2-oxoisovalerate dehydrogenase subunit alpha

Overview
Name2-oxoisovalerate dehydrogenase subunit alpha
Smed IDSMED30016422
Length (bp)913
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 2-oxoisovalerate dehydrogenase subunit alpha (SMED30016422) t-SNE clustered cells

Violin plots show distribution of expression levels for 2-oxoisovalerate dehydrogenase subunit alpha (SMED30016422) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 2-oxoisovalerate dehydrogenase subunit alpha (SMED30016422) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 2-oxoisovalerate dehydrogenase subunit alpha (SMED30016422) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016422

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30016422SMESG000021412.1 dd_Smed_v4_10732_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynx tipSMED30016422SMESG000021412.1 dd_10732dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynx tipSMED30016422SMESG000021412.1 dd_10732dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
head marginSMED30016422SMESG000021412.1 dd_10732dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
epidermisSMED30016422SMESG000021412.1 dd_Smed_v4_10732_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30016422SMESG000021412.1 dd_Smed_v4_10732_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Human
Match: BCKDHA (branched chain keto acid dehydrogenase E1 subunit alpha [Source:HGNC Symbol;Acc:HGNC:986])

HSP 1 Score: 153.295 bits (386), Expect = 6.558e-75
Identity = 71/120 (59.17%), Postives = 88/120 (73.33%), Query Frame = 3
Query:    3 LWRGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDEQYHGDGL 362
            ++R + +E  + Q + N  D+ +G+QMP+HY  K+ +F +ISSPL TQ+PQAVG +Y  K     + VICYFGEG AS GDA    NFAATLECPIIFFCRNNGYAISTPT EQY GDG+
Sbjct:  165 MYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAKRANANRVVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYRGDGI 284          

HSP 2 Score: 147.902 bits (372), Expect = 6.558e-75
Identity = 68/152 (44.74%), Postives = 98/152 (64.47%), Query Frame = 2
Query:  386 GCGFGISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNKSYGNPLVLFEDVYDSMNPILKKQMEKFSKFLALNREHYP 841
            G G+GI +++VDGND  AVY ATK AR  ++ +NQP LIEAMTYR+G+H+T +    YR +DEV YW+  D+P+ R + +L+ +  W +E+ K + K+ R K+    E+A+ K   NP +LF DVY  M   L+KQ E  ++ L    EHYP
Sbjct:  288 GPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQEMPAQLRKQQESLARHLQTYGEHYP 439          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Human
Match: AC011462.1 (novel protein)

HSP 1 Score: 152.91 bits (385), Expect = 9.844e-75
Identity = 71/120 (59.17%), Postives = 88/120 (73.33%), Query Frame = 3
Query:    3 LWRGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDEQYHGDGL 362
            ++R + +E  + Q + N  D+ +G+QMP+HY  K+ +F +ISSPL TQ+PQAVG +Y  K     + VICYFGEG AS GDA    NFAATLECPIIFFCRNNGYAISTPT EQY GDG+
Sbjct:  199 MYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAKRANANRVVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYRGDGI 318          

HSP 2 Score: 147.902 bits (372), Expect = 9.844e-75
Identity = 68/152 (44.74%), Postives = 98/152 (64.47%), Query Frame = 2
Query:  386 GCGFGISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNKSYGNPLVLFEDVYDSMNPILKKQMEKFSKFLALNREHYP 841
            G G+GI +++VDGND  AVY ATK AR  ++ +NQP LIEAMTYR+G+H+T +    YR +DEV YW+  D+P+ R + +L+ +  W +E+ K + K+ R K+    E+A+ K   NP +LF DVY  M   L+KQ E  ++ L    EHYP
Sbjct:  322 GPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQEMPAQLRKQQESLARHLQTYGEHYP 473          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Human
Match: BCKDHA (branched chain keto acid dehydrogenase E1 subunit alpha [Source:HGNC Symbol;Acc:HGNC:986])

HSP 1 Score: 152.525 bits (384), Expect = 1.595e-70
Identity = 71/120 (59.17%), Postives = 88/120 (73.33%), Query Frame = 3
Query:    3 LWRGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDEQYHGDGL 362
            ++R + +E  + Q + N  D+ +G+QMP+HY  K+ +F +ISSPL TQ+PQAVG +Y  K     + VICYFGEG AS GDA    NFAATLECPIIFFCRNNGYAISTPT EQY GDG+
Sbjct:  143 MYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAKRANANRVVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYRGDGI 262          

HSP 2 Score: 134.035 bits (336), Expect = 1.595e-70
Identity = 68/177 (38.42%), Postives = 98/177 (55.37%), Query Frame = 2
Query:  386 GCGFGISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTY-------------------------RVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNKSYGNPLVLFEDVYDSMNPILKKQMEKFSKFLALNREHYP 841
            G G+GI +++VDGND  AVY ATK AR  ++ +NQP LIEAMTY                         R+G+H+T +    YR +DEV YW+  D+P+ R + +L+ +  W +E+ K + K+ R K+    E+A+ K   NP +LF DVY  M   L+KQ E  ++ L    EHYP
Sbjct:  266 GPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYSSSPILPPDPHSREPTLTWGPLPLCRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQEMPAQLRKQQESLARHLQTYGEHYP 442          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Human
Match: BCKDHA (branched chain keto acid dehydrogenase E1 subunit alpha [Source:HGNC Symbol;Acc:HGNC:986])

HSP 1 Score: 152.91 bits (385), Expect = 5.381e-57
Identity = 71/120 (59.17%), Postives = 88/120 (73.33%), Query Frame = 3
Query:    3 LWRGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDEQYHGDGL 362
            ++R + +E  + Q + N  D+ +G+QMP+HY  K+ +F +ISSPL TQ+PQAVG +Y  K     + VICYFGEG AS GDA    NFAATLECPIIFFCRNNGYAISTPT EQY GDG+
Sbjct:  136 MYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAKRANANRVVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYRGDGI 255          

HSP 2 Score: 88.5817 bits (218), Expect = 5.381e-57
Identity = 38/68 (55.88%), Postives = 51/68 (75.00%), Query Frame = 2
Query:  386 GCGFGISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWE 589
            G G+GI +++VDGND  AVY ATK AR  ++ +NQP LIEAMTYR+G+H+T +    YR +DEV YW+
Sbjct:  259 GPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWD 326          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Human
Match: PDHA2 (pyruvate dehydrogenase E1 alpha 2 subunit [Source:HGNC Symbol;Acc:HGNC:8807])

HSP 1 Score: 60.8474 bits (146), Expect = 5.848e-20
Identity = 33/99 (33.33%), Postives = 53/99 (53.54%), Query Frame = 2
Query:  401 ISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKIN 697
            I  LKVDG D L V  ATK A  +      P+L+E  TYR   H+  + G++YR  +E++      +P++  Q  +++ KL + E+ K    E R +I+
Sbjct:  247 IPGLKVDGMDVLCVREATKFAANYCRSGKGPILMELQTYRYHGHSMSDPGVSYRTREEIQEVRSKRDPIIILQDRMVNSKLATVEELKEIGAEVRKEID 345          

HSP 2 Score: 56.225 bits (134), Expect = 5.848e-20
Identity = 31/111 (27.93%), Postives = 51/111 (45.95%), Query Frame = 3
Query:    9 RGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDE 341
            RG  +  +L +L   +    +GK   +H   K  NF+  +  +G Q P   G +   K +   +  +  +G+G A+ G    A N AA  + P +F C NN Y + T T+ 
Sbjct:  125 RGLSVRSILAELTGRRGGCAKGKGGSMHMYTK--NFYGGNGIVGAQGPLGAGIALACKYKGNDEICLTLYGDGAANQGQIAEAFNMAALWKLPCVFICENNLYGMGTSTER 233          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Celegans
Match: bckd-1A (2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:O45924])

HSP 1 Score: 167.162 bits (422), Expect = 2.942e-73
Identity = 75/121 (61.98%), Postives = 93/121 (76.86%), Query Frame = 3
Query:    3 LWRGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGV-ICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDEQYHGDGL 362
            LWRG+ ME+ +NQ + N DD+ +G+QMP+H+  K+ NF +ISSPL TQ+PQAVG +Y  K QK    + + YFG+G AS GDA  A NFAATL+CPIIFFCRNNGYAISTPT EQY GDG+
Sbjct:  148 LWRGYTMENFMNQCYGNADDLGKGRQMPMHFGTKERNFVTISSPLTTQLPQAVGSAYAFKQQKDNNRIAVVYFGDGAASEGDAHAAFNFAATLKCPIIFFCRNNGYAISTPTSEQYGGDGI 268          

HSP 2 Score: 127.487 bits (319), Expect = 2.942e-73
Identity = 62/152 (40.79%), Postives = 96/152 (63.16%), Query Frame = 2
Query:  386 GCGFGISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNKSYGNPLVLFEDVYDSMNPILKKQMEKFSKFLALNREHYP 841
            G  +G+ T++VDGND LAVY ATK AR  ++  N+PVLIEAMTYR+G+H+T +    YR  DEV+ W   D+P+ RF+ ++ +R  W++EK   + KE + ++      A+ +   +   LFEDVYD +   L++Q ++    +A  +EHYP
Sbjct:  272 GPAYGLHTIRVDGNDLLAVYNATKEARRVAL-TNRPVLIEAMTYRLGHHSTSDDSTAYRSSDEVQTWGDKDHPITRFKKYITERGWWNEEKEMEWQKEVKKRVLTEFAAAEKRKKAHYHDLFEDVYDELPLRLRRQRDELDAHVAEYKEHYP 422          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Celegans
Match: bckd-1A (2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:O45924])

HSP 1 Score: 166.777 bits (421), Expect = 3.118e-73
Identity = 75/121 (61.98%), Postives = 93/121 (76.86%), Query Frame = 3
Query:    3 LWRGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGV-ICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDEQYHGDGL 362
            LWRG+ ME+ +NQ + N DD+ +G+QMP+H+  K+ NF +ISSPL TQ+PQAVG +Y  K QK    + + YFG+G AS GDA  A NFAATL+CPIIFFCRNNGYAISTPT EQY GDG+
Sbjct:  149 LWRGYTMENFMNQCYGNADDLGKGRQMPMHFGTKERNFVTISSPLTTQLPQAVGSAYAFKQQKDNNRIAVVYFGDGAASEGDAHAAFNFAATLKCPIIFFCRNNGYAISTPTSEQYGGDGI 269          

HSP 2 Score: 127.487 bits (319), Expect = 3.118e-73
Identity = 62/152 (40.79%), Postives = 96/152 (63.16%), Query Frame = 2
Query:  386 GCGFGISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNKSYGNPLVLFEDVYDSMNPILKKQMEKFSKFLALNREHYP 841
            G  +G+ T++VDGND LAVY ATK AR  ++  N+PVLIEAMTYR+G+H+T +    YR  DEV+ W   D+P+ RF+ ++ +R  W++EK   + KE + ++      A+ +   +   LFEDVYD +   L++Q ++    +A  +EHYP
Sbjct:  273 GPAYGLHTIRVDGNDLLAVYNATKEARRVAL-TNRPVLIEAMTYRLGHHSTSDDSTAYRSSDEVQTWGDKDHPITRFKKYITERGWWNEEKEMEWQKEVKKRVLTEFAAAEKRKKAHYHDLFEDVYDELPLRLRRQRDELDAHVAEYKEHYP 423          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Celegans
Match: pdha-1 (Probable pyruvate dehydrogenase E1 component subunit alpha, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P52899])

HSP 1 Score: 66.6254 bits (161), Expect = 7.848e-22
Identity = 36/116 (31.03%), Postives = 62/116 (53.45%), Query Frame = 2
Query:  416 VDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNKSYGNPLVLFEDVY 763
            VDG D LAV  ATK A+E+      P+++E  TYR   H+  + G +YR  +E++      +P+  F+  +I   L ++E+ K   KE R +++  ++ A +     P  L+ D+Y
Sbjct:  248 VDGMDILAVREATKWAKEYCDSGKGPLMMEMATYRYHGHSMSDPGTSYRTREEIQEVRKTRDPITGFKDRIITSSLATEEELKAIDKEVRKEVDEALKIATSDGVLPPEALYADIY 363          

HSP 2 Score: 55.4546 bits (132), Expect = 7.848e-22
Identity = 30/109 (27.52%), Postives = 52/109 (47.71%), Query Frame = 3
Query:   12 GFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTD 338
            G  + ++L +L         GK   +H   K  NF+  +  +G Q P   G +   K +++K   +  +G+G A+ G  F A N A   + P++F C NNG+ + T  +
Sbjct:  122 GATVTEVLAELTGRVAGNVHGKGGSMHMYTK--NFYGGNGIVGAQQPLGAGVALAMKYREQKNVCVTLYGDGAANQGQLFEATNMAKLWDLPVLFVCENNGFGMGTTAE 228          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Celegans
Match: pdha-1 (Probable pyruvate dehydrogenase E1 component subunit alpha, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P52899])

HSP 1 Score: 66.6254 bits (161), Expect = 7.848e-22
Identity = 36/116 (31.03%), Postives = 62/116 (53.45%), Query Frame = 2
Query:  416 VDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNKSYGNPLVLFEDVY 763
            VDG D LAV  ATK A+E+      P+++E  TYR   H+  + G +YR  +E++      +P+  F+  +I   L ++E+ K   KE R +++  ++ A +     P  L+ D+Y
Sbjct:  248 VDGMDILAVREATKWAKEYCDSGKGPLMMEMATYRYHGHSMSDPGTSYRTREEIQEVRKTRDPITGFKDRIITSSLATEEELKAIDKEVRKEVDEALKIATSDGVLPPEALYADIY 363          

HSP 2 Score: 55.4546 bits (132), Expect = 7.848e-22
Identity = 30/109 (27.52%), Postives = 52/109 (47.71%), Query Frame = 3
Query:   12 GFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTD 338
            G  + ++L +L         GK   +H   K  NF+  +  +G Q P   G +   K +++K   +  +G+G A+ G  F A N A   + P++F C NNG+ + T  +
Sbjct:  122 GATVTEVLAELTGRVAGNVHGKGGSMHMYTK--NFYGGNGIVGAQQPLGAGVALAMKYREQKNVCVTLYGDGAANQGQLFEATNMAKLWDLPVLFVCENNGFGMGTTAE 228          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Celegans
Match: pdha-1 (Probable pyruvate dehydrogenase E1 component subunit alpha, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P52899])

HSP 1 Score: 66.6254 bits (161), Expect = 7.848e-22
Identity = 36/116 (31.03%), Postives = 62/116 (53.45%), Query Frame = 2
Query:  416 VDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNKSYGNPLVLFEDVY 763
            VDG D LAV  ATK A+E+      P+++E  TYR   H+  + G +YR  +E++      +P+  F+  +I   L ++E+ K   KE R +++  ++ A +     P  L+ D+Y
Sbjct:  248 VDGMDILAVREATKWAKEYCDSGKGPLMMEMATYRYHGHSMSDPGTSYRTREEIQEVRKTRDPITGFKDRIITSSLATEEELKAIDKEVRKEVDEALKIATSDGVLPPEALYADIY 363          

HSP 2 Score: 55.4546 bits (132), Expect = 7.848e-22
Identity = 30/109 (27.52%), Postives = 52/109 (47.71%), Query Frame = 3
Query:   12 GFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTD 338
            G  + ++L +L         GK   +H   K  NF+  +  +G Q P   G +   K +++K   +  +G+G A+ G  F A N A   + P++F C NNG+ + T  +
Sbjct:  122 GATVTEVLAELTGRVAGNVHGKGGSMHMYTK--NFYGGNGIVGAQQPLGAGVALAMKYREQKNVCVTLYGDGAANQGQLFEATNMAKLWDLPVLFVCENNGFGMGTTAE 228          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Fly
Match: CG8199 (gene:FBgn0037709 transcript:FBtr0082067)

HSP 1 Score: 165.236 bits (417), Expect = 8.951e-66
Identity = 72/121 (59.50%), Postives = 92/121 (76.03%), Query Frame = 3
Query:    3 LWRGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQG-VICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDEQYHGDGL 362
            +WRGF ++  ++Q + N DD+ RGKQMP+HY ++++NF +ISSPL TQMPQAVG +Y  K++      V+CYFGEG AS GDA  A NFAATL CP I FCRNNG+AISTP+ EQY GDG+
Sbjct:  157 VWRGFRIDQFIDQCYGNTDDLGRGKQMPVHYGSRELNFVTISSPLSTQMPQAVGAAYAMKLRPNNDACVVCYFGEGAASEGDAHAAFNFAATLGCPAILFCRNNGFAISTPSHEQYKGDGI 277          

HSP 2 Score: 104.76 bits (260), Expect = 8.951e-66
Identity = 50/150 (33.33%), Postives = 89/150 (59.33%), Query Frame = 2
Query:  392 GFGISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNKSYGNPLVLFEDVYDSMNPILKKQMEKFSKFLALNREHYP 841
            G+GI+T++VDG D  AVY A K ARE+ +++N+PV+ EA+ YRVG+H+T +    YR  +E++ W   ++P+ + + +++ +  + +     + K+ R K+   I  ++ K   N   +FE VY  M   L +Q  +  K +  ++EHYP
Sbjct:  284 GYGITTIRVDGTDVFAVYNAMKAAREYVLKENKPVVFEALAYRVGHHSTSDDSTAYRPAEEIEIWNSVEHPISKLKRYMVHKGWFDETVENEYVKDIRKKVLKQIAVSEKKLKPNWREMFEGVYAEMPDHLIEQRSELEKHIEAHKEHYP 433          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Fly
Match: CG7024 (gene:FBgn0029722 transcript:FBtr0070712)

HSP 1 Score: 53.9138 bits (128), Expect = 2.054e-17
Identity = 31/107 (28.97%), Postives = 52/107 (48.60%), Query Frame = 3
Query:   12 GFDMEDMLNQLFANKDDINRGKQMPIH-YSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAIST 329
            G  + +++ +LF  +   +RGK   +H YS+K   F+  +  +G Q+P   G    +  +K     +  +G+G A+ G  F + N A     P IF C NN Y + T
Sbjct:  130 GVSLYEIMAELFGVRTGCSRGKGGSMHMYSDK---FYGGNGIVGAQVPLGAGIGLAHSYRKDNGVSVVLYGDGAANQGQIFESFNMAKLWCLPCIFVCENNHYGMGT 233          

HSP 2 Score: 53.9138 bits (128), Expect = 2.054e-17
Identity = 31/105 (29.52%), Postives = 58/105 (55.24%), Query Frame = 2
Query:  401 ISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERA 715
            I  L VDGN  LAV  AT+ A + +++   P+++E  TYR   H+  + G +YR  +EV+      +P+  F++ +I   L  +E+ K    + R +++ + ++A
Sbjct:  251 IPGLWVDGNQVLAVRSATQFAVDHALKHG-PIVLEMSTYRYVGHSMSDPGTSYRSREEVQSTREKRDPITSFRSQIIALCLADEEELKALDDKTRKQVDSICKKA 354          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Fly
Match: Pdha (gene:FBgn0028325 transcript:FBtr0070710)

HSP 1 Score: 50.8322 bits (120), Expect = 2.105e-15
Identity = 36/127 (28.35%), Postives = 52/127 (40.94%), Query Frame = 3
Query:   12 GFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTP-------TDEQYHGDGLDDI 371
            G     +L +L   +    RGK   +H      NF+  +  +G Q+P   G     K +      +  +G+G A+ G  F A N A   + P+IF C NN Y + T        TD    GD L  I
Sbjct:   61 GVSPSGVLAELTGVQGGCARGKGGSMHMYAP--NFYGGNGIVGAQVPLGAGVGLACKYKGNGGMCLALYGDGAANQGQVFEAYNMAYLWKLPVIFVCENNNYGMGTSSERASCNTDYYTRGDALPGI 185          

HSP 2 Score: 50.0618 bits (118), Expect = 2.105e-15
Identity = 34/136 (25.00%), Postives = 69/136 (50.74%), Query Frame = 2
Query:  392 GFGISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNKSYGNPLVLFEDVY-DSMNPILKKQM 796
            G  +  + VDG D LAV  AT+ A  + +  + P+++E  TYR   H+  + G +YR  +E++      +P+  F+   I+  L + ++ K    + R +++     A++ +      L+ DVY +++ P L+  +
Sbjct:  179 GDALPGIWVDGMDVLAVRSATEFAINY-VNTHGPLVMETNTYRYSGHSMSDPGTSYRTREEIQEVRQKRDPITSFKELCIELGLITTDEVKAIDLKVRKEVDEATAFAKSDAELGVSHLWTDVYSNNLEPKLRGTI 313          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Fly
Match: Pdha (gene:FBgn0028325 transcript:FBtr0070708)

HSP 1 Score: 50.0618 bits (118), Expect = 3.272e-15
Identity = 36/127 (28.35%), Postives = 52/127 (40.94%), Query Frame = 3
Query:   12 GFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTP-------TDEQYHGDGLDDI 371
            G     +L +L   +    RGK   +H      NF+  +  +G Q+P   G     K +      +  +G+G A+ G  F A N A   + P+IF C NN Y + T        TD    GD L  I
Sbjct:  132 GVSPSGVLAELTGVQGGCARGKGGSMHMYAP--NFYGGNGIVGAQVPLGAGVGLACKYKGNGGMCLALYGDGAANQGQVFEAYNMAYLWKLPVIFVCENNNYGMGTSSERASCNTDYYTRGDALPGI 256          

HSP 2 Score: 50.0618 bits (118), Expect = 3.272e-15
Identity = 34/133 (25.56%), Postives = 68/133 (51.13%), Query Frame = 2
Query:  392 GFGISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNKSYGNPLVLFEDVY-DSMNPILK 787
            G  +  + VDG D LAV  AT+ A  + +  + P+++E  TYR   H+  + G +YR  +E++      +P+  F+   I+  L + ++ K    + R +++     A++ +      L+ DVY +++ P L+
Sbjct:  250 GDALPGIWVDGMDVLAVRSATEFAINY-VNTHGPLVMETNTYRYSGHSMSDPGTSYRTREEIQEVRQKRDPITSFKELCIELGLITTDEVKAIDLKVRKEVDEATAFAKSDAELGVSHLWTDVYSNNLEPKLR 381          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Fly
Match: Pdha (gene:FBgn0028325 transcript:FBtr0070709)

HSP 1 Score: 50.0618 bits (118), Expect = 3.272e-15
Identity = 36/127 (28.35%), Postives = 52/127 (40.94%), Query Frame = 3
Query:   12 GFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTP-------TDEQYHGDGLDDI 371
            G     +L +L   +    RGK   +H      NF+  +  +G Q+P   G     K +      +  +G+G A+ G  F A N A   + P+IF C NN Y + T        TD    GD L  I
Sbjct:  132 GVSPSGVLAELTGVQGGCARGKGGSMHMYAP--NFYGGNGIVGAQVPLGAGVGLACKYKGNGGMCLALYGDGAANQGQVFEAYNMAYLWKLPVIFVCENNNYGMGTSSERASCNTDYYTRGDALPGI 256          

HSP 2 Score: 50.0618 bits (118), Expect = 3.272e-15
Identity = 34/133 (25.56%), Postives = 68/133 (51.13%), Query Frame = 2
Query:  392 GFGISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNKSYGNPLVLFEDVY-DSMNPILK 787
            G  +  + VDG D LAV  AT+ A  + +  + P+++E  TYR   H+  + G +YR  +E++      +P+  F+   I+  L + ++ K    + R +++     A++ +      L+ DVY +++ P L+
Sbjct:  250 GDALPGIWVDGMDVLAVRSATEFAINY-VNTHGPLVMETNTYRYSGHSMSDPGTSYRTREEIQEVRQKRDPITSFKELCIELGLITTDEVKAIDLKVRKEVDEATAFAKSDAELGVSHLWTDVYSNNLEPKLR 381          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Zebrafish
Match: bckdha (branched chain keto acid dehydrogenase E1 subunit alpha [Source:ZFIN;Acc:ZDB-GENE-050522-376])

HSP 1 Score: 169.088 bits (427), Expect = 1.736e-77
Identity = 73/120 (60.83%), Postives = 94/120 (78.33%), Query Frame = 3
Query:    3 LWRGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDEQYHGDGL 362
            ++RGF ++  + Q +AN DD+ +G+QMP+HY +KD+NF +ISSPL TQ+PQA G +Y  K +   + VICYFGEG AS GDA    NF+ATLECP+IFFCRNNGYAISTPT+EQY GDG+
Sbjct:  166 MYRGFPLDLFMAQCYANADDLGKGRQMPVHYGSKDLNFVTISSPLATQIPQAAGAAYAVKRENANRVVICYFGEGAASEGDAHAGFNFSATLECPLIFFCRNNGYAISTPTNEQYRGDGI 285          

HSP 2 Score: 140.584 bits (353), Expect = 1.736e-77
Identity = 62/152 (40.79%), Postives = 97/152 (63.82%), Query Frame = 2
Query:  386 GCGFGISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNKSYGNPLVLFEDVYDSMNPILKKQMEKFSKFLALNREHYP 841
            G G+G+ +++VDGND  AVY ATK AR  ++ +NQP LIEAMTYR+G+H+T +    YR +DEV YW+  D+P+ R + ++  R  W +++ + + K+ R  +    ERA+ +   NP ++F DVYD M P + KQ +   + +   +EHYP
Sbjct:  289 GPGYGLMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRHYMTARDWWGEDEERAWRKQSRKLVMEAFERAERRLKPNPDLMFTDVYDEMVPHIAKQKDSMWRHVQQYKEHYP 440          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Zebrafish
Match: bckdha (branched chain keto acid dehydrogenase E1 subunit alpha [Source:ZFIN;Acc:ZDB-GENE-050522-376])

HSP 1 Score: 169.088 bits (427), Expect = 1.736e-77
Identity = 73/120 (60.83%), Postives = 94/120 (78.33%), Query Frame = 3
Query:    3 LWRGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDEQYHGDGL 362
            ++RGF ++  + Q +AN DD+ +G+QMP+HY +KD+NF +ISSPL TQ+PQA G +Y  K +   + VICYFGEG AS GDA    NF+ATLECP+IFFCRNNGYAISTPT+EQY GDG+
Sbjct:  166 MYRGFPLDLFMAQCYANADDLGKGRQMPVHYGSKDLNFVTISSPLATQIPQAAGAAYAVKRENANRVVICYFGEGAASEGDAHAGFNFSATLECPLIFFCRNNGYAISTPTNEQYRGDGI 285          

HSP 2 Score: 140.584 bits (353), Expect = 1.736e-77
Identity = 62/152 (40.79%), Postives = 97/152 (63.82%), Query Frame = 2
Query:  386 GCGFGISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNKSYGNPLVLFEDVYDSMNPILKKQMEKFSKFLALNREHYP 841
            G G+G+ +++VDGND  AVY ATK AR  ++ +NQP LIEAMTYR+G+H+T +    YR +DEV YW+  D+P+ R + ++  R  W +++ + + K+ R  +    ERA+ +   NP ++F DVYD M P + KQ +   + +   +EHYP
Sbjct:  289 GPGYGLMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRHYMTARDWWGEDEERAWRKQSRKLVMEAFERAERRLKPNPDLMFTDVYDEMVPHIAKQKDSMWRHVQQYKEHYP 440          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Zebrafish
Match: pdha1a (pyruvate dehydrogenase E1 alpha 1 subunit a [Source:ZFIN;Acc:ZDB-GENE-040426-2719])

HSP 1 Score: 64.6994 bits (156), Expect = 1.068e-20
Identity = 33/112 (29.46%), Postives = 56/112 (50.00%), Query Frame = 3
Query:    3 LWRGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTD 338
            L RG  + +++ +L   +  I +GK   +H   K  +F+  +  +G Q+P   G +   K Q K +  +C +G+G A+ G  F   N A+  + P IF C NN Y + T  +
Sbjct:  135 LTRGGTVREIMAELTGRRGGIAKGKGGSMHMYTK--HFYGGNGIVGAQVPLGAGVALACKYQGKNELCVCLYGDGAANQGQIFETYNMASLWKLPCIFICENNKYGMGTSVE 244          

HSP 2 Score: 54.299 bits (129), Expect = 1.068e-20
Identity = 31/98 (31.63%), Postives = 49/98 (50.00%), Query Frame = 2
Query:  401 ISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKI 694
            I  L+VDG D L V  ATK A E       P+L+E  TYR   H+  + G++YR  +E++      +P+   +  ++   + S E+ K    E R +I
Sbjct:  259 IPGLRVDGMDVLCVREATKFAAEHCRSGKGPILMELQTYRYHGHSMSDPGVSYRTREEIQEVRSKSDPISLLKDRMLSNNMASVEELKEIDVEVRKEI 356          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Zebrafish
Match: pdha1a (pyruvate dehydrogenase E1 alpha 1 subunit a [Source:ZFIN;Acc:ZDB-GENE-040426-2719])

HSP 1 Score: 64.6994 bits (156), Expect = 1.150e-20
Identity = 33/113 (29.20%), Postives = 56/113 (49.56%), Query Frame = 3
Query:    3 LWRGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDE 341
            L RG  + +++ +L   +  I +GK   +H   K  +F+  +  +G Q+P   G +   K Q K +  +C +G+G A+ G  F   N A+  + P IF C NN Y + T  + 
Sbjct:  128 LTRGGTVREIMAELTGRRGGIAKGKGGSMHMYTK--HFYGGNGIVGAQVPLGAGVALACKYQGKNELCVCLYGDGAANQGQIFETYNMASLWKLPCIFICENNKYGMGTSVER 238          

HSP 2 Score: 54.299 bits (129), Expect = 1.150e-20
Identity = 31/98 (31.63%), Postives = 49/98 (50.00%), Query Frame = 2
Query:  401 ISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKI 694
            I  L+VDG D L V  ATK A E       P+L+E  TYR   H+  + G++YR  +E++      +P+   +  ++   + S E+ K    E R +I
Sbjct:  252 IPGLRVDGMDVLCVREATKFAAEHCRSGKGPILMELQTYRYHGHSMSDPGVSYRTREEIQEVRSKSDPISLLKDRMLSNNMASVEELKEIDVEVRKEI 349          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Zebrafish
Match: pdha1a (pyruvate dehydrogenase E1 alpha 1 subunit a [Source:ZFIN;Acc:ZDB-GENE-040426-2719])

HSP 1 Score: 64.6994 bits (156), Expect = 1.150e-20
Identity = 33/113 (29.20%), Postives = 56/113 (49.56%), Query Frame = 3
Query:    3 LWRGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDE 341
            L RG  + +++ +L   +  I +GK   +H   K  +F+  +  +G Q+P   G +   K Q K +  +C +G+G A+ G  F   N A+  + P IF C NN Y + T  + 
Sbjct:  128 LTRGGTVREIMAELTGRRGGIAKGKGGSMHMYTK--HFYGGNGIVGAQVPLGAGVALACKYQGKNELCVCLYGDGAANQGQIFETYNMASLWKLPCIFICENNKYGMGTSVER 238          

HSP 2 Score: 54.299 bits (129), Expect = 1.150e-20
Identity = 31/98 (31.63%), Postives = 49/98 (50.00%), Query Frame = 2
Query:  401 ISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKI 694
            I  L+VDG D L V  ATK A E       P+L+E  TYR   H+  + G++YR  +E++      +P+   +  ++   + S E+ K    E R +I
Sbjct:  252 IPGLRVDGMDVLCVREATKFAAEHCRSGKGPILMELQTYRYHGHSMSDPGVSYRTREEIQEVRSKSDPISLLKDRMLSNNMASVEELKEIDVEVRKEI 349          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Xenopus
Match: h6pd (hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) [Source:Xenbase;Acc:XB-GENE-988586])

HSP 1 Score: 164.466 bits (415), Expect = 2.104e-75
Identity = 72/120 (60.00%), Postives = 91/120 (75.83%), Query Frame = 3
Query:    3 LWRGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDEQYHGDGL 362
            ++RG+ ++  + Q + N  D  +GKQMP+HY  KD+NF +ISSPL TQ+PQAVG +Y  K +   + VICYFGEG AS GDA  A NF+ATLECP++FFCRNNGYAISTPT EQY GDG+
Sbjct:  153 MYRGYPLDLFMAQCYGNASDPGKGKQMPVHYGCKDLNFVTISSPLATQIPQAVGAAYSFKRENADRAVICYFGEGAASEGDAHAAFNFSATLECPVLFFCRNNGYAISTPTSEQYRGDGI 272          

HSP 2 Score: 138.658 bits (348), Expect = 2.104e-75
Identity = 66/152 (43.42%), Postives = 94/152 (61.84%), Query Frame = 2
Query:  386 GCGFGISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNKSYGNPLVLFEDVYDSMNPILKKQMEKFSKFLALNREHYP 841
            G G+GI +++VDGND  AVY ATK AR  ++ +NQP LIEAMTYR+G+H+T +    YR +DEV YW+  D+P+ R + +++ +  W +E+ KI+ K+ R  +    E A+ K       +F DVY  M   L+KQ E   K L L  EHYP
Sbjct:  276 GPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRHYMLHKGWWDEEQEKIWRKKSRKMVMEAFEEAERKHKPKVEHMFSDVYSEMPAQLRKQEESLMKHLKLYGEHYP 427          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Xenopus
Match: h6pd (hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) [Source:Xenbase;Acc:XB-GENE-988586])

HSP 1 Score: 164.081 bits (414), Expect = 2.699e-75
Identity = 72/120 (60.00%), Postives = 91/120 (75.83%), Query Frame = 3
Query:    3 LWRGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDEQYHGDGL 362
            ++RG+ ++  + Q + N  D  +GKQMP+HY  KD+NF +ISSPL TQ+PQAVG +Y  K +   + VICYFGEG AS GDA  A NF+ATLECP++FFCRNNGYAISTPT EQY GDG+
Sbjct:  132 MYRGYPLDLFMAQCYGNASDPGKGKQMPVHYGCKDLNFVTISSPLATQIPQAVGAAYSFKRENADRAVICYFGEGAASEGDAHAAFNFSATLECPVLFFCRNNGYAISTPTSEQYRGDGI 251          

HSP 2 Score: 138.272 bits (347), Expect = 2.699e-75
Identity = 66/152 (43.42%), Postives = 94/152 (61.84%), Query Frame = 2
Query:  386 GCGFGISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNKSYGNPLVLFEDVYDSMNPILKKQMEKFSKFLALNREHYP 841
            G G+GI +++VDGND  AVY ATK AR  ++ +NQP LIEAMTYR+G+H+T +    YR +DEV YW+  D+P+ R + +++ +  W +E+ KI+ K+ R  +    E A+ K       +F DVY  M   L+KQ E   K L L  EHYP
Sbjct:  255 GPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRHYMLHKGWWDEEQEKIWRKKSRKMVMEAFEEAERKHKPKVEHMFSDVYSEMPAQLRKQEESLMKHLKLYGEHYP 406          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Xenopus
Match: h6pd (hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) [Source:Xenbase;Acc:XB-GENE-988586])

HSP 1 Score: 164.081 bits (414), Expect = 3.160e-75
Identity = 72/120 (60.00%), Postives = 91/120 (75.83%), Query Frame = 3
Query:    3 LWRGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDEQYHGDGL 362
            ++RG+ ++  + Q + N  D  +GKQMP+HY  KD+NF +ISSPL TQ+PQAVG +Y  K +   + VICYFGEG AS GDA  A NF+ATLECP++FFCRNNGYAISTPT EQY GDG+
Sbjct:  137 MYRGYPLDLFMAQCYGNASDPGKGKQMPVHYGCKDLNFVTISSPLATQIPQAVGAAYSFKRENADRAVICYFGEGAASEGDAHAAFNFSATLECPVLFFCRNNGYAISTPTSEQYRGDGI 256          

HSP 2 Score: 138.272 bits (347), Expect = 3.160e-75
Identity = 66/152 (43.42%), Postives = 94/152 (61.84%), Query Frame = 2
Query:  386 GCGFGISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNKSYGNPLVLFEDVYDSMNPILKKQMEKFSKFLALNREHYP 841
            G G+GI +++VDGND  AVY ATK AR  ++ +NQP LIEAMTYR+G+H+T +    YR +DEV YW+  D+P+ R + +++ +  W +E+ KI+ K+ R  +    E A+ K       +F DVY  M   L+KQ E   K L L  EHYP
Sbjct:  260 GPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRHYMLHKGWWDEEQEKIWRKKSRKMVMEAFEEAERKHKPKVEHMFSDVYSEMPAQLRKQEESLMKHLKLYGEHYP 411          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Xenopus
Match: h6pd (hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) [Source:Xenbase;Acc:XB-GENE-988586])

HSP 1 Score: 164.081 bits (414), Expect = 3.377e-75
Identity = 72/120 (60.00%), Postives = 91/120 (75.83%), Query Frame = 3
Query:    3 LWRGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDEQYHGDGL 362
            ++RG+ ++  + Q + N  D  +GKQMP+HY  KD+NF +ISSPL TQ+PQAVG +Y  K +   + VICYFGEG AS GDA  A NF+ATLECP++FFCRNNGYAISTPT EQY GDG+
Sbjct:  145 MYRGYPLDLFMAQCYGNASDPGKGKQMPVHYGCKDLNFVTISSPLATQIPQAVGAAYSFKRENADRAVICYFGEGAASEGDAHAAFNFSATLECPVLFFCRNNGYAISTPTSEQYRGDGI 264          

HSP 2 Score: 138.272 bits (347), Expect = 3.377e-75
Identity = 66/152 (43.42%), Postives = 94/152 (61.84%), Query Frame = 2
Query:  386 GCGFGISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNKSYGNPLVLFEDVYDSMNPILKKQMEKFSKFLALNREHYP 841
            G G+GI +++VDGND  AVY ATK AR  ++ +NQP LIEAMTYR+G+H+T +    YR +DEV YW+  D+P+ R + +++ +  W +E+ KI+ K+ R  +    E A+ K       +F DVY  M   L+KQ E   K L L  EHYP
Sbjct:  268 GPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRHYMLHKGWWDEEQEKIWRKKSRKMVMEAFEEAERKHKPKVEHMFSDVYSEMPAQLRKQEESLMKHLKLYGEHYP 419          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Xenopus
Match: h6pd (hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) [Source:Xenbase;Acc:XB-GENE-988586])

HSP 1 Score: 164.081 bits (414), Expect = 3.377e-75
Identity = 72/120 (60.00%), Postives = 91/120 (75.83%), Query Frame = 3
Query:    3 LWRGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDEQYHGDGL 362
            ++RG+ ++  + Q + N  D  +GKQMP+HY  KD+NF +ISSPL TQ+PQAVG +Y  K +   + VICYFGEG AS GDA  A NF+ATLECP++FFCRNNGYAISTPT EQY GDG+
Sbjct:  140 MYRGYPLDLFMAQCYGNASDPGKGKQMPVHYGCKDLNFVTISSPLATQIPQAVGAAYSFKRENADRAVICYFGEGAASEGDAHAAFNFSATLECPVLFFCRNNGYAISTPTSEQYRGDGI 259          

HSP 2 Score: 138.272 bits (347), Expect = 3.377e-75
Identity = 66/152 (43.42%), Postives = 94/152 (61.84%), Query Frame = 2
Query:  386 GCGFGISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNKSYGNPLVLFEDVYDSMNPILKKQMEKFSKFLALNREHYP 841
            G G+GI +++VDGND  AVY ATK AR  ++ +NQP LIEAMTYR+G+H+T +    YR +DEV YW+  D+P+ R + +++ +  W +E+ KI+ K+ R  +    E A+ K       +F DVY  M   L+KQ E   K L L  EHYP
Sbjct:  263 GPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRHYMLHKGWWDEEQEKIWRKKSRKMVMEAFEEAERKHKPKVEHMFSDVYSEMPAQLRKQEESLMKHLKLYGEHYP 414          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Mouse
Match: Bckdha (branched chain ketoacid dehydrogenase E1, alpha polypeptide [Source:MGI Symbol;Acc:MGI:107701])

HSP 1 Score: 152.525 bits (384), Expect = 7.213e-75
Identity = 71/120 (59.17%), Postives = 89/120 (74.17%), Query Frame = 3
Query:    3 LWRGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDEQYHGDGL 362
            ++R + +E  ++Q + N +D  +G+QMP+HY  K+ +F +ISSPL TQ+PQAVG +Y  K     + VICYFGEG AS GDA    NFAATLECPIIFFCRNNGYAISTPT EQY GDG+
Sbjct:  166 MYRDYPLELFMSQCYGNVNDPGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAKRANANRIVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYRGDGI 285          

HSP 2 Score: 147.902 bits (372), Expect = 7.213e-75
Identity = 67/152 (44.08%), Postives = 99/152 (65.13%), Query Frame = 2
Query:  386 GCGFGISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNKSYGNPLVLFEDVYDSMNPILKKQMEKFSKFLALNREHYP 841
            G G+GI +++VDGND  AVY ATK AR  ++ +NQP LIEAMTYR+G+H+T +    YR +DEV YW+  D+P+ R + +L+++  W +E+ K + K+ R K+    E+A+ K   NP +LF DVY  M   L++Q E  ++ L    EHYP
Sbjct:  289 GPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRQYLLNQGWWDEEQEKAWRKQSRKKVMEAFEQAERKLKPNPSLLFSDVYQEMPAQLRRQQESLARHLQTYGEHYP 440          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Mouse
Match: Bckdha (branched chain ketoacid dehydrogenase E1, alpha polypeptide [Source:MGI Symbol;Acc:MGI:107701])

HSP 1 Score: 74.3294 bits (181), Expect = 2.006e-25
Identity = 31/35 (88.57%), Postives = 32/35 (91.43%), Query Frame = 3
Query:  258 LNFAATLECPIIFFCRNNGYAISTPTDEQYHGDGL 362
             NFAATLECPIIFFCRNNGYAISTPT EQY GDG+
Sbjct:    1 FNFAATLECPIIFFCRNNGYAISTPTSEQYRGDGI 35          

HSP 2 Score: 60.8474 bits (146), Expect = 2.006e-25
Identity = 27/44 (61.36%), Postives = 34/44 (77.27%), Query Frame = 2
Query:  386 GCGFGISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTY 517
            G G+GI +++VDGND  AVY ATK AR  ++ +NQP LIEAMTY
Sbjct:   39 GPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTY 82          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Mouse
Match: Pdha1 (pyruvate dehydrogenase E1 alpha 1 [Source:MGI Symbol;Acc:MGI:97532])

HSP 1 Score: 59.3066 bits (142), Expect = 2.498e-20
Identity = 33/111 (29.73%), Postives = 52/111 (46.85%), Query Frame = 3
Query:    9 RGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDE 341
            RG  +  +L +L   +    +GK   +H   K  NF+  +  +G Q+P   G +   K   K +  +  +G+G A+ G  F A N AA  + P IF C NN Y + T  + 
Sbjct:  127 RGLPVRAILAELTGRRGGCAKGKGGSMHMYAK--NFYGGNGIVGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNRYGMGTSVER 235          

HSP 2 Score: 58.5362 bits (140), Expect = 2.498e-20
Identity = 40/146 (27.40%), Postives = 70/146 (47.95%), Query Frame = 2
Query:  401 ISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNKSYGNPLVLFED----VYDSMNPILKKQMEKFSKFLALN 826
            I  L+VDG D L V  ATK A  +      P+L+E  TYR   H+  + G++YR  +E++      +P++  +  +++  L S E+ K    E R +    IE A   +  +P    E+    +Y S  P   +   ++ KF +++
Sbjct:  249 IPGLRVDGMDILCVREATKFAAAYCRSGKGPILMELQTYRYHGHSMSDPGVSYRTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKE----IEDAAQFATADPEPPLEELGYHIYSSDPPFEVRGANQWIKFKSVS 390          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Mouse
Match: Pdha2 (pyruvate dehydrogenase E1 alpha 2 [Source:MGI Symbol;Acc:MGI:97533])

HSP 1 Score: 54.299 bits (129), Expect = 2.750e-17
Identity = 36/122 (29.51%), Postives = 57/122 (46.72%), Query Frame = 3
Query:    9 RGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDEQ-----YHGDG 359
            RG  ++ +L +L   K    +GK   +H   K  NF+  +  +G Q+P   G ++  K  K  Q  +  +G+G A+ G  F A N +A  + P +F C NN Y + T  +       YH  G
Sbjct:  128 RGLSVKSILAELTGRKGGCAKGKGGSMHMYGK--NFYGGNGIVGAQVPLGAGVAFACKYLKNGQVCLALYGDGAANQGQVFEAYNMSALWKLPCVFICENNLYGMGTSNERSAASTDYHKKG 247          

HSP 2 Score: 53.1434 bits (126), Expect = 2.750e-17
Identity = 34/107 (31.78%), Postives = 51/107 (47.66%), Query Frame = 2
Query:  392 GFGISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWS----KEKNKIFHKECRDKINF 700
            GF I  L+V+G D L V  ATK A +       P+++E  TYR   H+  + GI+YR  +EV       +P++  +  +I   L +    KE +    KE  D   F
Sbjct:  247 GFIIPGLRVNGMDILCVREATKFAADHCRSGKGPIVMELQTYRYHGHSMSDPGISYRSREEVHNVRSKSDPIMLLRERIISNNLSNIEELKEIDADVKKEVEDAAQF 353          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. UniProt/SwissProt
Match: sp|A5A6H9|ODBA_PANTR (2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Pan troglodytes OX=9598 GN=BCKDHA PE=2 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 2.565e-74
Identity = 71/120 (59.17%), Postives = 88/120 (73.33%), Query Frame = 3
Query:    3 LWRGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDEQYHGDGL 362
            ++R + +E  + Q + N  D+ +G+QMP+HY  K+ +F +ISSPL TQ+PQAVG +Y  K     + VICYFGEG AS GDA    NFAATLECPIIFFCRNNGYAISTPT EQY GDG+
Sbjct:  165 MYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAKRANANRVVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYRGDGI 284          

HSP 2 Score: 148.288 bits (373), Expect = 2.565e-74
Identity = 68/152 (44.74%), Postives = 98/152 (64.47%), Query Frame = 2
Query:  386 GCGFGISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNKSYGNPLVLFEDVYDSMNPILKKQMEKFSKFLALNREHYP 841
            G G+GI +++VDGND  AVY ATK AR  ++ +NQP LIEAMTYR+G+H+T +    YR +DEV YW+  D+P+ R + +L+ +  W +E+ K + K+ R K+    E+A+ K   NP +LF DVY  M   L+KQ E  ++ L    EHYP
Sbjct:  288 GPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPVSRLRHYLLSQGWWDEEQEKAWRKQSRKKVMEAFEQAERKPKPNPNLLFSDVYQEMPAQLRKQQESLARHLQTYGEHYP 439          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. UniProt/SwissProt
Match: sp|Q8HXY4|ODBA_MACFA (2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Macaca fascicularis OX=9541 GN=BCKDHA PE=2 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 2.587e-74
Identity = 71/120 (59.17%), Postives = 88/120 (73.33%), Query Frame = 3
Query:    3 LWRGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDEQYHGDGL 362
            ++R + +E  + Q + N  D+ +G+QMP+HY  K+ +F +ISSPL TQ+PQAVG +Y  K     + VICYFGEG AS GDA    NFAATLECPIIFFCRNNGYAISTPT EQY GDG+
Sbjct:  165 MYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAKRANANRVVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYRGDGI 284          

HSP 2 Score: 148.288 bits (373), Expect = 2.587e-74
Identity = 68/152 (44.74%), Postives = 98/152 (64.47%), Query Frame = 2
Query:  386 GCGFGISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNKSYGNPLVLFEDVYDSMNPILKKQMEKFSKFLALNREHYP 841
            G G+GI +++VDGND  AVY ATK AR  ++ +NQP LIEAMTYR+G+H+T +    YR +DEV YW+  D+P+ R + +L+ +  W +E+ K + K+ R K+    E+A+ K   NP +LF DVY  M   L+KQ E  ++ L    EHYP
Sbjct:  288 GPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRHYLLSQGWWDEEQEKAWRKQSRKKVMKAFEQAERKPKPNPNLLFSDVYQEMPAQLRKQQESLARHLQTYGEHYP 439          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. UniProt/SwissProt
Match: sp|P50136|ODBA_MOUSE (2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Bckdha PE=1 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 2.674e-74
Identity = 71/120 (59.17%), Postives = 89/120 (74.17%), Query Frame = 3
Query:    3 LWRGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDEQYHGDGL 362
            ++R + +E  ++Q + N +D  +G+QMP+HY  K+ +F +ISSPL TQ+PQAVG +Y  K     + VICYFGEG AS GDA    NFAATLECPIIFFCRNNGYAISTPT EQY GDG+
Sbjct:  162 MYRDYPLELFMSQCYGNVNDPGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAKRANANRIVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYRGDGI 281          

HSP 2 Score: 148.673 bits (374), Expect = 2.674e-74
Identity = 67/152 (44.08%), Postives = 99/152 (65.13%), Query Frame = 2
Query:  386 GCGFGISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNKSYGNPLVLFEDVYDSMNPILKKQMEKFSKFLALNREHYP 841
            G G+GI +++VDGND  AVY ATK AR  ++ +NQP LIEAMTYR+G+H+T +    YR +DEV YW+  D+P+ R + +L+++  W +E+ K + K+ R K+    E+A+ K   NP +LF DVY  M   L++Q E  ++ L    EHYP
Sbjct:  285 GPGYGIKSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRQYLLNQGWWDEEQEKAWRKQSRKKVMEAFEQAERKLKPNPSLLFSDVYQEMPAQLRRQQESLARHLQTYGEHYP 436          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. UniProt/SwissProt
Match: sp|P12694|ODBA_HUMAN (2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=BCKDHA PE=1 SV=2)

HSP 1 Score: 153.295 bits (386), Expect = 2.811e-74
Identity = 71/120 (59.17%), Postives = 88/120 (73.33%), Query Frame = 3
Query:    3 LWRGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDEQYHGDGL 362
            ++R + +E  + Q + N  D+ +G+QMP+HY  K+ +F +ISSPL TQ+PQAVG +Y  K     + VICYFGEG AS GDA    NFAATLECPIIFFCRNNGYAISTPT EQY GDG+
Sbjct:  165 MYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAKRANANRVVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYRGDGI 284          

HSP 2 Score: 147.902 bits (372), Expect = 2.811e-74
Identity = 68/152 (44.74%), Postives = 98/152 (64.47%), Query Frame = 2
Query:  386 GCGFGISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNKSYGNPLVLFEDVYDSMNPILKKQMEKFSKFLALNREHYP 841
            G G+GI +++VDGND  AVY ATK AR  ++ +NQP LIEAMTYR+G+H+T +    YR +DEV YW+  D+P+ R + +L+ +  W +E+ K + K+ R K+    E+A+ K   NP +LF DVY  M   L+KQ E  ++ L    EHYP
Sbjct:  288 GPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQEMPAQLRKQQESLARHLQTYGEHYP 439          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. UniProt/SwissProt
Match: sp|P11960|ODBA_RAT (2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial (Fragment) OS=Rattus norvegicus OX=10116 GN=Bckdha PE=1 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 3.430e-74
Identity = 72/120 (60.00%), Postives = 87/120 (72.50%), Query Frame = 3
Query:    3 LWRGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDEQYHGDGL 362
            ++R + +E  + Q + N  D  +G+QMP+HY  K+ +F +ISSPL TQ+PQAVG +Y  K     Q VICYFGEG AS GDA    NFAATLECPIIFFCRNNGYAISTPT EQY GDG+
Sbjct:  161 MYRDYPLELFMAQCYGNVSDPGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAKRANANQIVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYRGDGI 280          

HSP 2 Score: 148.288 bits (373), Expect = 3.430e-74
Identity = 67/152 (44.08%), Postives = 99/152 (65.13%), Query Frame = 2
Query:  386 GCGFGISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNKSYGNPLVLFEDVYDSMNPILKKQMEKFSKFLALNREHYP 841
            G G+GI +++VDGND  AVY ATK AR  ++ +NQP LIEAMTYR+G+H+T +    YR +DEV YW+  D+P+ R + +L+++  W +E+ K + K+ R K+    E+A+ K   NP +LF DVY  M   L++Q E  ++ L    EHYP
Sbjct:  284 GPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRQYLLNQGWWDEEQEKAWRKQSRKKVMEAFEQAERKLKPNPSLLFSDVYQEMPAQLRRQQESLARHLQTYGEHYP 435          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. TrEMBL
Match: A0A5P8I4K8 (BCKHDA-like protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 341.658 bits (875), Expect = 3.591e-161
Identity = 161/161 (100.00%), Postives = 161/161 (100.00%), Query Frame = 2
Query:  386 GCGFGISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNKSYGNPLVLFEDVYDSMNPILKKQMEKFSKFLALNREHYPGNFENPNPI 868
            GCGFGISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNKSYGNPLVLFEDVYDSMNPILKKQMEKFSKFLALNREHYPGNFENPNPI
Sbjct:  269 GCGFGISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNKSYGNPLVLFEDVYDSMNPILKKQMEKFSKFLALNREHYPGNFENPNPI 429          

HSP 2 Score: 256.914 bits (655), Expect = 3.591e-161
Identity = 120/120 (100.00%), Postives = 120/120 (100.00%), Query Frame = 3
Query:    3 LWRGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDEQYHGDGL 362
            LWRGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDEQYHGDGL
Sbjct:  146 LWRGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDEQYHGDGL 265          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. TrEMBL
Match: A0A2T7NW70 (2-oxoisovalerate dehydrogenase subunit alpha OS=Pomacea canaliculata OX=400727 GN=C0Q70_13063 PE=3 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 1.027e-77
Identity = 73/120 (60.83%), Postives = 96/120 (80.00%), Query Frame = 3
Query:    3 LWRGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDEQYHGDGL 362
            +WRG+ ++  +NQ + N++D+ +G+QMP+HY ++D+NF +ISSPL TQMPQA G +Y  K+Q+K    IC+FGEG AS GDA  ALNFAA L+CPIIFFCRNNGYAISTPT +QY GDG+
Sbjct:  160 MWRGYTLDQFMNQCYGNQNDLGKGRQMPVHYGSRDLNFVTISSPLATQMPQASGAAYALKLQQKGLVAICFFGEGAASEGDAHAALNFAAVLDCPIIFFCRNNGYAISTPTKDQYRGDGI 279          

HSP 2 Score: 147.132 bits (370), Expect = 1.027e-77
Identity = 66/152 (43.42%), Postives = 98/152 (64.47%), Query Frame = 2
Query:  386 GCGFGISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNKSYGNPLVLFEDVYDSMNPILKKQMEKFSKFLALNREHYP 841
            G G+GI T++VDGND  AVY ATK AR+  + QN+PVLIEAMTYR+G+H+T +    YR +DEV YW+  DNP+ R + F++ +K W+ +  + +  E R  +      A+ +   +P  +F DVY  M+P LK+QM+   K +  ++EHYP
Sbjct:  283 GRGYGIPTVRVDGNDVFAVYNATKAARDICLTQNRPVLIEAMTYRIGHHSTSDDSSAYRSVDEVSYWDQQDNPITRLRHFMVLQKWWNDDAEQNWKMESRKMVMKAFAEAEGRKKPSPDSMFHDVYTDMHPSLKEQMQAMKKHVTEHKEHYP 434          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. TrEMBL
Match: A0A3Q2Z4F8 (2-oxoisovalerate dehydrogenase subunit alpha OS=Hippocampus comes OX=109280 PE=3 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 2.301e-77
Identity = 73/120 (60.83%), Postives = 95/120 (79.17%), Query Frame = 3
Query:    3 LWRGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDEQYHGDGL 362
            ++RGF ++  + Q +AN DD+ +G+QMP+HY ++D+NF +ISSPL TQ+PQAVG +Y  K +   + VICYFGEG AS GDA    NF+ATLECP+IFFCRNNGYAISTPT+EQY GDG+
Sbjct:  103 MYRGFSLDSFMAQCYANADDLGKGRQMPVHYGSRDLNFVTISSPLATQIPQAVGAAYAIKRENINRAVICYFGEGAASEGDAHAGFNFSATLECPLIFFCRNNGYAISTPTNEQYRGDGI 222          

HSP 2 Score: 146.747 bits (369), Expect = 2.301e-77
Identity = 65/152 (42.76%), Postives = 98/152 (64.47%), Query Frame = 2
Query:  386 GCGFGISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNKSYGNPLVLFEDVYDSMNPILKKQMEKFSKFLALNREHYP 841
            G G+G+ +++VDGND  AVY ATK AR  ++ +NQP LIEAMTYR+G+H+T +    YR +DEV YW+  D+P+ R + ++  R  WS++  + + K+ R  +  + ERA+ +   NP +LF DVY+ M P L KQ E   + +   +EHYP
Sbjct:  226 GPGYGMLSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRHYMASRGWWSEDDERAWRKQSRQTVMEVFERAEKRLKPNPELLFTDVYEEMTPALTKQRESLFRHVQQYKEHYP 377          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. TrEMBL
Match: A0A3Q2Y9B4 (2-oxoisovalerate dehydrogenase subunit alpha OS=Hippocampus comes OX=109280 PE=3 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 2.759e-77
Identity = 73/120 (60.83%), Postives = 95/120 (79.17%), Query Frame = 3
Query:    3 LWRGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDEQYHGDGL 362
            ++RGF ++  + Q +AN DD+ +G+QMP+HY ++D+NF +ISSPL TQ+PQAVG +Y  K +   + VICYFGEG AS GDA    NF+ATLECP+IFFCRNNGYAISTPT+EQY GDG+
Sbjct:  169 MYRGFSLDSFMAQCYANADDLGKGRQMPVHYGSRDLNFVTISSPLATQIPQAVGAAYAIKRENINRAVICYFGEGAASEGDAHAGFNFSATLECPLIFFCRNNGYAISTPTNEQYRGDGI 288          

HSP 2 Score: 146.747 bits (369), Expect = 2.759e-77
Identity = 65/152 (42.76%), Postives = 98/152 (64.47%), Query Frame = 2
Query:  386 GCGFGISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNKSYGNPLVLFEDVYDSMNPILKKQMEKFSKFLALNREHYP 841
            G G+G+ +++VDGND  AVY ATK AR  ++ +NQP LIEAMTYR+G+H+T +    YR +DEV YW+  D+P+ R + ++  R  WS++  + + K+ R  +  + ERA+ +   NP +LF DVY+ M P L KQ E   + +   +EHYP
Sbjct:  292 GPGYGMLSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRHYMASRGWWSEDDERAWRKQSRQTVMEVFERAEKRLKPNPELLFTDVYEEMTPALTKQRESLFRHVQQYKEHYP 443          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. TrEMBL
Match: A0A1D1VN44 (2-oxoisovalerate dehydrogenase subunit alpha OS=Ramazzottius varieornatus OX=947166 GN=RvY_13520-1 PE=3 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 4.142e-77
Identity = 72/120 (60.00%), Postives = 95/120 (79.17%), Query Frame = 3
Query:    3 LWRGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDEQYHGDGL 362
            +WRGF ++  +NQ + N++D+ +GKQMP+HY +K++ F ++SSPL TQMPQAVG +Y  K  +  Q VICYFG+G AS GDA  A NF+ATL+CPIIFFCRNNGYAISTPT +Q+ GDG+
Sbjct:  194 MWRGFTLDQFMNQCYGNEEDLGKGKQMPVHYGSKELAFVTVSSPLATQMPQAVGSAYAYKRAQNGQIVICYFGDGAASEGDAHAAFNFSATLDCPIIFFCRNNGYAISTPTSQQFRGDGI 313          

HSP 2 Score: 148.673 bits (374), Expect = 4.142e-77
Identity = 67/152 (44.08%), Postives = 102/152 (67.11%), Query Frame = 2
Query:  386 GCGFGISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNKSYGNPLVLFEDVYDSMNPILKKQMEKFSKFLALNREHYP 841
            G G+GI T++VDGND LA+Y  TK AR+ S++QN+PVLIEAMTYR+G+H+T +    YR +DEVK+W+  DNP+ RF+ ++  +  W+ EK   +  + + ++    +RA++K   +P  LF DVYD +   L+KQ ++   F+  N EHYP
Sbjct:  317 GPGYGIPTIRVDGNDTLAIYNVTKAARDISLQQNRPVLIEAMTYRIGHHSTSDDSSAYRSVDEVKHWDKEDNPIARFRRYITQKGYWNDEKETQWKDQAKKQVMQAFQRAEHKKKPSPEELFNDVYDELPWHLQKQRKEMMDFVRSNPEHYP 468          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Cavefish
Match: bckdha (branched chain keto acid dehydrogenase E1 subunit alpha [Source:NCBI gene;Acc:103041479])

HSP 1 Score: 168.703 bits (426), Expect = 6.282e-78
Identity = 73/120 (60.83%), Postives = 93/120 (77.50%), Query Frame = 3
Query:    3 LWRGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDEQYHGDGL 362
            ++RGF ++  + Q +AN DD+ +G+QMP+HY  KD+NF +ISSPL TQ+PQA G +Y  K +   + VICYFGEG AS GDA    NF+ATLECP+IFFCRNNGYAISTPT+EQY GDG+
Sbjct:   95 MYRGFPLDLFMAQCYANADDLGKGRQMPVHYGCKDLNFVTISSPLATQIPQAAGAAYAVKRENANRAVICYFGEGAASEGDAHAGFNFSATLECPLIFFCRNNGYAISTPTNEQYRGDGI 214          

HSP 2 Score: 141.739 bits (356), Expect = 6.282e-78
Identity = 63/152 (41.45%), Postives = 98/152 (64.47%), Query Frame = 2
Query:  386 GCGFGISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNKSYGNPLVLFEDVYDSMNPILKKQMEKFSKFLALNREHYP 841
            G G+G+ +++VDGND  AVY ATK AR  ++ +NQP LIEAMTYR+G+H+T +    YR +DEV YW+  D+P+ R + ++  R  W +++ + + K+ R  +    ERA+ +   +P ++F DVYD M P L+KQ E   + +   +EHYP
Sbjct:  218 GPGYGMLSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRHYMTARDWWGEDEERAWRKQSRKLVMEAFERAERRLKPHPDLMFTDVYDQMTPGLEKQKEAMWRHVQQYKEHYP 369          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Cavefish
Match: bckdha (branched chain keto acid dehydrogenase E1 subunit alpha [Source:NCBI gene;Acc:103041479])

HSP 1 Score: 168.318 bits (425), Expect = 9.662e-78
Identity = 73/120 (60.83%), Postives = 93/120 (77.50%), Query Frame = 3
Query:    3 LWRGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDEQYHGDGL 362
            ++RGF ++  + Q +AN DD+ +G+QMP+HY  KD+NF +ISSPL TQ+PQA G +Y  K +   + VICYFGEG AS GDA    NF+ATLECP+IFFCRNNGYAISTPT+EQY GDG+
Sbjct:  166 MYRGFPLDLFMAQCYANADDLGKGRQMPVHYGCKDLNFVTISSPLATQIPQAAGAAYAVKRENANRAVICYFGEGAASEGDAHAGFNFSATLECPLIFFCRNNGYAISTPTNEQYRGDGI 285          

HSP 2 Score: 141.739 bits (356), Expect = 9.662e-78
Identity = 63/152 (41.45%), Postives = 98/152 (64.47%), Query Frame = 2
Query:  386 GCGFGISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNKSYGNPLVLFEDVYDSMNPILKKQMEKFSKFLALNREHYP 841
            G G+G+ +++VDGND  AVY ATK AR  ++ +NQP LIEAMTYR+G+H+T +    YR +DEV YW+  D+P+ R + ++  R  W +++ + + K+ R  +    ERA+ +   +P ++F DVYD M P L+KQ E   + +   +EHYP
Sbjct:  289 GPGYGMLSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRHYMTARDWWGEDEERAWRKQSRKLVMEAFERAERRLKPHPDLMFTDVYDQMTPGLEKQKEAMWRHVQQYKEHYP 440          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Cavefish
Match: pdha1a (pyruvate dehydrogenase E1 component subunit alpha, mitochondrial-like [Source:NCBI gene;Acc:103026590])

HSP 1 Score: 66.2402 bits (160), Expect = 1.876e-21
Identity = 34/112 (30.36%), Postives = 56/112 (50.00%), Query Frame = 3
Query:    3 LWRGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTD 338
            L RG  + +++ +L   +  I +GK   +H   K  NF+  +  +G Q+P   G +   K Q K +  +C +G+G A+ G  F   N A+  + P IF C NN Y + T  +
Sbjct:  135 LTRGGTVREIMAELTGRRGGIAKGKGGSMHMYTK--NFYGGNGIVGAQVPLGAGVALACKYQGKNELCVCLYGDGAANQGQIFETYNMASLWKLPCIFICENNKYGMGTSVE 244          

HSP 2 Score: 55.0694 bits (131), Expect = 1.876e-21
Identity = 31/98 (31.63%), Postives = 50/98 (51.02%), Query Frame = 2
Query:  401 ISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKI 694
            I  L+VDG D L V  ATK A E       P+L+E  TYR   H+  + G++YR  +E++      +P+   +  +++  + S E+ K    E R +I
Sbjct:  259 IPGLRVDGMDVLCVREATKFAAEHCRSGKGPILMELQTYRYHGHSMSDPGVSYRTREEIQEVRSKSDPISMLKDRMLNNNMASVEELKEIDVEVRKEI 356          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Cavefish
Match: pdha1a (pyruvate dehydrogenase E1 component subunit alpha, mitochondrial-like [Source:NCBI gene;Acc:103026590])

HSP 1 Score: 66.2402 bits (160), Expect = 2.122e-21
Identity = 34/113 (30.09%), Postives = 56/113 (49.56%), Query Frame = 3
Query:    3 LWRGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDE 341
            L RG  + +++ +L   +  I +GK   +H   K  NF+  +  +G Q+P   G +   K Q K +  +C +G+G A+ G  F   N A+  + P IF C NN Y + T  + 
Sbjct:  128 LTRGGTVREIMAELTGRRGGIAKGKGGSMHMYTK--NFYGGNGIVGAQVPLGAGVALACKYQGKNELCVCLYGDGAANQGQIFETYNMASLWKLPCIFICENNKYGMGTSVER 238          

HSP 2 Score: 55.0694 bits (131), Expect = 2.122e-21
Identity = 31/98 (31.63%), Postives = 50/98 (51.02%), Query Frame = 2
Query:  401 ISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKI 694
            I  L+VDG D L V  ATK A E       P+L+E  TYR   H+  + G++YR  +E++      +P+   +  +++  + S E+ K    E R +I
Sbjct:  252 IPGLRVDGMDVLCVREATKFAAEHCRSGKGPILMELQTYRYHGHSMSDPGVSYRTREEIQEVRSKSDPISMLKDRMLNNNMASVEELKEIDVEVRKEI 349          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Cavefish
Match: pdha1b (pyruvate dehydrogenase E1 alpha 1 subunit b [Source:ZFIN;Acc:ZDB-GENE-040718-96])

HSP 1 Score: 48.9062 bits (115), Expect = 3.676e-13
Identity = 30/111 (27.03%), Postives = 55/111 (49.55%), Query Frame = 3
Query:    9 RGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDE 341
            RG  ++++L +L   K  + +GK   +H   K  +F+  +  +G Q+P   G +   + +   +  +  +G+G A+ G  F A N A+  + P IF C NN Y + T  + 
Sbjct:  112 RGVSVKEILAELTGRKGGVAKGKGGSMHMYAK--HFYGGNGIVGAQVPLGAGVALACQYKGNNEVCVTLYGDGAANQGQIFEAFNMASLWKLPCIFICENNKYGMGTSVER 220          

HSP 2 Score: 44.2838 bits (103), Expect = 3.676e-13
Identity = 29/98 (29.59%), Postives = 47/98 (47.96%), Query Frame = 2
Query:  401 ISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKI 694
            I  L+VDG D L V  ATK A ++      P+L+E  TYR   H+  + G+      E++      +P+   +  +I+  + S E+ K    E R +I
Sbjct:  234 IPGLRVDGMDVLCVREATKFAADYCRSGKGPILMELQTYRYHGHSMSDPGLPNTV--EIQEVRSKSDPISMLKDRMINNNMASLEEIKEIDAEVRKEI 329          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Sea Lamprey
Match: bckdha (branched chain keto acid dehydrogenase E1 subunit alpha [Source:ZFIN;Acc:ZDB-GENE-050522-376])

HSP 1 Score: 159.458 bits (402), Expect = 1.221e-74
Identity = 72/125 (57.60%), Postives = 91/125 (72.80%), Query Frame = 3
Query:    3 LWRGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQA-----VGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDEQYHGDGL 362
            +WR F ++  ++Q + N DD  +G+QMP+HY + ++NF +ISSPL TQ+PQA     VG +Y  K     + VICYFGEG AS GDA    NF+ATLECP+IFFCRNNGYAISTPTDEQY GDG+
Sbjct:  119 MWRDFPLDMFMSQCYGNVDDPGKGRQMPVHYGSNELNFVTISSPLATQIPQARTHAAVGAAYAYKRANNDRVVICYFGEGAASEGDAHAGFNFSATLECPVIFFCRNNGYAISTPTDEQYRGDGI 243          

HSP 2 Score: 137.887 bits (346), Expect = 1.221e-74
Identity = 60/152 (39.47%), Postives = 97/152 (63.82%), Query Frame = 2
Query:  386 GCGFGISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNKSYGNPLVLFEDVYDSMNPILKKQMEKFSKFLALNREHYP 841
            G G+GI +++VDGND  AVY AT+ AR  ++ +NQP LIEAMTYR+G+H+T +    YR +DEV YW+  D+P+ R + +++   +W+    K + K+ R  +    E+A+ +   +P  LF DVY  M P +++QM++  + + +  EHYP
Sbjct:  247 GPGYGILSIRVDGNDVFAVYNATREARRRAVSENQPTLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRNYMLRESMWNDSLEKDWRKQSRKLVLEAFEKAEKRLKPSPSELFHDVYKEMTPHIQRQMDEMRRHVKIYAEHYP 398          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Yeast
Match: PDA1 (E1 alpha subunit of the pyruvate dehydrogenase (PDH) complex; catalyzes the direct oxidative decarboxylation of pyruvate to acetyl-CoA; phosphorylated; regulated by glucose; PDH complex is concentrated in spots within the mitochondrial matrix, often near the ERMES complex and near peroxisomes [Source:SGD;Acc:S000000980])

HSP 1 Score: 76.6406 bits (187), Expect = 7.996e-24
Identity = 43/136 (31.62%), Postives = 74/136 (54.41%), Query Frame = 2
Query:  401 ISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNK--SYGNPLVLFEDVY--DSMNPILKKQM 796
            I  LKV+G D LAVY A+K A+++ +    P+++E  TYR G H+  + G TYR  DE+++    ++P+   +  LID  + ++ + K + K  R  ++  +E A           +LFEDVY   +  P L+ ++
Sbjct:  269 IPGLKVNGMDILAVYQASKFAKDWCLSGKGPLVLEYETYRYGGHSMSDPGTTYRTRDEIQHMRSKNDPIAGLKMHLIDLGIATEAEVKAYDKSARKYVDEQVELADAAPPPEAKLSILFEDVYVKGTETPTLRGRI 404          

HSP 2 Score: 50.0618 bits (118), Expect = 7.996e-24
Identity = 25/107 (23.36%), Postives = 51/107 (47.66%), Query Frame = 3
Query:    9 RGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAIST 329
            RG  ++ +L +L   +  ++ GK   +H       F+  +  +G Q+P   G ++ ++ + +       +G+G ++ G  F + N A     P++F C NN Y + T
Sbjct:  147 RGASVKAVLAELMGRRAGVSYGKGGSMHLYAP--GFYGGNGIVGAQVPLGAGLAFAHQYKNEDACSFTLYGDGASNQGQVFESFNMAKLWNLPVVFCCENNKYGMGT 251          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Nematostella
Match: EDO43057 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZV6])

HSP 1 Score: 166.392 bits (420), Expect = 1.262e-68
Identity = 74/120 (61.67%), Postives = 92/120 (76.67%), Query Frame = 3
Query:    3 LWRGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDEQYHGDGL 362
            +WRGF + D +NQ +AN+ D  +G+QMP+HY +K++NF +ISS L TQMPQA G +Y  K Q K   V+CYFG+G AS GDA  A NFAATL+ P+IFFCRNNGYAISTPT EQY GDG+
Sbjct:  163 MWRGFTLADFMNQCYANQHDAGKGRQMPVHYGSKELNFVTISSTLATQMPQASGAAYALKRQGKGNCVMCYFGDGAASEGDAHSAFNFAATLDAPVIFFCRNNGYAISTPTREQYRGDGI 282          

HSP 2 Score: 111.694 bits (278), Expect = 1.262e-68
Identity = 56/153 (36.60%), Postives = 92/153 (60.13%), Query Frame = 2
Query:  386 GCGFGISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNKSYGNPLV-LFEDVYDSMNPILKKQMEKFSKFLALNREHYP 841
            G  +G+  ++VDGND  AVY  TK ARE ++ +N+PVL+EAMTYR+G+H+T +    YR + EV YW+  D+P+ R + ++ D+  W +++ + + KE R ++      A+ K+   P+  LF DVY    P L++Q ++    +A     YP
Sbjct:  286 GRSYGMLAIRVDGNDIFAVYNVTKKAREIAVNENRPVLVEAMTYRIGHHSTSDDSSVYRSLKEVNYWDKEDHPISRLRYYMEDKGWWDQDQEQQWKKEARLQVMQAFADAE-KALKPPVKELFLDVYKEFTPHLQEQYKECVDHVAKYPHEYP 437          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Nematostella
Match: EDO33561 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRY1])

HSP 1 Score: 61.2326 bits (147), Expect = 1.205e-20
Identity = 34/107 (31.78%), Postives = 57/107 (53.27%), Query Frame = 2
Query:  401 ISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQN 721
            I  ++VDG D L V  ATK A +++     P+L+E  TYR   H+  + G +YR  DE++      +P+   +  L+D  L S +  K   +E + +I+  +E A+N
Sbjct:  252 IPGIRVDGMDVLTVREATKWAVDYARSGKGPILMELKTYRYYGHSMSDPGTSYRSRDEIQSVRKTRDPITGLREKLLDSGLASTDDIKKIEQEAKAEIDEAVECAKN 358          

HSP 2 Score: 55.8398 bits (133), Expect = 1.205e-20
Identity = 29/111 (26.13%), Postives = 51/111 (45.95%), Query Frame = 3
Query:    9 RGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDE 341
            RG    ++L +L   K    +GK   +H    +  ++  +  +G Q+P   G +  +K++   +  +  +G+G A+ G  F   N A     P IF C NNGY + T  + 
Sbjct:  130 RGRSAREVLCELTGRKTGCTQGKGGSMHMYGHE--YYGGNGIVGAQVPLGAGIALAHKLRGNGRICLTLYGDGAANQGQLFETYNMAKLWNLPCIFICENNGYGMGTSVER 238          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Medaka
Match: bckdha (branched chain keto acid dehydrogenase E1 subunit alpha [Source:NCBI gene;Acc:101166649])

HSP 1 Score: 167.548 bits (423), Expect = 2.515e-77
Identity = 73/120 (60.83%), Postives = 93/120 (77.50%), Query Frame = 3
Query:    3 LWRGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDEQYHGDGL 362
            ++RGF ++  + Q +AN DD+ +G+QMP+HY  KD+NF +ISSPL TQ+PQA G +Y  K +   + VICYFGEG AS GDA    NF+ATLECP+IFFCRNNGYAISTPT+EQY GDG+
Sbjct:  169 MYRGFPLDLFMAQCYANADDLGKGRQMPVHYGCKDLNFVTISSPLATQIPQAAGAAYALKRENLNRAVICYFGEGAASEGDAHAGFNFSATLECPLIFFCRNNGYAISTPTNEQYRGDGI 288          

HSP 2 Score: 140.969 bits (354), Expect = 2.515e-77
Identity = 63/152 (41.45%), Postives = 96/152 (63.16%), Query Frame = 2
Query:  386 GCGFGISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNKSYGNPLVLFEDVYDSMNPILKKQMEKFSKFLALNREHYP 841
            G G+G+ +++VDGND  AVY ATK AR  ++ +NQP LIEAMTYR+G+H+T +    YR +DEV YW+  D+P+ R + ++  R  WS++  + + K+ R  +    ERA+ +   NP +LF DVY  M P L +Q +   + +   +EHYP
Sbjct:  292 GPGYGMLSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRHYMTARGWWSEDDERSWRKQSRKTVMEAFERAERRLKPNPELLFTDVYQEMTPGLSRQRDSMWRHVQQYKEHYP 443          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Medaka
Match: pdha1a (pyruvate dehydrogenase E1 component subunit alpha, mitochondrial [Source:NCBI gene;Acc:101165911])

HSP 1 Score: 62.3882 bits (150), Expect = 5.209e-21
Identity = 32/111 (28.83%), Postives = 55/111 (49.55%), Query Frame = 3
Query:    9 RGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDE 341
            RG  ++ ++ +L   +  I +GK   +H   K  NF+  +  +G Q+P   G +   K Q   +  +C +G+G A+ G  F   N A+  + P+IF C NN Y + T  + 
Sbjct:  123 RGGTVKKIMAELTGRRGGIAKGKGGSMHMYCK--NFYGGNGIVGAQVPLGAGVALACKYQGNNELCVCLYGDGAANQGQIFETYNMASLWKLPVIFICENNRYGMGTSVER 231          

HSP 2 Score: 57.3806 bits (137), Expect = 5.209e-21
Identity = 32/98 (32.65%), Postives = 50/98 (51.02%), Query Frame = 2
Query:  401 ISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKI 694
            I  L+VDG D L V  AT+ A E       P+L+E  TYR   H+  + GI+YR  +E++      +P+   +  L+   + S E+ K+   E R +I
Sbjct:  245 IPGLRVDGMDVLCVREATRFAAEHCRSGKGPILMELQTYRYHGHSMSDPGISYRTREEIQEVRSKSDPISLLKDRLLSNNMASVEELKVIDVEVRKEI 342          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Medaka
Match: pdha1a (pyruvate dehydrogenase E1 component subunit alpha, mitochondrial [Source:NCBI gene;Acc:101165911])

HSP 1 Score: 62.3882 bits (150), Expect = 6.555e-21
Identity = 32/111 (28.83%), Postives = 55/111 (49.55%), Query Frame = 3
Query:    9 RGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDE 341
            RG  ++ ++ +L   +  I +GK   +H   K  NF+  +  +G Q+P   G +   K Q   +  +C +G+G A+ G  F   N A+  + P+IF C NN Y + T  + 
Sbjct:  127 RGGTVKKIMAELTGRRGGIAKGKGGSMHMYCK--NFYGGNGIVGAQVPLGAGVALACKYQGNNELCVCLYGDGAANQGQIFETYNMASLWKLPVIFICENNRYGMGTSVER 235          

HSP 2 Score: 57.3806 bits (137), Expect = 6.555e-21
Identity = 32/98 (32.65%), Postives = 50/98 (51.02%), Query Frame = 2
Query:  401 ISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKI 694
            I  L+VDG D L V  AT+ A E       P+L+E  TYR   H+  + GI+YR  +E++      +P+   +  L+   + S E+ K+   E R +I
Sbjct:  249 IPGLRVDGMDVLCVREATRFAAEHCRSGKGPILMELQTYRYHGHSMSDPGISYRTREEIQEVRSKSDPISLLKDRLLSNNMASVEELKVIDVEVRKEI 346          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Medaka
Match: ENSORLT00000041277.1 (pyruvate dehydrogenase E1 component subunit alpha, mitochondrial [Source:NCBI gene;Acc:101174054])

HSP 1 Score: 50.0618 bits (118), Expect = 1.258e-14
Identity = 26/88 (29.55%), Postives = 45/88 (51.14%), Query Frame = 2
Query:  401 ISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNK 664
            I  L+VDG D L V  AT+ A E       P+++E  TYR   H+  + G++YR  +E++      +P+   +  ++   + S E+ K
Sbjct:  252 IPGLRVDGMDVLCVREATRFAAEHCRAGKGPIVMELQTYRYHGHSMSDPGVSYRTREEIQEVRSKSDPISMLKERMLANNMASAEEFK 339          

HSP 2 Score: 48.1358 bits (113), Expect = 1.258e-14
Identity = 31/110 (28.18%), Postives = 52/110 (47.27%), Query Frame = 3
Query:    9 RGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTD 338
            RG  ++++L +L   K  + +GK   +H      +F+  +  +G Q+P   G +     Q   Q  +  +G+G A+ G  F   N AA  + P IF C NN Y + T  +
Sbjct:  130 RGVSVKEILAELTGRKGGVAKGKGGSMHMYAP--HFYGGNGIVGAQVPVGAGIALACSYQGNNQLCVTLYGDGAANQGQIFETFNMAALWKLPCIFICENNKYGMGTAVE 237          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Medaka
Match: ENSORLT00000029291.1 (pyruvate dehydrogenase E1 component subunit alpha, mitochondrial [Source:NCBI gene;Acc:101174054])

HSP 1 Score: 50.0618 bits (118), Expect = 1.267e-14
Identity = 26/88 (29.55%), Postives = 45/88 (51.14%), Query Frame = 2
Query:  401 ISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNK 664
            I  L+VDG D L V  AT+ A E       P+++E  TYR   H+  + G++YR  +E++      +P+   +  ++   + S E+ K
Sbjct:  259 IPGLRVDGMDVLCVREATRFAAEHCRAGKGPIVMELQTYRYHGHSMSDPGVSYRTREEIQEVRSKSDPISMLKERMLANNMASAEEFK 346          

HSP 2 Score: 48.1358 bits (113), Expect = 1.267e-14
Identity = 31/110 (28.18%), Postives = 52/110 (47.27%), Query Frame = 3
Query:    9 RGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTD 338
            RG  ++++L +L   K  + +GK   +H      +F+  +  +G Q+P   G +     Q   Q  +  +G+G A+ G  F   N AA  + P IF C NN Y + T  +
Sbjct:  137 RGVSVKEILAELTGRKGGVAKGKGGSMHMYAP--HFYGGNGIVGAQVPVGAGIALACSYQGNNQLCVTLYGDGAANQGQIFETFNMAALWKLPCIFICENNKYGMGTAVE 244          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Planmine SMEST
Match: SMESG000021412.1 (SMESG000021412.1)

HSP 1 Score: 339.732 bits (870), Expect = 7.598e-164
Identity = 160/161 (99.38%), Postives = 160/161 (99.38%), Query Frame = 2
Query:  386 GCGFGISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNKSYGNPLVLFEDVYDSMNPILKKQMEKFSKFLALNREHYPGNFENPNPI 868
            GCGFGISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGI YRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNKSYGNPLVLFEDVYDSMNPILKKQMEKFSKFLALNREHYPGNFENPNPI
Sbjct:  269 GCGFGISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGIAYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNKSYGNPLVLFEDVYDSMNPILKKQMEKFSKFLALNREHYPGNFENPNPI 429          

HSP 2 Score: 256.914 bits (655), Expect = 7.598e-164
Identity = 120/120 (100.00%), Postives = 120/120 (100.00%), Query Frame = 3
Query:    3 LWRGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDEQYHGDGL 362
            LWRGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDEQYHGDGL
Sbjct:  146 LWRGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDEQYHGDGL 265          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Planmine SMEST
Match: SMESG000021409.1 (SMESG000021409.1)

HSP 1 Score: 174.096 bits (440), Expect = 1.002e-87
Identity = 79/120 (65.83%), Postives = 95/120 (79.17%), Query Frame = 3
Query:    3 LWRGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDEQYHGDGL 362
            LWRGF +E+MLNQ + NK D N+GKQMPIHY+NK +N+FSISS LGTQMP AVG +Y  K  +  + VICYFG+G +SVGDA  ALNF+ATL+CP+I  CRNN YAISTP  EQY GDG+
Sbjct:  144 LWRGFTLEEMLNQCYGNKYDSNKGKQMPIHYANKKLNYFSISSVLGTQMPHAVGAAYAFKRAQNGKCVICYFGDGASSVGDAHAALNFSATLDCPVIMLCRNNLYAISTPVHEQYRGDGI 263          

HSP 2 Score: 169.088 bits (427), Expect = 1.002e-87
Identity = 76/161 (47.20%), Postives = 113/161 (70.19%), Query Frame = 2
Query:  386 GCGFGISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNKSYGNPLVLFEDVYDSMNPILKKQMEKFSKFLALNREHYPGNFENPNPI 868
            G G+GI+T++VDGND +AVY ATK ARE  + +N+PVLIEAMTYR+G+H+T +  + YR +DEV +W+ +DNP+LRF+ +L  +  WS ++ + +  E R  +   IE+A+  +  NPL+LFEDVYD M   ++ QM K   FL  N+EHYP ++++P  I
Sbjct:  267 GIGYGIATIRVDGNDLIAVYNATKAARELCVNENRPVLIEAMTYRIGSHSTSDDSLAYRSVDEVTWWDKHDNPILRFKFYLKQKNWWSDKEEEAWRNESRKLVVQAIEKAEKTNLPNPLILFEDVYDEMPTRIRSQMNKHYTFLKRNKEHYPISYDSPEKI 427          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Planmine SMEST
Match: SMESG000021408.1 (SMESG000021408.1)

HSP 1 Score: 169.088 bits (427), Expect = 8.030e-82
Identity = 74/120 (61.67%), Postives = 93/120 (77.50%), Query Frame = 3
Query:    3 LWRGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAISTPTDEQYHGDGL 362
            LWRG+ +E MLNQ + NK+D  +G+QMP+HY+NKD N FSISSPLGTQ+  A G +Y  K  +     +CYFG+G AS GDA  A+NF++TL+CP+IFFCRNNGYAISTPT EQY GDG+
Sbjct:  142 LWRGYTIEGMLNQCYGNKNDFGKGRQMPVHYTNKDANIFSISSPLGTQLLHAAGAAYAFKRNQNGLCTVCYFGDGAASEGDAHAAMNFSSTLDCPMIFFCRNNGYAISTPTSEQYRGDGI 261          

HSP 2 Score: 154.066 bits (388), Expect = 8.030e-82
Identity = 70/161 (43.48%), Postives = 105/161 (65.22%), Query Frame = 2
Query:  386 GCGFGISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNKSYGNPLVLFEDVYDSMNPILKKQMEKFSKFLALNREHYPGNFENPNPI 868
              G+G++ ++VDGND  AVY ATK AR   + +N+PVLIEAMTYRVG+H+T +  + YR +DE+ +W+ +DNP+ R + +L+++  WS+ + KI+  E R  +   IE+ +     NP+ LFEDVYD M   L KQM K   F+  N++ +P  +E P PI
Sbjct:  265 ASGYGMACIRVDGNDIFAVYNATKAARNLCVNENRPVLIEAMTYRVGSHSTSDDSLAYRSVDEISWWDKHDNPISRLKHYLLNQGWWSEGEEKIWRDEARKLVVKAIEKTEKVPLPNPMELFEDVYDKMPQRLYKQMSKQYSFMVKNKDLFPTAYETPKPI 425          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Planmine SMEST
Match: SMESG000073271.1 (SMESG000073271.1)

HSP 1 Score: 62.003 bits (149), Expect = 1.861e-21
Identity = 35/129 (27.13%), Postives = 62/129 (48.06%), Query Frame = 2
Query:  401 ISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNKSYGNPLVLFEDVYDSMNPILK 787
            I  + VDG D L V  A +   ++  +   P+++E  TYR   H+  + G +YR  +EV+      +P+  F   L    L   E +K   KE +D++N  +E  ++    NP+  +  VY   N +++
Sbjct:  176 IPGIWVDGMDVLTVREALRFCTKWCRDGFGPIIVEMETYRYSGHSMSDPGTSYRTREEVQAVRKEKDPITLFTKALQSANLLDDETSKKIEKEVKDEVNAAMELCKSDPEPNPIEAYTHVYSDSNVLIR 304          

HSP 2 Score: 58.9214 bits (141), Expect = 1.861e-21
Identity = 31/107 (28.97%), Postives = 51/107 (47.66%), Query Frame = 3
Query:    9 RGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAIST 329
            RG  +  ++ +L   K  ++ GK   +H   K  N++  +  +G Q+P   G +  +K +K     I  +G+G A+ G  F A N A     P IF C NN + + T
Sbjct:   54 RGASIHSIIAELMGKKTGVSEGKGGSMHMYGK--NYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGT 158          
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Planmine SMEST
Match: SMESG000073271.1 (SMESG000073271.1)

HSP 1 Score: 62.003 bits (149), Expect = 2.087e-21
Identity = 35/129 (27.13%), Postives = 62/129 (48.06%), Query Frame = 2
Query:  401 ISTLKVDGNDPLAVYLATKTAREFSIEQNQPVLIEAMTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEKNKIFHKECRDKINFLIERAQNKSYGNPLVLFEDVYDSMNPILK 787
            I  + VDG D L V  A +   ++  +   P+++E  TYR   H+  + G +YR  +EV+      +P+  F   L    L   E +K   KE +D++N  +E  ++    NP+  +  VY   N +++
Sbjct:  182 IPGIWVDGMDVLTVREALRFCTKWCRDGFGPIIVEMETYRYSGHSMSDPGTSYRTREEVQAVRKEKDPITLFTKALQSANLLDDETSKKIEKEVKDEVNAAMELCKSDPEPNPIEAYTHVYSDSNVLIR 310          

HSP 2 Score: 58.9214 bits (141), Expect = 2.087e-21
Identity = 31/107 (28.97%), Postives = 51/107 (47.66%), Query Frame = 3
Query:    9 RGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMPQAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFCRNNGYAIST 329
            RG  +  ++ +L   K  ++ GK   +H   K  N++  +  +G Q+P   G +  +K +K     I  +G+G A+ G  F A N A     P IF C NN + + T
Sbjct:   60 RGASIHSIIAELMGKKTGVSEGKGGSMHMYGK--NYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGT 164          
The following BLAST results are available for this feature:
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BCKDHA6.558e-7559.17branched chain keto acid dehydrogenase E1 subunit ... [more]
AC011462.19.844e-7559.17novel protein[more]
BCKDHA1.595e-7059.17branched chain keto acid dehydrogenase E1 subunit ... [more]
BCKDHA5.381e-5759.17branched chain keto acid dehydrogenase E1 subunit ... [more]
PDHA25.848e-2033.33pyruvate dehydrogenase E1 alpha 2 subunit [Source:... [more]
back to top
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bckd-1A2.942e-7361.982-oxoisovalerate dehydrogenase subunit alpha, mito... [more]
bckd-1A3.118e-7361.982-oxoisovalerate dehydrogenase subunit alpha, mito... [more]
pdha-17.848e-2231.03Probable pyruvate dehydrogenase E1 component subun... [more]
pdha-17.848e-2231.03Probable pyruvate dehydrogenase E1 component subun... [more]
pdha-17.848e-2231.03Probable pyruvate dehydrogenase E1 component subun... [more]
back to top
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG81998.951e-6659.50gene:FBgn0037709 transcript:FBtr0082067[more]
CG70242.054e-1728.97gene:FBgn0029722 transcript:FBtr0070712[more]
Pdha2.105e-1528.35gene:FBgn0028325 transcript:FBtr0070710[more]
Pdha3.272e-1528.35gene:FBgn0028325 transcript:FBtr0070708[more]
Pdha3.272e-1528.35gene:FBgn0028325 transcript:FBtr0070709[more]
back to top
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bckdha1.736e-7760.83branched chain keto acid dehydrogenase E1 subunit ... [more]
bckdha1.736e-7760.83branched chain keto acid dehydrogenase E1 subunit ... [more]
pdha1a1.068e-2029.46pyruvate dehydrogenase E1 alpha 1 subunit a [Sourc... [more]
pdha1a1.150e-2029.20pyruvate dehydrogenase E1 alpha 1 subunit a [Sourc... [more]
pdha1a1.150e-2029.20pyruvate dehydrogenase E1 alpha 1 subunit a [Sourc... [more]
back to top
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
h6pd2.104e-7560.00hexose-6-phosphate dehydrogenase (glucose 1-dehydr... [more]
h6pd2.699e-7560.00hexose-6-phosphate dehydrogenase (glucose 1-dehydr... [more]
h6pd3.160e-7560.00hexose-6-phosphate dehydrogenase (glucose 1-dehydr... [more]
h6pd3.377e-7560.00hexose-6-phosphate dehydrogenase (glucose 1-dehydr... [more]
h6pd3.377e-7560.00hexose-6-phosphate dehydrogenase (glucose 1-dehydr... [more]
back to top
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Bckdha7.213e-7559.17branched chain ketoacid dehydrogenase E1, alpha po... [more]
Bckdha2.006e-2588.57branched chain ketoacid dehydrogenase E1, alpha po... [more]
Pdha12.498e-2029.73pyruvate dehydrogenase E1 alpha 1 [Source:MGI Symb... [more]
Pdha22.750e-1729.51pyruvate dehydrogenase E1 alpha 2 [Source:MGI Symb... [more]
back to top
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A5A6H9|ODBA_PANTR2.565e-7459.172-oxoisovalerate dehydrogenase subunit alpha, mito... [more]
sp|Q8HXY4|ODBA_MACFA2.587e-7459.172-oxoisovalerate dehydrogenase subunit alpha, mito... [more]
sp|P50136|ODBA_MOUSE2.674e-7459.172-oxoisovalerate dehydrogenase subunit alpha, mito... [more]
sp|P12694|ODBA_HUMAN2.811e-7459.172-oxoisovalerate dehydrogenase subunit alpha, mito... [more]
sp|P11960|ODBA_RAT3.430e-7460.002-oxoisovalerate dehydrogenase subunit alpha, mito... [more]
back to top
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5P8I4K83.591e-161100.00BCKHDA-like protein OS=Schmidtea mediterranea OX=7... [more]
A0A2T7NW701.027e-7760.832-oxoisovalerate dehydrogenase subunit alpha OS=Po... [more]
A0A3Q2Z4F82.301e-7760.832-oxoisovalerate dehydrogenase subunit alpha OS=Hi... [more]
A0A3Q2Y9B42.759e-7760.832-oxoisovalerate dehydrogenase subunit alpha OS=Hi... [more]
A0A1D1VN444.142e-7760.002-oxoisovalerate dehydrogenase subunit alpha OS=Ra... [more]
back to top
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bckdha6.282e-7860.83branched chain keto acid dehydrogenase E1 subunit ... [more]
bckdha9.662e-7860.83branched chain keto acid dehydrogenase E1 subunit ... [more]
pdha1a1.876e-2130.36pyruvate dehydrogenase E1 component subunit alpha,... [more]
pdha1a2.122e-2130.09pyruvate dehydrogenase E1 component subunit alpha,... [more]
pdha1b3.676e-1327.03pyruvate dehydrogenase E1 alpha 1 subunit b [Sourc... [more]
back to top
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
bckdha1.221e-7457.60branched chain keto acid dehydrogenase E1 subunit ... [more]
back to top
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PDA17.996e-2431.62E1 alpha subunit of the pyruvate dehydrogenase (PD... [more]
back to top
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO430571.262e-6861.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO335611.205e-2031.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bckdha2.515e-7760.83branched chain keto acid dehydrogenase E1 subunit ... [more]
pdha1a5.209e-2128.83pyruvate dehydrogenase E1 component subunit alpha,... [more]
pdha1a6.555e-2128.83pyruvate dehydrogenase E1 component subunit alpha,... [more]
ENSORLT00000041277.11.258e-1429.55pyruvate dehydrogenase E1 component subunit alpha,... [more]
ENSORLT00000029291.11.267e-1429.55pyruvate dehydrogenase E1 component subunit alpha,... [more]
back to top
BLAST of 2-oxoisovalerate dehydrogenase subunit alpha vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000021412.17.598e-16499.38SMESG000021412.1[more]
SMESG000021409.11.002e-8765.83SMESG000021409.1[more]
SMESG000021408.18.030e-8261.67SMESG000021408.1[more]
SMESG000073271.11.861e-2127.13SMESG000073271.1[more]
SMESG000073271.12.087e-2127.13SMESG000073271.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016422 ID=SMED30016422|Name=2-oxoisovalerate dehydrogenase subunit alpha|organism=Schmidtea mediterranea sexual|type=transcript|length=913bp
GTTTGTGGAGGGGTTTCGATATGGAAGATATGCTTAATCAATTGTTTGCT
AACAAAGATGATATAAATAGAGGAAAACAAATGCCAATTCATTATTCAAA
TAAAGATATCAATTTTTTCAGTATTAGTTCTCCACTTGGAACTCAAATGC
CTCAAGCTGTTGGATATTCATACATGAATAAAATACAGAAGAAAAAGCAA
GGAGTCATTTGCTACTTTGGAGAAGGAACGGCGTCGGTTGGTGACGCTTT
TGTAGCACTTAACTTTGCTGCTACGTTAGAATGCCCGATTATATTCTTTT
GTCGTAATAACGGATATGCCATATCTACACCGACCGATGAACAATATCAC
GGAGACGGATTAGATGATATTCTACAGCTGCTCGAGGTTGCGGATTTGGA
ATCTCGACTCTGAAGGTAGATGGCAATGACCCTCTAGCAGTATATTTAGC
GACGAAAACTGCTAGAGAATTTTCCATAGAACAAAACCAACCAGTCCTCA
TTGAAGCAATGACTTATCGAGTGGGAAACCACACTACGGATGAACACGGA
ATAACATATCGGTGTATGGATGAAGTAAAATACTGGGAATTAAACGATAA
TCCTTTGCTGAGATTTCAAACGTTTCTCATAGATCGAAAATTATGGTCCA
AGGAGAAAAATAAAATTTTCCACAAAGAATGCCGGGACAAAATAAATTTC
TTAATTGAAAGGGCACAGAATAAATCCTATGGAAATCCCCTTGTTTTGTT
TGAAGATGTTTACGATTCCATGAATCCAATTTTGAAAAAGCAAATGGAGA
AATTTAGTAAATTCCTTGCACTAAATCGAGAACATTATCCGGGAAATTTT
GAAAACCCAAATCCAATTTAAAAATTTGATTATTTATTTCATTTTTTACT
TATTAATTGTCAG
back to top

protein sequence of SMED30016422-orf-1

>SMED30016422-orf-1 ID=SMED30016422-orf-1|Name=SMED30016422-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=137bp
LWRGFDMEDMLNQLFANKDDINRGKQMPIHYSNKDINFFSISSPLGTQMP
QAVGYSYMNKIQKKKQGVICYFGEGTASVGDAFVALNFAATLECPIIFFC
RNNGYAISTPTDEQYHGDGLDDILQLLEVADLESRL*
back to top

protein sequence of SMED30016422-orf-2

>SMED30016422-orf-2 ID=SMED30016422-orf-2|Name=SMED30016422-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=121bp
MTYRVGNHTTDEHGITYRCMDEVKYWELNDNPLLRFQTFLIDRKLWSKEK
NKIFHKECRDKINFLIERAQNKSYGNPLVLFEDVYDSMNPILKKQMEKFS
KFLALNREHYPGNFENPNPI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003826alpha-ketoacid dehydrogenase activity
GO:00038633-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring) activity
GO:0016491oxidoreductase activity
GO:0016624oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor
Vocabulary: biological process
TermDefinition
GO:0009083branched-chain amino acid catabolic process
GO:0008152metabolic process
GO:0055114oxidation-reduction process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0002074pharynx tip
PLANA:0007561head margin
Vocabulary: INTERPRO
TermDefinition
IPR034616BCKDH_E1-a
IPR001017DH_E1
IPR029061THDP-binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001017Dehydrogenase, E1 componentPFAMPF00676E1_dhcoord: 1..119
e-value: 3.8E-30
score: 104.9
NoneNo IPR availableGENE3DG3DSA:3.40.50.970coord: 1..130
e-value: 3.1E-45
score: 156.6
NoneNo IPR availablePANTHERPTHR43380FAMILY NOT NAMEDcoord: 1..120
IPR0346162-oxoisovalerate dehydrogenase subunit alphaPANTHERPTHR43380:SF12-OXOISOVALERATE DEHYDROGENASE SUBUNIT ALPHA-RELATEDcoord: 1..120
IPR029061Thiamin diphosphate-binding foldSUPERFAMILYSSF52518Thiamin diphosphate-binding fold (THDP-binding)coord: 1..123