BED-type domain-containing protein

Overview
NameBED-type domain-containing protein
Smed IDSMED30016435
Length (bp)2765
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of BED-type domain-containing protein (SMED30016435) t-SNE clustered cells

Violin plots show distribution of expression levels for BED-type domain-containing protein (SMED30016435) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of BED-type domain-containing protein (SMED30016435) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for BED-type domain-containing protein (SMED30016435) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of BED-type domain-containing protein vs. TrEMBL
Match: B0W9I7 (Predicted protein OS=Culex quinquefasciatus OX=7176 GN=6035136 PE=4 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 4.323e-37
Identity = 58/152 (38.16%), Postives = 86/152 (56.58%), Query Frame = 2
Query:  479 APVWEYLKKIPSTNKKVAKAQCLKCMVFISNSNGNTDGMLNHLKLLHKIHCKRYNDESVL-------GDQEQNFKEIKGNTMMDFVKRQILSEIVSRLAAEDVITICAITNSKFIRQSIVDRGYNLPKSENSVMRLIHTEFENRKQEVIKKL 913
            A +W    K+        +AQC KC   IS   G+T G+L H   +H    KR   ESV+       G ++      K +T+  F+ ++ ++E+ +RLAA+D +TI AITNSKFIR S   RGY LP S+ SVM+LIH  +E  KQ+ ++++
Sbjct:    2 ADIWSLYDKLDGE-----RAQCKKCPKTISCKGGSTSGLLRHGVNVHNFRVKRRIPESVVQPEDVPSGSKQAKSNTSKQSTIEPFIHKKPMNEMFARLAAQDGLTISAITNSKFIRTSFAQRGYQLPLSKTSVMKLIHDYYEIAKQQTVQQI 148          

HSP 2 Score: 84.3445 bits (207), Expect = 4.323e-37
Identity = 83/236 (35.17%), Postives = 127/236 (53.81%), Query Frame = 3
Query:  954 LDEWVSARNRRFXXXXXXXXXXXXXXXXXXRATGSCTAAVVLENVTKHLELFNLSFQNDFVCTTNDGASVMVKYGRDCPSK-SVMFMSRANLAVVETFYKKKVFESXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQKNLKNVLILIKFLKKSSVRNSILQQKIIDEIGHEL*LQLDVKHRWNYIHPMLEKLLRVRIPIQYTLIKLNALHLISGIDFEKLSSLMNAIKP 1658
            LDEW S+ NR+++N+NVH  +G   NLGLVR  GS  A  +LE V +HLE F +  +N     T+D A VM K+G+    K  + F    +LAV +  +K    E+    + E D DD+  D+E  DD  +          + +  L  +  + K  ++S V+N+ILQ+K++ E G  L L LDVK RWN    ML + +++   +   L +L  L  +S  D E +S L +A++P
Sbjct:  162 LDEWTSSGNRKYLNVNVHFGDGAFFNLGLVRVKGSFPAEKILEAVDQHLECFAIRDRN-VAAATSDAAKVMEKFGKLATFKHQLCFNHGLHLAVCDVIFKSS--ETPGDLLEESDSDDEDCDSEESDDSKDATIPGLYNSSNYRPVLLQIRNICKLFRRSPVKNAILQKKVVQEFGKPLQLILDVKTRWNSTEQMLARYMKLHGCVAEALKELEDLAPVSTSDLESISQLYDALQP 394          
BLAST of BED-type domain-containing protein vs. TrEMBL
Match: A0A4C1Y486 (BED-type domain-containing protein OS=Eumeta variegata OX=151549 GN=EVAR_52339_1 PE=4 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 9.280e-30
Identity = 62/170 (36.47%), Postives = 90/170 (52.94%), Query Frame = 2
Query:  485 VWEYLKKIPSTNKKVAKAQCLKCMVFISNSNGNTDGMLNHLKLLHKIHCKRYNDESV--LGDQEQNFKE-----------IKGNTMMDFVKRQILSEIVSRLAAEDVITICAITNSKFIRQSIVDRGYNLPKSENSVMRLIHTEFENRKQEVIKKLTTIKN-DGGKFSIT 952
            VW+Y  K P    K   AQCLKC   IS    NT G++ HL+ +HKI  K    ++    G    N  E           ++     +   +Q L EIV+ LAA+D +TI  IT S FIR+S+  RG NLPK+E+ VM++I   +E +KQE I  L+  K  +  +F+++
Sbjct:    6 VWKYFTKTP----KEGLAQCLKCPKKISTKGSNTTGLVRHLEHIHKISIKNTETQASTSAGYSADNRDEQPSDSKKSKSKLQKTLHFEPKNKQSLGEIVAVLAAKDGLTIRQITKSDFIRESLRLRGINLPKNESDVMKIILKYYEEKKQETIDFLSNSKQKESARFNLS 171          

HSP 2 Score: 70.8626 bits (172), Expect = 9.280e-30
Identity = 63/171 (36.84%), Postives = 95/171 (55.56%), Query Frame = 3
Query:  954 LDEWVSARNRRFXXXXXXXXXXXXXXXXXXRATGSCTAAVVLENVTKHLELFNLSFQNDFVCTTNDGASVMVKYGRDCPSKSVMFMSRA-NLAVVETFYKKKVFESXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQKNLKNVLILIKFLKKSSVRNSILQQKI 1463
            +DEW S RNRR+ NI +H  + N  NLGLV   G C A  + E +   LE F L F+ D V  T+DG +VMVK+GR+ P++ V+ ++ A +LAV+ETF KK     N     + D+    +     D+   E E   +   +I K L++   L+K  +KS ++N  LQ+ +
Sbjct:  172 VDEWSSLRNRRYFNICIHHTDSNFYNLGLVYIPGQCRAVEIKEIIKHRLEEFGLYFEQDVVAVTSDGPNVMVKFGRENPTEMVLCLNHAVHLAVLETFCKKNETNENFTSNQDSDNLSGEESEYDEDNCDLEPEIRTNYTQNIDKALQDTRALVKLFRKSPLKNITLQKHV 342          
BLAST of BED-type domain-containing protein vs. TrEMBL
Match: A0A226D4I7 (Putative AC transposase OS=Folsomia candida OX=158441 GN=Fcan01_25450 PE=4 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 2.797e-25
Identity = 78/249 (31.33%), Postives = 130/249 (52.21%), Query Frame = 3
Query:  957 DEWVSARNRRFXXXXXXXXXXXXXXXXXXRATGSCTAAVVLENVTKHLELFNLSFQNDFVCTTNDGASVMVKYGRDCPS-KSVMFMSRANLAVVETFYKK-----KVFESXXX---XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQKNLKNVLILIKFLKKSSVRNSILQQKIIDEIGHEL*LQLDVKHRWNYIHPMLEKLLRVRIPIQYTLIKLNALHLISGIDFEKLSSLMNAIKPLTSLLK 1676
            DEW S +NRR++N+ +HG      NLGL+R  GS  A   LE V   L L NLS +ND VC   DG+SVM K GR  P+ + + F     L V++  YKK     +  ES +    ++   +DD     +   ++   +E+        ++  +  V  +++  ++S ++N ILQ  I  E G EL L LD K RWN +  MLE+   V+  I+  L+ + +   +   +  ++S +++A+KP+ + ++
Sbjct:  190 DEWSSIKNRRYMNVILHGKPQEFWNLGLIRIHGSLPAEKCLEMVANKLRLLNLSLENDIVCIITDGSSVMTKIGRLSPTYQQLCFAHGIQLGVLDVLYKKINQTPEADESENENLDNLAPCEDDSCCDSDSDSEEIDEDEDEDLVISHTLRPVIDKVRTIVRMFRRSPLKNEILQTYIKQEFGKELSLILDCKTRWNSLVAMLERFYTVQASIKKALVDVRSDAHLKDWELARISDIVDALKPIEATIE 438          

HSP 2 Score: 54.299 bits (129), Expect = 2.797e-25
Identity = 43/161 (26.71%), Postives = 83/161 (51.55%), Query Frame = 2
Query:  485 VWEY-LKKIPSTNKKVAKAQCLKCMVFISNSNGNTDGMLNHLKLLHKIH-CKRYNDESVLGDQEQNFKEIKGNTMMDFVKRQI--LSEIVSRLAAEDVITICAITNSKFIRQSIVDRGY-NLPKSENSVMRLIHTEFENRKQEVIKKLTTIKNDGGKFSIT 952
            +W Y LK++   + K AK     C   +  + G+T G+  HL+ +H I   K+  + S LG + ++ K I      DF +++   L E ++R+ A+D I     + S  +R+++   G+ +LPKS +++ +++    +  K    + +  +K  G KFS+T
Sbjct:   35 IWNYFLKEV--ADGKTAKCMDTSCQKVLKTAGGSTSGLNTHLRSIHHIDLLKKDLNPSELGVKAKSVKPIS-----DFFEKKTKSLEETLARMTAKDGIPFSVFSTSTDLRRALKSDGFTDLPKSAHTIKKIVIGYSQKIKSTENEHVLDLKRIGRKFSVT 188          
BLAST of BED-type domain-containing protein vs. TrEMBL
Match: A0A226EBE0 (Uncharacterized protein OS=Folsomia candida OX=158441 GN=Fcan01_11805 PE=4 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 3.682e-23
Identity = 71/245 (28.98%), Postives = 112/245 (45.71%), Query Frame = 3
Query:  957 DEWVSARNRRFXXXXXXXXXXXXXXXXXXRATGSCTAAVVLENVTKHLELFNLSFQNDFVCTTNDGASVMVKYGRDCPSKSVM-FMSRANLAVVETFYKKKVFESXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQKNL--------KNVLILIKFLKKSSVRNS-ILQQKIIDEIGHEL*LQLDVKHRWNYIHPMLEKLLRVRIPIQYTLIKLNALHLISGIDFEKLSSLMNAIKPL 1661
            DEW S RNRR +                 R  G   A   L+ V+  L+ F LS   D +C   DGASVM K G   P+   M F     L V++  Y K    +     I  D  D  +D     D +  E    + D D  K+L          V  ++K  +KS  +N  +LQ+  + +IG EL LQLD + RW+ +  M+++ + +++ I  +LI +++    S  ++  LSSL + ++P+
Sbjct:  181 DEWTSKRNRRLV-----------------RIHGGAPAEKCLDLVSGRLKEFGLSLNTDIICICTDGASVMTKVGNISPTLQQMCFAHAIQLGVMDVLYSKPKPTNEKRSDINIDIPDVDEDEGLDMDLLTVELEVCEADEDTPKDLVDQFRSIIDKVRRVVKIFRKSPKKNDEVLQKHTLVDIGKELQLQLDSRTRWSSLFDMIKRFVTLKVSILKSLIDIDSEMSFSEQEWATLSSLASVLEPV 408          

HSP 2 Score: 42.743 bits (99), Expect = 3.682e-23
Identity = 36/150 (24.00%), Postives = 68/150 (45.33%), Query Frame = 2
Query:  536 AQCLKCMVF---ISNSNGNTDGMLNHLKLLHKIHCKRYNDESVLGDQEQNFKEIKGNTMMDFVKRQI-------LSEIVSRLAAEDVITICAITNSKFIRQSIVDRGY-NLPKSENSVMRLIHTEFENRKQEVIKKLTTIKNDGGKFSIT 952
            +Q  KC ++   +  + G T G+  HL+  HKI  K+  +   LGD+     ++   +    +   +       +  ++SRL A D +     T S  +R  + + GY ++PK+   +   +       +  VI ++  ++N G KFSIT
Sbjct:   33 SQEAKCRIWDQILKTTQGATTGLHVHLRTKHKIFIKKRTE---LGDKNTENSDLTPRSKQRKISEGLPTQDDKSMEAVLSRLTALDGLPFAVFTTSLDLRDLLTNGGYLDVPKTPQIIRNTVIQHTVKIRGHVISEIRKLENLGKKFSIT 179          

HSP 3 Score: 41.9726 bits (97), Expect = 3.682e-23
Identity = 48/187 (25.67%), Postives = 84/187 (44.92%), Query Frame = 2
Query: 1658 INITVETLGRQDTNLLTAKGAMNFLYNKLNECNDVICSTLKLNIERRMKEREN--STIIDTQACLT-----NNSLKPSKIVLEFASNLFARLFEYXXXXXXXXXXEHVDLNTDAPVSLEAELDAAIN-YVTCENFQKSNL--NXXXXXXXXXXTIQ----RPEKLEKLFEALTTIKPSSTEAERTVS 2176
            + +TVE L R+DTNL TA   + F+  KL   N  + + L   + RR+K+R    S I++ +  +       +   P +   +  SNL ++  ++                 +   +LE EL  AI   ++  + +KS +  N+           Q    R   L+ ++++L TI+P+S EAER  S
Sbjct:  408 VKLTVEALCRRDTNLHTADAMLQFMITKLENQNSTMSTELVTVLTRRIKQRRTNFSGILNIRDLIQRLHAIGHDDSPDEDDEDPLSNLTSQRIKH-----------------NQKTALEIELQEAIQKAISSAHSEKSQVKQNLLSTIKKELALFQHGGTRGVHLQIVYDSLLTIRPTSVEAERAFS 577          
BLAST of BED-type domain-containing protein vs. TrEMBL
Match: A0A0N7Z9Z3 (BED-type domain-containing protein OS=Scylla olivacea OX=85551 PE=4 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.619e-20
Identity = 56/165 (33.94%), Postives = 88/165 (53.33%), Query Frame = 2
Query:  485 VWEYLKKIPSTNKKVAKAQCLKCMVFISNSNGNTDGMLNHLKLLHKI----HCKRYNDESVLGDQEQNFKEIKGNT----MMDFVKRQ-ILSEIVSRLAAEDVITICAITNSKFIRQSIVDRGYNLPKSENSVMRLIHTEFENRKQEVIKKLTTIKNDGGKFSIT 952
             W+Y +K+         ++C KC   I     +T GM+ HLK  H I    + KR +D S     +++  E+K N+    M D +K++    EIV +LAA D  +I AI  S+FI+ S++ RGY LP+S   VM L+H ++   K+ VI  +   KN G +F ++
Sbjct:   15 AWKYFEKLKCEES----SRCKKCRAVIKCRGWSTSGMIRHLKSKHSIEKTENLKRPSDRS----HDKDTSEVKRNSVQQKMTDLLKKEETKEEIVGKLAAVDGFSINAIAKSEFIKTSMLARGYKLPQSPTLVMDLVHKQYNVAKERVIFDINKRKNVGVRFGLS 171          

HSP 2 Score: 47.3654 bits (111), Expect = 1.619e-20
Identity = 37/101 (36.63%), Postives = 55/101 (54.46%), Query Frame = 3
Query:  954 LDEWVSARNRRFXXXXXXXXXXXXXXXXXXRATGSCTAAVVLENVTKHLELFNLSFQNDFVCTTNDGASVMVKYGRDCPS-KSVMFMSRANLAVVETFYKK 1253
            LDE+ S +N+R++NIN+H ++   N     R TGS  A   +E V   L  F ++ + D V    DGASVMVK+G+   +     +    +LAV +  YKK
Sbjct:  172 LDEYTSLKNKRYMNINLHTSDTFWNLGMA-RITGSVPAETAVEVVENKLAEFQVNLERDVVACVTDGASVMVKFGKLIKTCHHTCYAHGIHLAVCDVLYKK 271          
BLAST of BED-type domain-containing protein vs. Planmine SMEST
Match: SMESG000051925.1 (SMESG000051925.1)

HSP 1 Score: 134.035 bits (336), Expect = 4.212e-36
Identity = 65/83 (78.31%), Postives = 76/83 (91.57%), Query Frame = -3
Query: 2479 IERRENSTRMTYENFHRLKKKYRDPERFWIENNLLIPNWFRTDDRKMKIFPFIVLRNSGLKLAEDIKTKAENKYQMHIIEGKL 2727
            +ER ENSTRMTY+NFH LKKKY +P+RF I+NNLLIPNWFRTDDRKMKIF FIV RNSGL LAE+I+TKAEN+Y+MHII+GK+
Sbjct:    6 MERWENSTRMTYDNFHWLKKKYGEPKRFSIKNNLLIPNWFRTDDRKMKIFLFIVQRNSGLNLAEEIETKAENEYRMHIIDGKI 88          
BLAST of BED-type domain-containing protein vs. Planmine SMEST
Match: SMESG000046976.1 (SMESG000046976.1)

HSP 1 Score: 130.183 bits (326), Expect = 1.174e-32
Identity = 83/222 (37.39%), Postives = 119/222 (53.60%), Query Frame = 3
Query: 1044 RATGSCTAAVVLENVTKHLELFNLSFQNDFVCTTNDGASVMVKYGRDCPSKSVMFMSRA-NLAVVETFYKKKVFESXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQKNLKNVLILIKFLKKSSVRNSILQQKIIDEIGHEL*LQLDVKHRWNYIHPMLEKLLRVRIPIQYTLIKLNALHLISGIDFEKLSSLMNAIKP--LTSLLKHWGDKTPI 1700
            R  GSC A  +L  VT HL++F+LSF+ND V   NDGASVMVKYGR+  ++  + ++   +LAV  TFY KK          E++   +       + +                        IKF K S++RN ILQ K+   + HEL L LDVKHRWN I+PMLE+ L+++ PI   L +LNA +L+ G++ + +  L + ++P  LT L   W D   I
Sbjct:   17 RIIGSCNARKLLSIVTDHLKIFHLSFENDVVANINDGASVMVKYGRESKAEVQLCLNHGLHLAVCNTFYFKKCINDYQNTSSEDEAIGNNLSATTDEYEE-----------------------IKFFKSSTIRNDILQAKVRIGLEHELHLVLDVKHRWNSIYPMLEQFLKLQKPIVEALTELNATNLLIGLNLDVIKGLCSILQPLELTVLALSWKDANLI 215          

HSP 2 Score: 53.9138 bits (128), Expect = 3.329e-7
Identity = 47/136 (34.56%), Postives = 69/136 (50.74%), Query Frame = 2
Query: 1652 KTINITVETLGRQDTNLLTAKGAMNFLYNKLNECN-------DVI--CSTLKLNIERRMKERENSTIIDTQACLTNNSLKPSKIVLEFASNLFARLFEYXXXXXXXXXXEHVDLNTDAPV-----SLEAELDAAIN 2017
            + + +TV  L  +D NL+TAKGA+NFL  KL+          + I   + LK NI  R+  RENS +    +CL    + P+K   +F + L  RL+   S+ + S   EH   + D  V     SLE E++A IN
Sbjct:  198 QPLELTVLALSWKDANLITAKGAINFLLKKLDGIGTQEKTLVEAIPEINALKENIMTRLCSRENSDLNSLLSCLLQQKI-PTKDNFKFGTRLLNRLYPNLSTSAVSDDEEHFIDSNDVSVHCDIMSLEYEMNACIN 332          
BLAST of BED-type domain-containing protein vs. Planmine SMEST
Match: SMESG000065760.1 (SMESG000065760.1)

HSP 1 Score: 79.337 bits (194), Expect = 5.369e-30
Identity = 73/244 (29.92%), Postives = 128/244 (52.46%), Query Frame = 3
Query:  957 DEWVSARNRRFXXXXXXXXXXXXXXXXXXRATGSCTAAVVLENVTKHLELFNLSFQNDFVCTTNDGASVMVKYGRDCPSKSVMFMSRA-NLAVVETFYKK-----KVFESXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQKN----LKNVLILIKFLKKSSVRNSILQQKIIDEIGHEL*LQLDVKHRWNYIHPMLEKLLRVRIPIQYTLIKLNALHLISGIDFEKLSSLMNAIKP 1658
            DEW S   +R++N+ +H    +     +    GSC A  +   V + L  + +  +N  + +T DGASVM KY +    ++   ++ A +LAVVETFY K     ++ +S + D  E+++  +    +   +  N+ +  +        N    L+N     +FL+KS VRN ILQ+ + D+ G +L L LD + RWN I PM+E+L+ +++ I++ L ++    L +  DF  L+ L+  +KP
Sbjct:  153 DEWTSCSGKRYLNVTLHSQEDSYKLGLIA-IEGSCDAYQIHSLVEQKLMDYGIKLRN-ILASTQDGASVMKKYAQLNKIENQFCINHAIHLAVVETFYNKNNVIDEISDSENADGDEDENQFNSFAGDHNLNIDNDIDNTEYTYSLDDANINEILQNFRKTDRFLRKSPVRNDILQRYVEDKEGKKLKLILDCRTRWNSIIPMMERLVLLQVCIKHVLEEIGCDDLYNEKDFTNLADLIEILKP 394          

HSP 2 Score: 72.4034 bits (176), Expect = 5.369e-30
Identity = 47/159 (29.56%), Postives = 83/159 (52.20%), Query Frame = 2
Query:  479 APVWEYLKKIPSTNKKVAKAQCLKCMVFISNSNGNTDGMLNHLKLLHKIHCKRYNDESVLGDQEQNFKEIKGNTMMDFVKRQILSEIVSRLAAEDVITICAITNSKFIRQSIVDRGYNLPKSENSVMRLIHTEFENRKQEVIK-KLTTIKNDGGKFSIT 952
            + VW+  +K          A+C  C   +  + GNT  + NHL+  H I  K+        ++    +    + M++F+KR+ + E++++ +A D  +I A+T+S  IR+ I  R Y +P+SE+++ +LI  +F N K+   K K T +   G  FSIT
Sbjct:    6 SEVWKIFQKETDNT-----AKCTMCNSVLKCAGGNTSNLANHLRAKHDIDVKK-------NEEPPETRAKATSNMLNFIKRESVGELLAKCSAYDGFSIHAMTHSSVIREFITTRSYVMPRSESTIKKLI-VDFANEKKLQFKDKFTKMAKSGMCFSIT 151          
BLAST of BED-type domain-containing protein vs. Planmine SMEST
Match: SMESG000037368.1 (SMESG000037368.1)

HSP 1 Score: 120.553 bits (301), Expect = 8.430e-30
Identity = 55/75 (73.33%), Postives = 68/75 (90.67%), Query Frame = -3
Query: 2476 MTYENFHRLKKKYRDPERFWIENNLLIPNWFRTDDRKMKIFPFIVLRNSGLKLAEDIKTKAENKYQMHIIEGKLR 2700
            MTY+N HRL+KKY +P+RF IENNL+IPNWF TDDR+MKIF FIV RNSGLKLAE+I+TK EN+Y+MHII+GK++
Sbjct:    1 MTYDNIHRLRKKYGEPKRFSIENNLMIPNWFHTDDREMKIFLFIVQRNSGLKLAEEIETKTENEYRMHIIDGKIK 75          
BLAST of BED-type domain-containing protein vs. Planmine SMEST
Match: SMESG000077975.1 (SMESG000077975.1)

HSP 1 Score: 75.0998 bits (183), Expect = 1.995e-29
Identity = 51/160 (31.87%), Postives = 87/160 (54.37%), Query Frame = 2
Query:  479 APVWEYLKKIPSTNKKVAKAQCLKCMVFISNSNGNTDGMLNHLKLLHKIHCKRYNDESVLGDQEQNFKEIKG-NTMMDFVKRQILSEIVSRLAAEDVITICAITNSKFIRQSIVDRGYNLPKSENSVMRLIHTEFENRKQEVIK-KLTTIKNDGGKFSIT 952
            + VW+  +K          A+C  C   +  ++GNT  + NHL+  H I  K+        ++E   K  K  ++M++F+KR+ + E++++ AA D  +I A+T+S  IR+ I  R Y +P+SE+++ +LI  +F N K+   K K T +   G  FSIT
Sbjct:    6 SEVWKIFQKETDNT-----AKCTMCNSILKCASGNTSNLANHLRAKHDIDVKK--------NEEPPEKRAKATSSMLNFIKRESVEELLAKCAAYDGFSIDAMTHSSAIREFITTRSYVMPRSESTIKKLI-VDFANEKKLQFKDKFTKMAKSGMCFSIT 151          

HSP 2 Score: 74.7146 bits (182), Expect = 1.995e-29
Identity = 71/244 (29.10%), Postives = 127/244 (52.05%), Query Frame = 3
Query:  957 DEWVSARNRRFXXXXXXXXXXXXXXXXXXRATGSCTAAVVLENVTKHLELFNLSFQNDFVCTTNDGASVMVKYGRDCPSKSVMFMSRA-NLAVVETFYKK-----KVFESXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQKN----LKNVLILIKFLKKSSVRNSILQQKIIDEIGHEL*LQLDVKHRWNYIHPMLEKLLRVRIPIQYTLIKLNALHLISGIDFEKLSSLMNAIKP 1658
            DEW S   +R++N+ +H    +     +     SC A  +   V + L  + +  +N  + +T DGASVM KY +    ++   ++ A +LAVVETFY K     ++ +S + D  E+++  +        +  N+ +  +        N    L+N    ++F +KS VRN ILQ+ + D+ G +L L LD + RWN I PM+E+L+ +++ I++ L ++    L +  DF  L++L+  +KP
Sbjct:  153 DEWTSCSGKRYLNVTLHSQEDSYKLGLIA-IECSCDAYQIHSLVEQKLMDYGIKLRN-ILTSTQDGASVMKKYAQLNKIENQFCINHAIHLAVVETFYNKNNVIDEISDSENADGDEDENQFNSFAGYHNLNIDNDIDNTEYTYSLDDANINEILQNFRKTVRFFRKSPVRNDILQRYVEDKEGKKLKLILDCRTRWNSIIPMMERLVLLQVCIKHALEEIGRDDLYNEKDFNILANLIEILKP 394          
The following BLAST results are available for this feature:
BLAST of BED-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BED-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BED-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BED-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BED-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BED-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BED-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BED-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
B0W9I74.323e-3738.16Predicted protein OS=Culex quinquefasciatus OX=717... [more]
A0A4C1Y4869.280e-3036.47BED-type domain-containing protein OS=Eumeta varie... [more]
A0A226D4I72.797e-2531.33Putative AC transposase OS=Folsomia candida OX=158... [more]
A0A226EBE03.682e-2328.98Uncharacterized protein OS=Folsomia candida OX=158... [more]
A0A0N7Z9Z31.619e-2033.94BED-type domain-containing protein OS=Scylla oliva... [more]
back to top
BLAST of BED-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BED-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BED-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BED-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BED-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BED-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051925.14.212e-3678.31SMESG000051925.1[more]
SMESG000046976.11.174e-3237.39SMESG000046976.1[more]
SMESG000065760.15.369e-3029.92SMESG000065760.1[more]
SMESG000037368.18.430e-3073.33SMESG000037368.1[more]
SMESG000077975.11.995e-2931.88SMESG000077975.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016435 ID=SMED30016435|Name=BED-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2765bp
AATAAAACTTATAATATCGTGATTCATTATTATGAAAAATTACTTCAGGC
AAATGGCACTTTTAGTGACAATAAATGGGTCGAAGTATGTGTCGATCAAT
AGTCAATTCATTTTTTTTGTCGTATGCTGCTTTAATTCTCTTCTGCCGAA
GTTCCTCTGAAATTGTCAGCGATGTAAATCTGCGCTTCATTCTAGAGTTT
GACGGTTCGGATTATCCGTATTCGATATCCACGAATTTGTAGACAAAAAT
CCGTATTCGGTATCCGCTCAAATATACTCGCGATTATCGGATAGTGAAAA
TTATTTTAAATTATGTATAGAATAAAAAATCGATATAATTTGTTATTGAG
AAATTGTTAGTAAAGATTTCAAATGAAAGAGTTGAAAAAAATCAAAGGTA
ATTATAATAAATTTCTTTTTCACCGTAAAACTTGTATTAAATTTATATTG
TACTACTATTTATCCCATGGCACCATCAGCTCCTGTTTGGGAATATTTAA
AAAAAATTCCTTCTACCAATAAAAAAGTTGCCAAAGCTCAGTGTTTAAAA
TGTATGGTTTTTATTTCAAATAGTAATGGAAACACGGATGGTATGCTAAA
CCATCTGAAACTCTTACACAAAATCCATTGTAAACGGTATAATGATGAAT
CTGTTTTGGGGGATCAAGAGCAAAACTTCAAGGAAATCAAAGGAAATACG
ATGATGGATTTTGTTAAACGGCAAATTTTAAGTGAGATTGTTTCAAGATT
AGCTGCTGAAGACGTAATAACAATTTGTGCAATTACAAATTCCAAATTTA
TCAGACAATCTATTGTAGACAGAGGATATAACCTACCAAAAAGTGAAAAC
AGTGTTATGCGCCTTATTCATACTGAATTCGAAAATAGAAAACAAGAGGT
AATAAAAAAATTAACAACAATTAAGAATGATGGTGGTAAGTTTAGTATAA
CCCCTTGATGAGTGGGTAAGTGCACGAAATCGTCGCTTTATTAATATTAA
TGTACATGGAAATAATGGAAATTGCAACAATCTAGGTTTGGTGAGAGCTA
CTGGTTCGTGTACTGCAGCTGTAGTGTTAGAAAATGTAACCAAGCATTTA
GAGTTGTTTAATTTGTCGTTCCAAAACGACTTCGTTTGTACTACAAATGA
TGGTGCCAGCGTAATGGTGAAGTATGGGAGAGATTGTCCATCTAAATCAG
TTATGTTTATGTCACGGGCAAATTTGGCGGTAGTTGAAACATTTTATAAA
AAGAAAGTTTTTGAATCAAATGATGTTGACATTATAGAAGAAGATGATGA
TGACGACTTCCAAGACAATGAATTTTTCGATGATGATGTTAATGAAGAAG
AATTCGCAGATGATGAAGATGTCGACATACAAAAAAATCTGAAGAACGTG
CTGATTTTGATTAAGTTTTTGAAAAAATCTAGTGTTCGAAATTCAATTTT
ACAACAGAAAATTATCGATGAAATTGGGCACGAACTATAACTTCAACTGG
ATGTCAAACACAGGTGGAACTATATTCATCCTATGTTAGAAAAATTACTC
AGAGTTCGAATTCCAATTCAATACACTCTCATCAAATTAAATGCACTTCA
CCTAATATCTGGAATAGATTTCGAAAAATTGTCCAGCTTAATGAATGCAA
TAAAACCATTAACATCACTGTTGAAACATTGGGGAGACAAGACACCAATT
TATTAACAGCAAAAGGAGCGATGAATTTTCTGTACAACAAATTGAATGAA
TGTAATGACGTGATCTGTAGTACATTAAAATTAAATATCGAACGACGGAT
GAAAGAACGAGAAAACTCTACCATTATTGATACTCAGGCATGTCTCACCA
ATAACTCTTTAAAACCATCAAAAATTGTTTTGGAATTTGCATCTAATCTG
TTTGCTAGACTTTTTGAATATTCTTCATCTATATCACCTTCATCTTCACC
AGAACATGTAGATTTGAACACGGATGCACCAGTTTCGTTGGAAGCAGAGC
TAGATGCTGCAATTAATTATGTTACTTGCGAAAATTTTCAAAAATCCAAC
TTAAACATCAAAGATGACTTTATAATATTTAAGAAAACAATTCAAAGGCC
TGAAAAACTTGAAAAATTATTTGAAGCCTTAACAACAATAAAACCATCAT
CAACCGAAGCCGAAAGGACTGTCTCTGTTTCCTCCCACTTTTGTGGCAAA
TTTCGAACCCGTTTATCTGATTATTCTCTAAATTGCTTAGTTTTTCTAAA
ATATTTGTATATAAATGAAAAAAAGTGAATAAGTTTTCATCTTAAATTGA
CAATTTTTCGAGTTTTTTTATCTTTTCTTTTTTAAATTAGCTATTTCCAA
AATATCAGTATCCGAACGGTTAACCGCGGTTTTCGAATAATGAAAACCGG
TATTCGCGGATACTAAAAAACCGGATATTTTGGAAACTCTAGCTTCATTC
CATATTTTCAATCTTTCATCTAAGATCTCAATTTTCCCTCGATAATGTGC
ATCTGGTATTTGTTTTCAGCTTTTGTTTTGATATCTTCAGCTAATTTTAA
TCCCGAATTCCTCAGAACAATAAATGGGAATATTTTCATTTTTCTGTCAT
CCGTGCGGAACCAGTTTGGGATTAACAAGTTGTTTTCGATCCAAAATCTT
TCTGGGTCTCGATATTTTTTCTTCAATCGATGAAAATTTTCGTACGTCAT
CCTTGTACTGTTTTCCCTTCGCTCAATTTAATTAAGTCTTGGATTGTCTT
TGCCAGACCGAAAAT
back to top

protein sequence of SMED30016435-orf-1

>SMED30016435-orf-1 ID=SMED30016435-orf-1|Name=SMED30016435-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=164bp
MAPSAPVWEYLKKIPSTNKKVAKAQCLKCMVFISNSNGNTDGMLNHLKLL
HKIHCKRYNDESVLGDQEQNFKEIKGNTMMDFVKRQILSEIVSRLAAEDV
ITICAITNSKFIRQSIVDRGYNLPKSENSVMRLIHTEFENRKQEVIKKLT
TIKNDGGKFSITP*
back to top

protein sequence of SMED30016435-orf-2

>SMED30016435-orf-2 ID=SMED30016435-orf-2|Name=SMED30016435-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=109bp
MVKYGRDCPSKSVMFMSRANLAVVETFYKKKVFESNDVDIIEEDDDDDFQ
DNEFFDDDVNEEEFADDEDVDIQKNLKNVLILIKFLKKSSVRNSILQQKI
IDEIGHEL*
back to top

protein sequence of SMED30016435-orf-3

>SMED30016435-orf-3 ID=SMED30016435-orf-3|Name=SMED30016435-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=186bp
MNFLYNKLNECNDVICSTLKLNIERRMKERENSTIIDTQACLTNNSLKPS
KIVLEFASNLFARLFEYSSSISPSSSPEHVDLNTDAPVSLEAELDAAINY
VTCENFQKSNLNIKDDFIIFKKTIQRPEKLEKLFEALTTIKPSSTEAERT
VSVSSHFCGKFRTRLSDYSLNCLVFLKYLYINEKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000136whole organism
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR003656Znf_BED
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding