNLNQDIFLGMKICPTEKCLTIFSWFMEIYS 1798
            MKAYTIFNLVQKAKVVK+MEILVDF SFRRDLD++ILRKII DFDN++LSISCVECDIF KAYLEFH+MFAEIGIKLVWIYDGI  LDEV+  +KSETW  RI  YSNLVD  LECC+NKMP KDLGNV S    LT LENLKASG EVIKLLQGGSDEFIASEFHRRQSYAIFSNDTDFLVFKDCRVIFPRILRDIY D+LPFMDTENPG FFK+PTK +CPIVTQSDVFRPLQFSTHEEIIILSILKGNDNTHNYSQNLLYALGIAESLDRWPHISRVAKYIKSNHVNRNNLFDLDGMSTFLNENPEFKNTVNFCFDFYTLRHFERASGKTLINFDPGSADGSLTSFLQRKLS MEI D LY SHFG Y+    IEKPI A  T+  V+SEIRS+IYPYVL+ADL+H+TEFKRRDAEGILINVVHSPFKSNLIISKPDPESERQNGVKYGIDIFEEIWSHLESQDSLNFVYQFGLEKGFLCYILRYLYKVT+GLNIEMTAKEFDAIFAMVFYRYRLSINMPFRTNLNQDIFLGMKICPTEKCLTIFSWFM  Y+
Sbjct:    1 MKAYTIFNLVQKAKVVKDMEILVDFRSFRRDLDKLILRKIIKDFDNNYLSISCVECDIFGKAYLEFHKMFAEIGIKLVWIYDGINSLDEVMCYQKSETWDCRIKNYSNLVDKFLECCQNKMPFKDLGNVRSMFNVLTALENLKASGAEVIKLLQGGSDEFIASEFHRRQSYAIFSNDTDFLVFKDCRVIFPRILRDIYHDKLPFMDTENPGKFFKKPTKFDCPIVTQSDVFRPLQFSTHEEIIILSILKGNDNTHNYSQNLLYALGIAESLDRWPHISRVAKYIKSNHVNRNNLFDLDGMSTFLNENPEFKNTVNFCFDFYTLRHFERASGKTLINFDPGSADGSLTSFLQRKLSNMEILDPLYGSHFGMYTYKLVIEKPIVASLTVGAVLSEIRSKIYPYVLNADLNHITEFKRRDAEGILINVVHSPFKSNLIISKPDPESERQNGVKYGIDIFEEIWSHLESQDSLNFVYQFGLEKGFLCYILRYLYKVTNGLNIEMTAKEFDAIFAMVFYRYRLSINMPFRTNLNQDIFLGMKICPTEKCLTIFSWFMVRYN 556          
The following BLAST results are available for this feature:
BLAST of SMED30016453 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016453 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016453 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016453 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016453 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016453 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016453 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016453 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1QJE95.351e-4626.33Uncharacterized protein OS=Crassostrea gigas OX=29... [more]
A0A1S3HAE63.322e-4024.96uncharacterized protein LOC106153553 OS=Lingula un... [more]
A0A0L8GFX01.605e-3925.00Uncharacterized protein OS=Octopus bimaculoides OX... [more]
A0A210QAR57.375e-3925.57Uncharacterized protein OS=Mizuhopecten yessoensis... [more]
A0A2T7PUB96.993e-3425.53Uncharacterized protein OS=Pomacea canaliculata OX... [more]
back to top
BLAST of SMED30016453 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016453 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016453 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016453 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016453 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016453 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033479.10.000e+098.20SMESG000033479.1[more]
SMESG000033479.10.000e+097.71SMESG000033479.1[more]
SMESG000033479.10.000e+097.94SMESG000033479.1[more]
SMESG000033476.10.000e+089.28SMESG000033476.1[more]
SMESG000033476.10.000e+089.03SMESG000033476.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016453 ID=SMED30016453|Name=SMED30016453|organism=Schmidtea mediterranea sexual|type=transcript|length=2498bp
ATTTATCCTTGATTCTTAGAATTAAATTTAATATTTATTTGAAAATCATT
ATTGCAAAAGTGTATTATTAAAATAAAATACTCTAATTTCAATGGGTATA
AGGGGACTTTATTCGTATTTTGCTTTTGACATGAAAGCTTATACCATTTT
TAATTTAGTTCAAAAAGCTAAAGTTGTCAAAAACATGGAAATTTTAGTAG
ATTTCAGCTCATTTCGTAGAGATCTTGATGAAATTATTTTGCGAAAAATA
ATTAATGACTTTGACAATGATTTTTTATCTATATCCTGTGTTGAATGTGA
TATTTTTAGTAAAGCATATTTGGAATTCCATAGAATGTTTGCCGAAATTG
GCATTAAATTGGTGTGGATTTATGATGGAATAAAAGGCTTAGATGAAGTT
GTGCATAATGAAAAATCTGAAACATGGAGTTATAGGATTAATAAATATTC
TAATTTGGTTGATACACTTTTGGAATGTTGCAAAAATAAAATGCCTGTAA
AAGATTTGGGAAACGTTATTTCGCGGGCTTATTCATTGACGACTCTCGAG
AATTTGAAAGCCTCAGGCGTGGAAGTAATTAAGTTGTTGCAAGGTGGATC
TGATGAATTCATTGCTTCAGAATTTCACCGTCGACAATCCTATGCAATTT
TCAGTAATGATACTGATTTTCTGGTGTTCAAAGATTGCAGAGTTATATTT
CCTAGAATTTTAAGAGATATTTATCAGGATGAATTACCATTCATGGACAC
TGAAAACCCTGGAAACTTTTTCAAAAGACCAACGAAATTAAACTGTCCAA
TAGTAACGCAAAGTGATGTATTCAGACCCTTGCAGTTTTCTACTCACGAG
GAAATCATAATCTTGAGCATCTTAAAGGGCAACGACAATACTCATAATTA
TTCTCAGAATTTATTATACGCGCTTGGCATAGCAGAGTCATTGGACAGAT
GGCCTCATATAAGCCGTGTCGCAAAATATATCAAATCAAATCACGTTAAT
CGAAATAATCTCTTTGATCTTGATGGAATGAGCACATTTTTGAATGAAAA
TCCAGAATTTAAAAATACTGTTAATTTTTGTTTTGATTTTTATACTTTGA
GACACTTTGAAAGGGCTTCTGGAAAAACTTTAATAAATTTTGACCCAGGT
TCTGCCGATGGCTCGCTAACAAGCTTCCTTCAAAGAAAATTGTCCAAAAT
GGAAATTTCTGATTCATTATACATATCACATTTTGGAAGGTACAGTTGTG
TATTTTGGATAGAAAAACCTATCGACGCTTTTGCGACAATAACTACAGTA
ATGAGCGAGATTCGCTCAAGAATTTACCCCTATGTCCTACATGCAGATCT
GGATCATGTAACGGAATTTAAACGTCGAGATGCTGAGGGCATTTTGATAA
ATGTTGTTCATTCTCCATTTAAGTCAAACCTCATTATAAGCAAACCAGAT
CCAGAATCAGAACGTCAAAATGGTGTCAAATATGGAATTGATATTTTCGA
AGAAATATGGTCACATTTAGAGAGTCAGGATTCGTTAAATTTTGTATATC
AGTTCGGATTGGAAAAAGGATTTCTCTGTTACATTTTGAGATATTTGTAT
AAAGTAACACACGGTTTAAATATCGAAATGACCGCCAAGGAATTTGACGC
TATATTTGCAATGGTTTTCTATAGATATAGACTTTCTATAAATATGCCAT
TTCGGACAAATCTGAATCAAGATATATTTTTGGGAATGAAAATTTGTCCG
ACGGAAAAATGCTTGACAATATTTTCTTGGTTTATGGAAATATATTCAAC
TGCGAAATATTTCTGTGGAGGCGCGCTCAATTTGTTGAAAGACTTTCCAA
AAGCTGAAAATGTTATGAGTTCTACTGTTTTTATCGCCTTTTATGAAAAT
AATGTGAATGATATTAACAAAAGAGTTGATCATTTGGATGAATCTGTTAT
CGGAATGATTCAAGACCTTGAAAATGAAATATTAGAATGTTTGGACGGCC
CATATCAAGCCATCACCAAGTGACTTTGGAAAACCTTCAATTACACTTCA
TACATTTCGAACAATAACTTCAAAACCTTTAATTTCAATTGTGCGCTTAT
GTAATATTTGTATAATCTTACTTGTTAGGTTTGCATTTTCATTAGTATTT
TCTATCATTTTATTTTCTATTTTAATATATCAATGACTTTAGCATTTGTT
TCAATCAAATGTATGATAATGCTCAGGATACTCGCTATAATAATTTAAAC
TAGCCGAATGAATGCAATGTAAGAAAATACAACTCAGTTAAATAATTATA
TAACATTCGCAATGCGAATTTCGCATCATTCACAAGCTAGTGGCGCAATA
AGCAGGATAATCCTATCAGGATAGTGAGACCATGGTTGGGTTATGTAAAT
GAGTACAAATAAACTTACAAATTCGAAACATTATTATTTCTCAGACAGAA
AGGGTAAATACAGGTTTGGCTCAAAACTTTCTAATCGATGAATAAAGC
back to top

protein sequence of SMED30016453-orf-1

>SMED30016453-orf-1 ID=SMED30016453-orf-1|Name=SMED30016453-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=644bp
MGIRGLYSYFAFDMKAYTIFNLVQKAKVVKNMEILVDFSSFRRDLDEIIL
RKIINDFDNDFLSISCVECDIFSKAYLEFHRMFAEIGIKLVWIYDGIKGL
DEVVHNEKSETWSYRINKYSNLVDTLLECCKNKMPVKDLGNVISRAYSLT
TLENLKASGVEVIKLLQGGSDEFIASEFHRRQSYAIFSNDTDFLVFKDCR
VIFPRILRDIYQDELPFMDTENPGNFFKRPTKLNCPIVTQSDVFRPLQFS
THEEIIILSILKGNDNTHNYSQNLLYALGIAESLDRWPHISRVAKYIKSN
HVNRNNLFDLDGMSTFLNENPEFKNTVNFCFDFYTLRHFERASGKTLINF
DPGSADGSLTSFLQRKLSKMEISDSLYISHFGRYSCVFWIEKPIDAFATI
TTVMSEIRSRIYPYVLHADLDHVTEFKRRDAEGILINVVHSPFKSNLIIS
KPDPESERQNGVKYGIDIFEEIWSHLESQDSLNFVYQFGLEKGFLCYILR
YLYKVTHGLNIEMTAKEFDAIFAMVFYRYRLSINMPFRTNLNQDIFLGMK
ICPTEKCLTIFSWFMEIYSTAKYFCGGALNLLKDFPKAENVMSSTVFIAF
YENNVNDINKRVDHLDESVIGMIQDLENEILECLDGPYQAITK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000231vitelline gland
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR029060PIN-like_dom_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 598..618
NoneNo IPR availableCDDcd18672PIN_FAM120B-likecoord: 78..200
e-value: 4.7223E-4
score: 39.9662
IPR029060PIN-like domain superfamilySUPERFAMILYSSF88723PIN domain-likecoord: 1..214