Basement membrane-specific heparan sulfate proteoglycan core protein

Overview
NameBasement membrane-specific heparan sulfate proteoglycan core protein
Smed IDSMED30016420
Length (bp)2989
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Basement membrane-specific heparan sulfate proteoglycan core protein (SMED30016420) t-SNE clustered cells

Violin plots show distribution of expression levels for Basement membrane-specific heparan sulfate proteoglycan core protein (SMED30016420) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Basement membrane-specific heparan sulfate proteoglycan core protein (SMED30016420) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Basement membrane-specific heparan sulfate proteoglycan core protein (SMED30016420) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016420

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30016420SMESG000012063.1 SmedASXL_013722SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
parenchymal cellSMED30016420SMESG000012063.1 dd_Smed_v4_3527_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Human
Match: HSPG2 (heparan sulfate proteoglycan 2 [Source:HGNC Symbol;Acc:HGNC:5273])

HSP 1 Score: 114.775 bits (286), Expect = 5.104e-25
Identity = 76/219 (34.70%), Postives = 102/219 (46.58%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKD--IFLIHWKCDGENDCGNNFDESQC--NENDYKCGNIKFNC-SNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILRITNFQPGDDGIYNCETLSGPNRSF 2869
            C      C NG C P    CDG  +C D SDE    C    P    CE   N+ P  +    L  W+CDG+ DC +  DE+ C     +  CG  +F C S    IP ++ CD+ESDC +  DE GC+ PQV +     ++  R +  T   C + GVP P I WR NWG +    R+T+  T EG       L I + +  D G Y CE ++     F
Sbjct:  285 CGPQEAACRNGHCIPRDYLCDGQEDCEDGSDELD--CGPPPP----CE--PNEFPCGNGHCALKLWRCDGDFDCEDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPRESIQASRGQTVT-FTCVAIGVPTPIINWRLNWGHIPSHPRVTV--TSEGGR---GTLIIRDVKESDQGAYTCEAMNARGMVF 489          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Human
Match: SORL1 (sortilin related receptor 1 [Source:HGNC Symbol;Acc:HGNC:11185])

HSP 1 Score: 83.1889 bits (204), Expect = 2.105e-15
Identity = 53/146 (36.30%), Postives = 80/146 (54.79%), Query Frame = 2
Query: 2162 NLKVECHDGIRVKSAT-IFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLIN-KCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            +L  +C  G ++K+ T +  EN C +N  RC+NG C  S  +CD   +C D SDE       CD     +C+  G  +PL       +KCD E+DCG+N DES C    ++C + ++NCS+G  I  ++ CD ++DC +  DE  C
Sbjct: 1055 DLMCDCPQGYQLKNNTCVKQENTCLRNQYRCSNGNCINSIWWCDFDNDCGDMSDERNCPTTICDLDTQFRCQESGTCIPLS------YKCDLEDDCGDNSDESHCEM--HQCRSDEYNCSSGMCIRSSWVCDGDNDCRDWSDEANC 1192          

HSP 2 Score: 72.7886 bits (177), Expect = 3.553e-12
Identity = 48/131 (36.64%), Postives = 69/131 (52.67%), Query Frame = 2
Query: 2252 NNGECQPSGKFCDGVANCADRSDENPSV--CNKCDPLINK-CEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGN----IKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC----ILPQVT 2611
            N  +C      CDG+  C D SDE+ +   C++ DP  +K C+ +G +        + WKCDG +DCG+  DE+ C EN  +  N     +F C NG  IP  ++CD+E+DC +  DE  C    ILP  T
Sbjct: 1285 NRQQCLFHSMVCDGIIQCRDGSDEDAAFAGCSQ-DPEFHKVCDEFGFQCQNGVCISLIWKCDGMDDCGDYSDEANC-ENPTEAPNCSRYFQFRCENGHCIPNRWKCDRENDCGDWSDEKDCGDSHILPFST 1413          

HSP 3 Score: 63.929 bits (154), Expect = 1.779e-9
Identity = 56/211 (26.54%), Postives = 88/211 (41.71%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDE-------------NPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWK-CDGENDCGNNFDESQC-NENDYKCGNIKFNCSNGKV-IPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGS-----TELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILR 2797
            C  NY RC++G C      CDG  +CAD SDE              P+   +CD    +C      +P       +WK CDG  DC +  DE+ C   +   C + +F C +G+  I  + +CD   DCS+  DE  C       +T  KV+ ++         T        +P    V+   +  + +S+  T+ T     N V+ +L+
Sbjct: 1419 CLPNYYRCSSGTCVMDTWVCDGYRDCADGSDEEACPLLANVTAASTPTQLGRCDRFEFECHQPKTCIP-------NWKRCDGHQDCQDGRDEANCPTHSTLTCMSREFQCEDGEACIVLSERCDGFLDCSDESDEKAC----SDELTVYKVQNLQWTADFSGDVTLTWMRPKKMPSASCVYNVYYRVVGESIWKTLETHSNKTNTVLKVLK 1618          

HSP 4 Score: 63.1586 bits (152), Expect = 3.187e-9
Identity = 46/140 (32.86%), Postives = 66/140 (47.14%), Query Frame = 2
Query: 2246 RCNNGECQPSGKFCDGVANCADRSDE----NPSVCNKCDPLIN-KCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDY---------KCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC-ILPQVTSMT 2620
            +C NG C      CDG+ +C D SDE    NP+    C      +CE  G+ +P +      WKCD ENDCG+  DE  C ++            C    + CS+G  +   + CD   DC++G DE  C +L  VT+ +
Sbjct: 1331 QCQNGVCISLIWKCDGMDDCGDYSDEANCENPTEAPNCSRYFQFRCE-NGHCIPNR------WKCDRENDCGDWSDEKDCGDSHILPFSTPGPSTCLPNYYRCSSGTCVMDTWVCDGYRDCADGSDEEACPLLANVTAAS 1463          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Human
Match: VLDLR (very low density lipoprotein receptor [Source:HGNC Symbol;Acc:HGNC:12698])

HSP 1 Score: 82.0333 bits (201), Expect = 4.077e-15
Identity = 51/145 (35.17%), Postives = 75/145 (51.72%), Query Frame = 2
Query: 2174 ECHDGIRVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIY--GNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILP 2602
            +C DG   K+    ++  C ++   CNNG+C PS   CDG  +C D SDE+P  C+     +  C I+             + W+CDGENDC +  DE  C   +  C   +F CS+G+ I R + C+ + DCS+G DE+ C  P
Sbjct:   57 DCVDGSDEKNC---VKKTCAESDFVCNNGQCVPSRWKCDGDPDCEDGSDESPEQCH-----MRTCRIHEISCGAHSTQCIPVSWRCDGENDCDSGEDEENC--GNITCSPDEFTCSSGRCISRNFVCNGQDDCSDGSDELDCAPP 191          

HSP 2 Score: 61.2326 bits (147), Expect = 8.851e-9
Identity = 38/122 (31.15%), Postives = 57/122 (46.72%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            C  +  +C+   C P    CD  A+C+D+SDE+   C +   +  KC     +    +     W+CDG+ DC +  DE  C      C   +F C +G  I  + QC+   DC +G DEV C
Sbjct:  193 CGAHEFQCSTSSCIPISWVCDDDADCSDQSDESLEQCGRQPVIHTKCPASEIQCGSGECIHKKWRCDGDPDCKDGSDEVNCPSR--TCRPDQFECEDGSCIHGSRQCNGIRDCVDGSDEVNC 312          

HSP 3 Score: 60.077 bits (144), Expect = 1.856e-8
Identity = 45/128 (35.16%), Postives = 63/128 (49.22%), Query Frame = 2
Query: 2225 QCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSV---CNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDES--QCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            +C  +  +C NG C      CDG  +C D SDE   V   C + D + N     G  VP +      WKCDG+ DC +  DES  QC+    +   I     + + IP +++CD E+DC +GEDE  C
Sbjct:   32 KCEPSQFQCTNGRCITLLWKCDGDEDCVDGSDEKNCVKKTCAESDFVCNN----GQCVPSR------WKCDGDPDCEDGSDESPEQCHMRTCRIHEISCGAHSTQCIPVSWRCDGENDCDSGEDEENC 149          

HSP 4 Score: 54.6842 bits (130), Expect = 9.710e-7
Identity = 39/127 (30.71%), Postives = 57/127 (44.88%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDES--QCNEN---DYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            C  +   C++G C      C+G  +C+D SDE       C P    C  +  +        I W CD + DC +  DES  QC        KC   +  C +G+ I + ++CD + DC +G DEV C
Sbjct:  154 CSPDEFTCSSGRCISRNFVCNGQDDCSDGSDEL-----DCAP--PTCGAHEFQCSTSSCIPISWVCDDDADCSDQSDESLEQCGRQPVIHTKCPASEIQCGSGECIHKKWRCDGDPDCKDGSDEVNC 273          

HSP 5 Score: 52.7582 bits (125), Expect = 3.819e-6
Identity = 39/128 (30.47%), Postives = 59/128 (46.09%), Query Frame = 2
Query: 2213 FLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCE----IYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDE 2584
             +  +CP +  +C +GEC      CDG  +C D SDE       C P   +CE    I+G++           +C+G  DC +  DE  C   +   G  KF C +G+ I  +  C++E DC +  DE
Sbjct:  234 VIHTKCPASEIQCGSGECIHKKWRCDGDPDCKDGSDEVNCPSRTCRPDQFECEDGSCIHGSR-----------QCNGIRDCVDGSDEVNCKNVNQCLGPGKFKCRSGECIDISKVCNQEQDCRDWSDE 350          

HSP 6 Score: 51.9878 bits (123), Expect = 5.794e-6
Identity = 29/100 (29.00%), Postives = 47/100 (47.00%), Query Frame = 2
Query: 2411 IHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCESYGVPRPHIVWR 2710
            + WKCDG+ DC +  DE  C +    C    F C+NG+ +P  ++CD + DC +G DE     P+   M   ++         E+ C ++      + WR
Sbjct:   48 LLWKCDGDEDCVDGSDEKNCVKK--TCAESDFVCNNGQCVPSRWKCDGDPDCEDGSDES----PEQCHMRTCRIH--------EISCGAHSTQCIPVSWR 133          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Human
Match: VLDLR (very low density lipoprotein receptor [Source:HGNC Symbol;Acc:HGNC:12698])

HSP 1 Score: 81.2629 bits (199), Expect = 6.329e-15
Identity = 51/145 (35.17%), Postives = 75/145 (51.72%), Query Frame = 2
Query: 2174 ECHDGIRVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIY--GNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILP 2602
            +C DG   K+    ++  C ++   CNNG+C PS   CDG  +C D SDE+P  C+     +  C I+             + W+CDGENDC +  DE  C   +  C   +F CS+G+ I R + C+ + DCS+G DE+ C  P
Sbjct:   57 DCVDGSDEKNC---VKKTCAESDFVCNNGQCVPSRWKCDGDPDCEDGSDESPEQCH-----MRTCRIHEISCGAHSTQCIPVSWRCDGENDCDSGEDEENC--GNITCSPDEFTCSSGRCISRNFVCNGQDDCSDGSDELDCAPP 191          

HSP 2 Score: 60.8474 bits (146), Expect = 1.249e-8
Identity = 38/122 (31.15%), Postives = 57/122 (46.72%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            C  +  +C+   C P    CD  A+C+D+SDE+   C +   +  KC     +    +     W+CDG+ DC +  DE  C      C   +F C +G  I  + QC+   DC +G DEV C
Sbjct:  193 CGAHEFQCSTSSCIPISWVCDDDADCSDQSDESLEQCGRQPVIHTKCPASEIQCGSGECIHKKWRCDGDPDCKDGSDEVNCPSR--TCRPDQFECEDGSCIHGSRQCNGIRDCVDGSDEVNC 312          

HSP 3 Score: 59.6918 bits (143), Expect = 2.491e-8
Identity = 45/128 (35.16%), Postives = 63/128 (49.22%), Query Frame = 2
Query: 2225 QCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSV---CNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDES--QCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            +C  +  +C NG C      CDG  +C D SDE   V   C + D + N     G  VP +      WKCDG+ DC +  DES  QC+    +   I     + + IP +++CD E+DC +GEDE  C
Sbjct:   32 KCEPSQFQCTNGRCITLLWKCDGDEDCVDGSDEKNCVKKTCAESDFVCNN----GQCVPSR------WKCDGDPDCEDGSDESPEQCHMRTCRIHEISCGAHSTQCIPVSWRCDGENDCDSGEDEENC 149          

HSP 4 Score: 54.299 bits (129), Expect = 1.385e-6
Identity = 39/127 (30.71%), Postives = 57/127 (44.88%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDES--QCNEN---DYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            C  +   C++G C      C+G  +C+D SDE       C P    C  +  +        I W CD + DC +  DES  QC        KC   +  C +G+ I + ++CD + DC +G DEV C
Sbjct:  154 CSPDEFTCSSGRCISRNFVCNGQDDCSDGSDEL-----DCAP--PTCGAHEFQCSTSSCIPISWVCDDDADCSDQSDESLEQCGRQPVIHTKCPASEIQCGSGECIHKKWRCDGDPDCKDGSDEVNC 273          

HSP 5 Score: 52.373 bits (124), Expect = 5.006e-6
Identity = 39/128 (30.47%), Postives = 59/128 (46.09%), Query Frame = 2
Query: 2213 FLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCE----IYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDE 2584
             +  +CP +  +C +GEC      CDG  +C D SDE       C P   +CE    I+G++           +C+G  DC +  DE  C   +   G  KF C +G+ I  +  C++E DC +  DE
Sbjct:  234 VIHTKCPASEIQCGSGECIHKKWRCDGDPDCKDGSDEVNCPSRTCRPDQFECEDGSCIHGSR-----------QCNGIRDCVDGSDEVNCKNVNQCLGPGKFKCRSGECIDISKVCNQEQDCRDWSDE 350          

HSP 6 Score: 51.9878 bits (123), Expect = 6.800e-6
Identity = 29/100 (29.00%), Postives = 47/100 (47.00%), Query Frame = 2
Query: 2411 IHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCESYGVPRPHIVWR 2710
            + WKCDG+ DC +  DE  C +    C    F C+NG+ +P  ++CD + DC +G DE     P+   M   ++         E+ C ++      + WR
Sbjct:   48 LLWKCDGDEDCVDGSDEKNCVKK--TCAESDFVCNNGQCVPSRWKCDGDPDCEDGSDES----PEQCHMRTCRIH--------EISCGAHSTQCIPVSWR 133          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Human
Match: SORL1 (sortilin related receptor 1 [Source:HGNC Symbol;Acc:HGNC:11185])

HSP 1 Score: 80.4925 bits (197), Expect = 1.214e-14
Identity = 52/142 (36.62%), Postives = 78/142 (54.93%), Query Frame = 2
Query: 2174 ECHDGIRVKSAT-IFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLIN-KCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            +C  G ++K+ T +  EN C +N  RC+NG C  S  +CD   +C D SDE       CD     +C+  G  +PL       +KCD E+DCG+N DES C    ++C + ++NCS+G  I  ++ CD ++DC +  DE  C
Sbjct:    3 DCPQGYQLKNNTCVKQENTCLRNQYRCSNGNCINSIWWCDFDNDCGDMSDERNCPTTICDLDTQFRCQESGTCIPLS------YKCDLEDDCGDNSDESHCEM--HQCRSDEYNCSSGMCIRSSWVCDGDNDCRDWSDEANC 136          

HSP 2 Score: 71.2478 bits (173), Expect = 8.884e-12
Identity = 48/131 (36.64%), Postives = 69/131 (52.67%), Query Frame = 2
Query: 2252 NNGECQPSGKFCDGVANCADRSDENPSV--CNKCDPLINK-CEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGN----IKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC----ILPQVT 2611
            N  +C      CDG+  C D SDE+ +   C++ DP  +K C+ +G +        + WKCDG +DCG+  DE+ C EN  +  N     +F C NG  IP  ++CD+E+DC +  DE  C    ILP  T
Sbjct:  229 NRQQCLFHSMVCDGIIQCRDGSDEDAAFAGCSQ-DPEFHKVCDEFGFQCQNGVCISLIWKCDGMDDCGDYSDEANC-ENPTEAPNCSRYFQFRCENGHCIPNRWKCDRENDCGDWSDEKDCGDSHILPFST 357          

HSP 3 Score: 61.6178 bits (148), Expect = 8.119e-9
Identity = 56/211 (26.54%), Postives = 88/211 (41.71%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDE-------------NPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWK-CDGENDCGNNFDESQC-NENDYKCGNIKFNCSNGKV-IPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGS-----TELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILR 2797
            C  NY RC++G C      CDG  +CAD SDE              P+   +CD    +C      +P       +WK CDG  DC +  DE+ C   +   C + +F C +G+  I  + +CD   DCS+  DE  C       +T  KV+ ++         T        +P    V+   +  + +S+  T+ T     N V+ +L+
Sbjct:  363 CLPNYYRCSSGTCVMDTWVCDGYRDCADGSDEEACPLLANVTAASTPTQLGRCDRFEFECHQPKTCIP-------NWKRCDGHQDCQDGRDEANCPTHSTLTCMSREFQCEDGEACIVLSERCDGFLDCSDESDEKAC----SDELTVYKVQNLQWTADFSGDVTLTWMRPKKMPSASCVYNVYYRVVGESIWKTLETHSNKTNTVLKVLK 562          

HSP 4 Score: 61.2326 bits (147), Expect = 1.130e-8
Identity = 46/140 (32.86%), Postives = 66/140 (47.14%), Query Frame = 2
Query: 2246 RCNNGECQPSGKFCDGVANCADRSDE----NPSVCNKCDPLIN-KCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDY---------KCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC-ILPQVTSMT 2620
            +C NG C      CDG+ +C D SDE    NP+    C      +CE  G+ +P +      WKCD ENDCG+  DE  C ++            C    + CS+G  +   + CD   DC++G DE  C +L  VT+ +
Sbjct:  275 QCQNGVCISLIWKCDGMDDCGDYSDEANCENPTEAPNCSRYFQFRCE-NGHCIPNR------WKCDRENDCGDWSDEKDCGDSHILPFSTPGPSTCLPNYYRCSSGTCVMDTWVCDGYRDCADGSDEEACPLLANVTAAS 407          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Celegans
Match: unc-52 (Basement membrane proteoglycan [Source:UniProtKB/Swiss-Prot;Acc:Q06561])

HSP 1 Score: 100.908 bits (250), Expect = 3.963e-21
Identity = 95/326 (29.14%), Postives = 148/326 (45.40%), Query Frame = 2
Query: 1943 LTITPEIVRVRNGQPVVVECFSVSE-----------KTGEPYGEPKFTMEYGKSLSTDPRLVEQKVGQSRVRLSIKDGLQTSDNNLKVECHDGIRVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDEN--PSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNE--NDYKCGNIKFNCSNGK-VIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILRITNFQPGDDGIYNCETLSGPNRSFS 2872
            +T+ P    VR+G+ V  EC + +            + G P   P    + G  L+ +P  V+     + + +S  +G              G +  S  +    QC  + + C N EC  +   CDG  +C DRSDE   P++   C+P   KC    NK   K      W CDG++DCG+N DE  CN   +   C   +F C + +  +P ++ CD  +DC +G DEVGC+ P V       + ++ R  +  L C++  VP P+I WR NWG + +  R  ++T+  G       L I + QP D G Y CE ++   R  +
Sbjct:   47 ITVFPSEKEVRDGRDVSFECRARTSDNSVYPTVRWARVGGPL--PSSAHDSGGRLTINP--VQLSDAGTYICVSDYNGNTVEARATLSVVSYGPQEVSNGLRQAGQCMADEKACGNNECVKNDYVCDGEPDCRDRSDEANCPAISRTCEPNEFKCN--NNKCVQK-----MWLCDGDDDCGDNSDELNCNAKPSSSDCKPTEFQCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQTNL-QVPRGTTFSLTCKAVAVPEPYINWRLNWGPVCEPPRC-LQTSEGG----YGTLTIHDAQPVDQGAYTCEAINVKGRVLA 355          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Celegans
Match: unc-52 (Basement membrane proteoglycan [Source:UniProtKB/Swiss-Prot;Acc:Q06561])

HSP 1 Score: 100.523 bits (249), Expect = 4.294e-21
Identity = 95/326 (29.14%), Postives = 148/326 (45.40%), Query Frame = 2
Query: 1943 LTITPEIVRVRNGQPVVVECFSVSE-----------KTGEPYGEPKFTMEYGKSLSTDPRLVEQKVGQSRVRLSIKDGLQTSDNNLKVECHDGIRVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDEN--PSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNE--NDYKCGNIKFNCSNGK-VIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILRITNFQPGDDGIYNCETLSGPNRSFS 2872
            +T+ P    VR+G+ V  EC + +            + G P   P    + G  L+ +P  V+     + + +S  +G              G +  S  +    QC  + + C N EC  +   CDG  +C DRSDE   P++   C+P   KC    NK   K      W CDG++DCG+N DE  CN   +   C   +F C + +  +P ++ CD  +DC +G DEVGC+ P V       + ++ R  +  L C++  VP P+I WR NWG + +  R  ++T+  G       L I + QP D G Y CE ++   R  +
Sbjct:  836 ITVFPSEKEVRDGRDVSFECRARTSDNSVYPTVRWARVGGPL--PSSAHDSGGRLTINP--VQLSDAGTYICVSDYNGNTVEARATLSVVSYGPQEVSNGLRQAGQCMADEKACGNNECVKNDYVCDGEPDCRDRSDEANCPAISRTCEPNEFKCN--NNKCVQK-----MWLCDGDDDCGDNSDELNCNAKPSSSDCKPTEFQCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQTNL-QVPRGTTFSLTCKAVAVPEPYINWRLNWGPVCEPPRC-LQTSEGG----YGTLTIHDAQPVDQGAYTCEAINVKGRVLA 1144          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Celegans
Match: unc-52 (Basement membrane proteoglycan [Source:UniProtKB/Swiss-Prot;Acc:Q06561])

HSP 1 Score: 100.523 bits (249), Expect = 4.681e-21
Identity = 95/326 (29.14%), Postives = 148/326 (45.40%), Query Frame = 2
Query: 1943 LTITPEIVRVRNGQPVVVECFSVSE-----------KTGEPYGEPKFTMEYGKSLSTDPRLVEQKVGQSRVRLSIKDGLQTSDNNLKVECHDGIRVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDEN--PSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNE--NDYKCGNIKFNCSNGK-VIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILRITNFQPGDDGIYNCETLSGPNRSFS 2872
            +T+ P    VR+G+ V  EC + +            + G P   P    + G  L+ +P  V+     + + +S  +G              G +  S  +    QC  + + C N EC  +   CDG  +C DRSDE   P++   C+P   KC    NK   K      W CDG++DCG+N DE  CN   +   C   +F C + +  +P ++ CD  +DC +G DEVGC+ P V       + ++ R  +  L C++  VP P+I WR NWG + +  R  ++T+  G       L I + QP D G Y CE ++   R  +
Sbjct:   47 ITVFPSEKEVRDGRDVSFECRARTSDNSVYPTVRWARVGGPL--PSSAHDSGGRLTINP--VQLSDAGTYICVSDYNGNTVEARATLSVVSYGPQEVSNGLRQAGQCMADEKACGNNECVKNDYVCDGEPDCRDRSDEANCPAISRTCEPNEFKCN--NNKCVQK-----MWLCDGDDDCGDNSDELNCNAKPSSSDCKPTEFQCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQTNL-QVPRGTTFSLTCKAVAVPEPYINWRLNWGPVCEPPRC-LQTSEGG----YGTLTIHDAQPVDQGAYTCEAINVKGRVLA 355          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Celegans
Match: unc-52 (Basement membrane proteoglycan [Source:UniProtKB/Swiss-Prot;Acc:Q06561])

HSP 1 Score: 100.523 bits (249), Expect = 4.723e-21
Identity = 95/326 (29.14%), Postives = 148/326 (45.40%), Query Frame = 2
Query: 1943 LTITPEIVRVRNGQPVVVECFSVSE-----------KTGEPYGEPKFTMEYGKSLSTDPRLVEQKVGQSRVRLSIKDGLQTSDNNLKVECHDGIRVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDEN--PSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNE--NDYKCGNIKFNCSNGK-VIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILRITNFQPGDDGIYNCETLSGPNRSFS 2872
            +T+ P    VR+G+ V  EC + +            + G P   P    + G  L+ +P  V+     + + +S  +G              G +  S  +    QC  + + C N EC  +   CDG  +C DRSDE   P++   C+P   KC    NK   K      W CDG++DCG+N DE  CN   +   C   +F C + +  +P ++ CD  +DC +G DEVGC+ P V       + ++ R  +  L C++  VP P+I WR NWG + +  R  ++T+  G       L I + QP D G Y CE ++   R  +
Sbjct:   47 ITVFPSEKEVRDGRDVSFECRARTSDNSVYPTVRWARVGGPL--PSSAHDSGGRLTINP--VQLSDAGTYICVSDYNGNTVEARATLSVVSYGPQEVSNGLRQAGQCMADEKACGNNECVKNDYVCDGEPDCRDRSDEANCPAISRTCEPNEFKCN--NNKCVQK-----MWLCDGDDDCGDNSDELNCNAKPSSSDCKPTEFQCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQTNL-QVPRGTTFSLTCKAVAVPEPYINWRLNWGPVCEPPRC-LQTSEGG----YGTLTIHDAQPVDQGAYTCEAINVKGRVLA 355          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Celegans
Match: unc-52 (Basement membrane proteoglycan [Source:UniProtKB/Swiss-Prot;Acc:Q06561])

HSP 1 Score: 100.523 bits (249), Expect = 4.752e-21
Identity = 95/326 (29.14%), Postives = 148/326 (45.40%), Query Frame = 2
Query: 1943 LTITPEIVRVRNGQPVVVECFSVSE-----------KTGEPYGEPKFTMEYGKSLSTDPRLVEQKVGQSRVRLSIKDGLQTSDNNLKVECHDGIRVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDEN--PSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNE--NDYKCGNIKFNCSNGK-VIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILRITNFQPGDDGIYNCETLSGPNRSFS 2872
            +T+ P    VR+G+ V  EC + +            + G P   P    + G  L+ +P  V+     + + +S  +G              G +  S  +    QC  + + C N EC  +   CDG  +C DRSDE   P++   C+P   KC    NK   K      W CDG++DCG+N DE  CN   +   C   +F C + +  +P ++ CD  +DC +G DEVGC+ P V       + ++ R  +  L C++  VP P+I WR NWG + +  R  ++T+  G       L I + QP D G Y CE ++   R  +
Sbjct:   47 ITVFPSEKEVRDGRDVSFECRARTSDNSVYPTVRWARVGGPL--PSSAHDSGGRLTINP--VQLSDAGTYICVSDYNGNTVEARATLSVVSYGPQEVSNGLRQAGQCMADEKACGNNECVKNDYVCDGEPDCRDRSDEANCPAISRTCEPNEFKCN--NNKCVQK-----MWLCDGDDDCGDNSDELNCNAKPSSSDCKPTEFQCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQTNL-QVPRGTTFSLTCKAVAVPEPYINWRLNWGPVCEPPRC-LQTSEGG----YGTLTIHDAQPVDQGAYTCEAINVKGRVLA 355          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Fly
Match: trol (gene:FBgn0284408 transcript:FBtr0342821)

HSP 1 Score: 127.102 bits (318), Expect = 4.471e-29
Identity = 105/338 (31.07%), Postives = 155/338 (45.86%), Query Frame = 2
Query: 1874 CTTTEGLRRTAELVIKRREDSTLLTITPEIV-RVRNGQPVVVECFSVSEKTGEPYGEPKFTMEYGKSLSTDPRLVEQK--VGQSRVRLSIKDGLQTSDNNLKVECHDGIRVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENP-SVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNE--NDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILRITNFQPGDDGIYNCETLSGPNRSF 2869
            C      RR  +L +K   DS ++  + E++ R R+  P   +    S   G P   P FT   G+    + R+ +    V ++    S   G Q +  NL VE ++ +  +      E+ C +    C NGEC      CDG  +C+D SDE   S+  KC P  N+     +K   +      W+CDGENDCG+N DE+ C+   +   C   +F C +G  IP+++QCD   DC++G DEVGC+ P         V  +  E   EL C + G P P IVWR NWG + D        +  G       LR  + +P D G Y+CE ++     F
Sbjct:  786 CAADSNDRRPNQLNLKTYPDSQIIKESREVIFRCRDEGPARAK-VKWSRPGGRPL-PPGFTDRNGRLEIPNIRVEDAGTYVCEAVGYASYIPGQQVT-VNLNVERYNDVGSRP-----ESACTEYQATCMNGECIDKSSICDGNPDCSDASDEQSCSLGLKCQP--NQFMCSNSKCVDRT-----WRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQSVSLLEYE-VLELTCVATGTPTPTIVWRLNWGHVPDKCE---SKSYGG----TGTLRCPDMRPQDSGAYSCEIINTRGTHF 1100          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Fly
Match: trol (gene:FBgn0284408 transcript:FBtr0342811)

HSP 1 Score: 126.716 bits (317), Expect = 6.059e-29
Identity = 104/338 (30.77%), Postives = 153/338 (45.27%), Query Frame = 2
Query: 1874 CTTTEGLRRTAELVIKRREDSTLLTITPEIV-RVRNGQPVVVECFSVSEKTGEPYGEPKFTMEYGKSLSTDPRLVEQK--VGQSRVRLSIKDGLQTSDNNLKVECHDGIRVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENP-SVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNE--NDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILRITNFQPGDDGIYNCETLSGPNRSF 2869
            C      RR  +L +K   DS ++  + E++ R R+  P   +    S   G P   P FT   G+    + R+ +    V ++    S   G Q +  NL VE ++ +  +      E+ C +    C NGEC      CDG  +C+D SDE   S+  KC P  N+     +K   +      W+CDGENDCG+N DE+ C+   +   C   +F C +G  IP+++QCD   DC++G DEVGC+ P         V  +  E   EL C + G P P IVWR NWG + D                   LR  + +P D G Y+CE ++     F
Sbjct:  603 CAADSNDRRPNQLNLKTYPDSQIIKESREVIFRCRDEGPARAK-VKWSRPGGRPL-PPGFTDRNGRLEIPNIRVEDAGTYVCEAVGYASYIPGQQVT-VNLNVERYNDVGSRP-----ESACTEYQATCMNGECIDKSSICDGNPDCSDASDEQSCSLGLKCQP--NQFMCSNSKCVDRT-----WRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQSVSLLEYE-VLELTCVATGTPTPTIVWRLNWGHVPDKCESKSYGG-------TGTLRCPDMRPQDSGAYSCEIINTRGTHF 917          

HSP 2 Score: 65.855 bits (159), Expect = 2.345e-10
Identity = 55/218 (25.23%), Postives = 87/218 (39.91%), Query Frame = 2
Query: 2222 NQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLK--DIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILP-------QVTSMTDAKVRRIRREGSTELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILRITNFQPGDDGIYNCETL 2848
            N+C  N  RCNNG+C  + K C+ V++C++  DEN            +C  Y N+      D       C+G ++C ++ DE  C     +C   +F C++G+ +  + +C+  +DC +  DE  C          Q+   T    + I+       RC   G  R  + W    G          R    G       L I N +  D G Y CE +
Sbjct:  490 NECQANEFRCNNGDCIDARKRCNNVSDCSEGEDEN-----------EECRCYANQFRCNNGDCVSGSAPCNGYSECSDHSDELNCGGTQ-ECLPNQFRCNSGQCVSSSVRCNGRTDCQDSSDEQNCAADSNDRRPNQLNLKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGG----------RPLPPGFTDRNGRLEIPNIRVEDAGTYVCEAV 685          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Fly
Match: trol (gene:FBgn0284408 transcript:FBtr0342822)

HSP 1 Score: 126.331 bits (316), Expect = 6.848e-29
Identity = 104/338 (30.77%), Postives = 153/338 (45.27%), Query Frame = 2
Query: 1874 CTTTEGLRRTAELVIKRREDSTLLTITPEIV-RVRNGQPVVVECFSVSEKTGEPYGEPKFTMEYGKSLSTDPRLVEQK--VGQSRVRLSIKDGLQTSDNNLKVECHDGIRVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENP-SVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNE--NDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILRITNFQPGDDGIYNCETLSGPNRSF 2869
            C      RR  +L +K   DS ++  + E++ R R+  P   +    S   G P   P FT   G+    + R+ +    V ++    S   G Q +  NL VE ++ +  +      E+ C +    C NGEC      CDG  +C+D SDE   S+  KC P  N+     +K   +      W+CDGENDCG+N DE+ C+   +   C   +F C +G  IP+++QCD   DC++G DEVGC+ P         V  +  E   EL C + G P P IVWR NWG + D                   LR  + +P D G Y+CE ++     F
Sbjct:  882 CAADSNDRRPNQLNLKTYPDSQIIKESREVIFRCRDEGPARAK-VKWSRPGGRPL-PPGFTDRNGRLEIPNIRVEDAGTYVCEAVGYASYIPGQQVT-VNLNVERYNDVGSRP-----ESACTEYQATCMNGECIDKSSICDGNPDCSDASDEQSCSLGLKCQP--NQFMCSNSKCVDRT-----WRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQSVSLLEYE-VLELTCVATGTPTPTIVWRLNWGHVPDKCESKSYGG-------TGTLRCPDMRPQDSGAYSCEIINTRGTHF 1196          

HSP 2 Score: 74.3294 bits (181), Expect = 5.823e-13
Identity = 51/166 (30.72%), Postives = 76/166 (45.78%), Query Frame = 2
Query: 2222 NQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDY---KCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCESYGVPRPHIVWR 2710
            N+C  N  RCNNG+C  + K C+ V++C++  DEN      C  +  +C   G +        +  +CDG +DC +  DE  C+ + Y   +C   +F+C  G+ IP    CD   DC++  DEV C+                 EG  E R    G+P  H  WR
Sbjct:  530 NECQANEFRCNNGDCIDARKRCNNVSDCSEGEDENEECPAACSGMEYQCRD-GTRC-----ISVSQQCDGHSDCSDGDDEEHCDGSGYDSEECRFDEFHCGTGECIPMRQVCDNIYDCNDYSDEVNCV-----------------EGEEEDR---VGIPIGHQPWR 669          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Fly
Match: trol (gene:FBgn0284408 transcript:FBtr0342812)

HSP 1 Score: 126.331 bits (316), Expect = 7.074e-29
Identity = 105/338 (31.07%), Postives = 155/338 (45.86%), Query Frame = 2
Query: 1874 CTTTEGLRRTAELVIKRREDSTLLTITPEIV-RVRNGQPVVVECFSVSEKTGEPYGEPKFTMEYGKSLSTDPRLVEQK--VGQSRVRLSIKDGLQTSDNNLKVECHDGIRVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENP-SVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNE--NDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILRITNFQPGDDGIYNCETLSGPNRSF 2869
            C      RR  +L +K   DS ++  + E++ R R+  P   +    S   G P   P FT   G+    + R+ +    V ++    S   G Q +  NL VE ++ +  +      E+ C +    C NGEC      CDG  +C+D SDE   S+  KC P  N+     +K   +      W+CDGENDCG+N DE+ C+   +   C   +F C +G  IP+++QCD   DC++G DEVGC+ P         V  +  E   EL C + G P P IVWR NWG + D        +  G       LR  + +P D G Y+CE ++     F
Sbjct:  842 CAADSNDRRPNQLNLKTYPDSQIIKESREVIFRCRDEGPARAK-VKWSRPGGRPL-PPGFTDRNGRLEIPNIRVEDAGTYVCEAVGYASYIPGQQVT-VNLNVERYNDVGSRP-----ESACTEYQATCMNGECIDKSSICDGNPDCSDASDEQSCSLGLKCQP--NQFMCSNSKCVDRT-----WRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQSVSLLEYE-VLELTCVATGTPTPTIVWRLNWGHVPDKCE---SKSYGG----TGTLRCPDMRPQDSGAYSCEIINTRGTHF 1156          

HSP 2 Score: 74.3294 bits (181), Expect = 5.918e-13
Identity = 51/166 (30.72%), Postives = 76/166 (45.78%), Query Frame = 2
Query: 2222 NQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDY---KCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCESYGVPRPHIVWR 2710
            N+C  N  RCNNG+C  + K C+ V++C++  DEN      C  +  +C   G +        +  +CDG +DC +  DE  C+ + Y   +C   +F+C  G+ IP    CD   DC++  DEV C+                 EG  E R    G+P  H  WR
Sbjct:  490 NECQANEFRCNNGDCIDARKRCNNVSDCSEGEDENEECPAACSGMEYQCRD-GTRC-----ISVSQQCDGHSDCSDGDDEEHCDGSGYDSEECRFDEFHCGTGECIPMRQVCDNIYDCNDYSDEVNCV-----------------EGEEEDR---VGIPIGHQPWR 629          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Fly
Match: trol (gene:FBgn0284408 transcript:FBtr0342824)

HSP 1 Score: 126.331 bits (316), Expect = 7.465e-29
Identity = 105/338 (31.07%), Postives = 155/338 (45.86%), Query Frame = 2
Query: 1874 CTTTEGLRRTAELVIKRREDSTLLTITPEIV-RVRNGQPVVVECFSVSEKTGEPYGEPKFTMEYGKSLSTDPRLVEQK--VGQSRVRLSIKDGLQTSDNNLKVECHDGIRVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENP-SVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNE--NDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILRITNFQPGDDGIYNCETLSGPNRSF 2869
            C      RR  +L +K   DS ++  + E++ R R+  P   +    S   G P   P FT   G+    + R+ +    V ++    S   G Q +  NL VE ++ +  +      E+ C +    C NGEC      CDG  +C+D SDE   S+  KC P  N+     +K   +      W+CDGENDCG+N DE+ C+   +   C   +F C +G  IP+++QCD   DC++G DEVGC+ P         V  +  E   EL C + G P P IVWR NWG + D        +  G       LR  + +P D G Y+CE ++     F
Sbjct:  708 CAADSNDRRPNQLNLKTYPDSQIIKESREVIFRCRDEGPARAK-VKWSRPGGRPL-PPGFTDRNGRLEIPNIRVEDAGTYVCEAVGYASYIPGQQVT-VNLNVERYNDVGSRP-----ESACTEYQATCMNGECIDKSSICDGNPDCSDASDEQSCSLGLKCQP--NQFMCSNSKCVDRT-----WRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQSVSLLEYE-VLELTCVATGTPTPTIVWRLNWGHVPDKCE---SKSYGG----TGTLRCPDMRPQDSGAYSCEIINTRGTHF 1022          

HSP 2 Score: 53.9138 bits (128), Expect = 1.059e-6
Identity = 57/236 (24.15%), Postives = 87/236 (36.86%), Query Frame = 2
Query: 2162 NLKVECHDGIRVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILP-------QVTSMTDAKVRRIRREGSTELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILRITNFQPGDDGIYNCETL 2848
            N  V+C DG    S  +     CPQ+  +C +G C    + CD   +C D SDE            N C     +    D       C+G ++C ++ DE  C     +C   +F C++G+ +  + +C+  +DC +  DE  C          Q+   T    + I+       RC   G  R  + W    G          R    G       L I N +  D G Y CE +
Sbjct:  583 NGHVDCSDG----SDEVGCSLPCPQH--QCPSGRCYTESERCDRHRHCEDGSDE-----------ANCCYANQFRCNNGDCVSGSAPCNGYSECSDHSDELNCGGTQ-ECLPNQFRCNSGQCVSSSVRCNGRTDCQDSSDEQNCAADSNDRRPNQLNLKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGG----------RPLPPGFTDRNGRLEIPNIRVEDAGTYVCEAV 790          

HSP 3 Score: 53.5286 bits (127), Expect = 1.162e-6
Identity = 38/130 (29.23%), Postives = 61/130 (46.92%), Query Frame = 2
Query: 2222 NQCPQNYRRCNNGECQPSGKFCDGVANCADRSDEN---PSVCNK---CDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            N+C  N  RCNNG+C  + K C+ V++C++  DEN   P+   K   C P    C+        +  +    +C+G  DC +  DE  C+     C   +  C +G+    + +CD+   C +G DE  C
Sbjct:  517 NECQANEFRCNNGDCIDARKRCNNVSDCSEGEDENEECPTTRLKPSDCSPEQFYCD--------ESCYNRSVRCNGHVDCSDGSDEVGCS---LPC--PQHQCPSGRCYTESERCDRHRHCEDGSDEANC 633          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Zebrafish
Match: hspg2 (heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZDB-GENE-080807-4])

HSP 1 Score: 116.316 bits (290), Expect = 1.284e-25
Identity = 77/221 (34.84%), Postives = 108/221 (48.87%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVC---NKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQC--NENDYKCGNIKFNC-SNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILRITNFQPGDDGIYNCETLSGPNRSFS 2872
            C  +   C NG+C      CDG ++C D SDE  S C   + C+P   KC+    +  LK      W+CDG+NDC +N DE  C        C   +F C S+ K IP +YQCD+E DC++  DE GC  P VT   +  +   R +  T   C + GVP P I WR NWG +  + R+T+ +           L I + + GD G Y CE ++     F+
Sbjct:  199 CRADQATCQNGQCISREYLCDGESDCTDGSDE--SRCGTPSPCEPNEFKCQ--NGRCALK-----LWRCDGDNDCQDNSDEMNCPTKRPGAACAPEQFVCLSDRKCIPASYQCDEEPDCADRSDEFGCAPPTVTVSPEESITASRGDTVT-FTCSAIGVPVPIITWRLNWGHIPANNRITMIS-----ENGQGTLTIRDVKEGDQGAYTCEAINAKGLVFA 404          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Zebrafish
Match: hspg2 (heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZDB-GENE-080807-4])

HSP 1 Score: 115.931 bits (289), Expect = 1.512e-25
Identity = 77/221 (34.84%), Postives = 108/221 (48.87%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVC---NKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQC--NENDYKCGNIKFNC-SNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILRITNFQPGDDGIYNCETLSGPNRSFS 2872
            C  +   C NG+C      CDG ++C D SDE  S C   + C+P   KC+    +  LK      W+CDG+NDC +N DE  C        C   +F C S+ K IP +YQCD+E DC++  DE GC  P VT   +  +   R +  T   C + GVP P I WR NWG +  + R+T+ +           L I + + GD G Y CE ++     F+
Sbjct:  264 CRADQATCQNGQCISREYLCDGESDCTDGSDE--SRCGTPSPCEPNEFKCQ--NGRCALK-----LWRCDGDNDCQDNSDEMNCPTKRPGAACAPEQFVCLSDRKCIPASYQCDEEPDCADRSDEFGCAPPTVTVSPEESITASRGDTVT-FTCSAIGVPVPIITWRLNWGHIPANNRITMIS-----ENGQGTLTIRDVKEGDQGAYTCEAINAKGLVFA 469          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Zebrafish
Match: hspg2 (heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZDB-GENE-080807-4])

HSP 1 Score: 115.931 bits (289), Expect = 1.627e-25
Identity = 77/221 (34.84%), Postives = 108/221 (48.87%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVC---NKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQC--NENDYKCGNIKFNC-SNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILRITNFQPGDDGIYNCETLSGPNRSFS 2872
            C  +   C NG+C      CDG ++C D SDE  S C   + C+P   KC+    +  LK      W+CDG+NDC +N DE  C        C   +F C S+ K IP +YQCD+E DC++  DE GC  P VT   +  +   R +  T   C + GVP P I WR NWG +  + R+T+ +           L I + + GD G Y CE ++     F+
Sbjct:  199 CRADQATCQNGQCISREYLCDGESDCTDGSDE--SRCGTPSPCEPNEFKCQ--NGRCALK-----LWRCDGDNDCQDNSDEMNCPTKRPGAACAPEQFVCLSDRKCIPASYQCDEEPDCADRSDEFGCAPPTVTVSPEESITASRGDTVT-FTCSAIGVPVPIITWRLNWGHIPANNRITMIS-----ENGQGTLTIRDVKEGDQGAYTCEAINAKGLVFA 404          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Zebrafish
Match: sorl1 (sortilin-related receptor, L(DLR class) A repeats containing [Source:ZFIN;Acc:ZDB-GENE-050208-22])

HSP 1 Score: 89.7373 bits (221), Expect = 1.530e-17
Identity = 57/163 (34.97%), Postives = 83/163 (50.92%), Query Frame = 2
Query: 2138 DGLQTS---DNNLKVECHDGIRVKSAT-IFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLIN-KCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILPQVT 2611
            DG+ TS       + +C  G ++ + T +  E+ C  N  RC NG+C  S   CD   +C D SDE       CDP +  +C   G+ +PL       +KCD E+DCG+N DE  C    +KCG  +F C+ G  I  A++CD ++DC +  DE  C +   T
Sbjct: 1045 DGVPTSVLPSGERQCQCPSGYQLHNNTCVKTEHTCLPNQHRCANGKCISSIWKCDSDNDCGDMSDEQECPTTSCDPSVQFRCVASGSCIPLA------FKCDHEDDCGDNSDEEHCES--HKCGPGEFTCARGACIRDAWRCDGDNDCRDWSDEANCTVGHHT 1199          

HSP 2 Score: 73.559 bits (179), Expect = 1.271e-12
Identity = 40/119 (33.61%), Postives = 59/119 (49.58%), Query Frame = 2
Query: 2252 NNGECQPSGKFCDGVANCADRSDENP--SVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCG---NIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            N  +C      CDG  +CAD SDE+P  + C+        C+ Y  +        + WKCDG +DCG+  DE+ C     + G     +F C NG+ +P  ++CD E+DC +  DE  C
Sbjct: 1287 NRAQCLFQSLVCDGTRHCADGSDEDPIYAGCSTSVEFEKTCDGYNFQCTNGMCVTLEWKCDGMDDCGDYSDEANCASPTEEPGCTSYFRFECKNGRCVPAWWKCDGENDCGDWSDESQC 1405          

HSP 3 Score: 70.8626 bits (172), Expect = 8.973e-12
Identity = 53/158 (33.54%), Postives = 69/158 (43.67%), Query Frame = 2
Query: 2201 SATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIY-------GNKVPLKDIFLIHWKCDGENDCGNNFDESQCNEND---------YKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC--ILPQVTSMT 2620
            S ++  E  C     +C NG C      CDG+ +C D SDE        +P    C  Y       G  VP        WKCDGENDCG+  DESQC+  +           C   +F C +G  I   + CD  +DC +  DE GC  +   VTS+T
Sbjct: 1318 STSVEFEKTCDGYNFQCTNGMCVTLEWKCDGMDDCGDYSDEANCASPTEEP---GCTSYFRFECKNGRCVP------AWWKCDGENDCGDWSDESQCSGGEALHTPAPGPATCAPNRFRCGSGACIVDTWVCDGYADCPDSSDEAGCPTVKGSVTSVT 1466          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Zebrafish
Match: lrp2a (low density lipoprotein receptor-related protein 2a [Source:ZFIN;Acc:ZDB-GENE-050119-2])

HSP 1 Score: 78.9518 bits (193), Expect = 3.437e-14
Identity = 45/130 (34.62%), Postives = 63/130 (48.46%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSM 2617
            C   + RC  G C P  + CDG  +C+D SDE       C+    +C   G  +P       HW CD E DC +  DE Q +     C + +F C+NG  IP  Y+CD+  DC +G DE  C  P+ + +
Sbjct:    2 CESGFFRCGTGRCIPVSQRCDGTNDCSDNSDEIGCPQPTCESAQFQCLSDGECIPQ------HWVCDDEEDCEDGSDERQ-HCPGRTCSSSQFTCTNGACIPGGYRCDRVPDCLDGADERNCFYPECSEL 124          

HSP 2 Score: 75.485 bits (184), Expect = 3.658e-13
Identity = 50/128 (39.06%), Postives = 62/128 (48.44%), Query Frame = 2
Query: 2225 QCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVC--NKCDPLINKCEIYGNK--VPLKDIFLIHWKCDGENDCGNNFDESQC-NENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            QC  N   C+NG+C P    CDGV +C D SDE       N C PL   C    N+  VP        W CDG NDC +  DE  C  +    C   +F C+N   IPR + CD ++DC +G DE  C
Sbjct:  996 QCGSNSFSCSNGKCVPHSYQCDGVDDCHDNSDEAHCGAHNNTCSPLAFTC---ANQRCVPRS------WHCDGHNDCFDGSDERDCPTQTPGTCPADQFICANHYCIPRTWLCDTDNDCGDGSDENNC 1114          

HSP 3 Score: 72.7886 bits (177), Expect = 2.229e-12
Identity = 47/142 (33.10%), Postives = 65/142 (45.77%), Query Frame = 2
Query: 2171 VECHDGIRVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSV-CNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
             +C+DG         L   C     RC++G C  S   CDG  +C D SDE+    C        +     N+ P +      W CDG+ DC + FDE Q N     C   +F C+NG  I  +Y+CD+ +DC +  DE GC
Sbjct: 2884 TDCNDGSDEPITCTSLVRTCNSEQFRCDDGRCIASSWICDGDNDCGDMSDEDQRHNCANRTCSAQEFTCVNNRPPQRKCIPRDWVCDGDADCSDAFDEHQ-NCTRRSCSTNEFTCNNGLCIRSSYRCDRRNDCGDSSDEQGC 3024          

HSP 4 Score: 71.2478 bits (173), Expect = 7.709e-12
Identity = 44/120 (36.67%), Postives = 60/120 (50.00%), Query Frame = 2
Query: 2231 PQNYRRCNNGECQPSGKFCDGVANCADR--SDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDE 2584
            P     CNNG C      C+G+ NC D   SDE       C P   KC+     +P        + CDG+NDCG+N DES  +     C + +F CS+G+ IP  + CD  +DC++G DE
Sbjct: 2779 PNTEFSCNNGRCIAREYICNGINNCYDNGTSDEQNCPERTCQPEHTKCQSTNICIPRS------YLCDGDNDCGDNSDESPTHCATSTCSHNEFRCSSGRCIPGHWYCDGGTDCNDGSDE 2892          

HSP 5 Score: 70.8626 bits (172), Expect = 8.179e-12
Identity = 38/113 (33.63%), Postives = 58/113 (51.33%), Query Frame = 2
Query: 2246 RCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDE 2584
            +CN+G C      C+   +C D SDE+  +C       ++CE +  +   K      W+CDGENDCG+  DE   + +   C   +F C NG+ IP  ++CD + DC +  DE
Sbjct: 3555 QCNDGNCTSPHFLCNSNQDCPDGSDEDTVLC-----ATHQCESHQWQCANKRCISEAWQCDGENDCGDGSDEDPAHCSSRTCRPGQFKCRNGRCIPNTWKCDVDDDCGDNSDE 3662          

HSP 6 Score: 68.5514 bits (166), Expect = 4.101e-11
Identity = 48/135 (35.56%), Postives = 64/135 (47.41%), Query Frame = 2
Query: 2198 KSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQ-CNENDYKCGNIKFNCSNG-----KVIPRAYQCDKESDCSNGEDE 2584
            +S T    + C  N  RC++G C P   +CDG  +C D SDE P  C     L+  C     +          W CDG+NDCG+  DE Q  N  +  C   +F C N      K IPR + CD ++DCS+  DE
Sbjct: 2851 ESPTHCATSTCSHNEFRCSSGRCIPGHWYCDGGTDCNDGSDE-PITCTS---LVRTCNSEQFRCDDGRCIASSWICDGDNDCGDMSDEDQRHNCANRTCSAQEFTCVNNRPPQRKCIPRDWVCDGDADCSDAFDE 2981          

HSP 7 Score: 65.4698 bits (158), Expect = 4.073e-10
Identity = 47/140 (33.57%), Postives = 62/140 (44.29%), Query Frame = 2
Query: 2171 VECHDGIRVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNC-SNGKVIPRAYQCDKESDCSNGEDEV 2587
            + C DG    + T     +C     +C+NGEC P G  CD   +C DRSDE       C      C       P        W CDGE+DC +N DE  C+    +C   ++ C S+G  IP  + CD    C +GEDE 
Sbjct:  142 LNCRDGSDEANCT----QRCSSGQFQCSNGECIPRGYICDHDDDCGDRSDEQNCTYPTCRGTYFTC-------PSGRCIHQVWLCDGEDDCEDNADEKGCDNVQRECYPGEWPCPSSGVCIPFDHLCDGTVHCPDGEDET 270          

HSP 8 Score: 65.0846 bits (157), Expect = 4.821e-10
Identity = 41/125 (32.80%), Postives = 57/125 (45.60%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILP 2602
            C  +   C NG C P G  CD V +C D +DE      +C  L         +      F    +CD   +C +  DE+ C +   +C + +F CSNG+ IPR Y CD + DC +  DE  C  P
Sbjct:   82 CSSSQFTCTNGACIPGGYRCDRVPDCLDGADERNCFYPECSEL---------RCANGACFNRSQRCDQVLNCRDGSDEANCTQ---RCSSGQFQCSNGECIPRGYICDHDDDCGDRSDEQNCTYP 194          

HSP 9 Score: 64.3142 bits (155), Expect = 9.470e-10
Identity = 46/130 (35.38%), Postives = 59/130 (45.38%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDE--SQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILPQVT 2611
            C  N   CNNG C  S   CD   +C D SDE       C      C+   N   +   FL    CDG+NDCG+  DE    C      C +  F C NG  +P++  CD+  DCS+  DE GC + + T
Sbjct: 2990 CSTNEFTCNNGLCIRSSYRCDRRNDCGDSSDEQGCTYQPCQQHQFTCQ---NGRCISRDFL----CDGDNDCGDESDELDHLCRMPAPTCPSGHFRCDNGNCVPQSQVCDRNDDCSDNSDEKGCGINECT 3112          

HSP 10 Score: 64.3142 bits (155), Expect = 9.878e-10
Identity = 44/126 (34.92%), Postives = 63/126 (50.00%), Query Frame = 2
Query: 2246 RCNNG-ECQPSGKFCDGVANCADRSDEN------PSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILP 2602
            +C NG +C  S   CDGV +C DRSDE+      P +C+       +C+  G+ VP      ++W+CDG  DC +  DE         C   +F C NG  + R + CD ++DC +G DE  C  P
Sbjct: 1164 KCANGHQCVNSYYRCDGVFDCNDRSDESGCPTRPPGMCHHESEF--QCQSDGSCVP------VNWECDGHPDCEDGSDEHHACP-PRTCPTTQFRCDNGNCVYRGWICDGDNDCRDGSDERDCPTP 1280          

HSP 11 Score: 60.077 bits (144), Expect = 1.769e-8
Identity = 43/128 (33.59%), Postives = 62/128 (48.44%), Query Frame = 2
Query: 2219 ENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLIN-KCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCIL 2599
            E  C  NYR      C P    C+G  +C D SDE       C+P  + +C+ +   +PL+      W+CDG+NDCG+  DE  C+     C   ++ C N   IP  + CD ++DC +  DE  C L
Sbjct: 3679 EFDCRTNYR------CVPLWAVCNGHNDCRDNSDEQNCEELTCEPSGDFRCDNH-QCIPLR------WRCDGDNDCGDGSDELNCSPR--PCTESEYRCDNLHCIPDRWVCDHDNDCEDNSDERDCEL 3791          

HSP 12 Score: 59.6918 bits (143), Expect = 2.418e-8
Identity = 52/190 (27.37%), Postives = 75/190 (39.47%), Query Frame = 2
Query: 2162 NLKVECHDGIRVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNK--CDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDE--SQCNENDYKCGNIK------------------------------------------FNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            N   +C DG   +   +   +QC  +  +C N  C      CDG  +C D SDE+P+ C+   C P   KC   G  +P        WKCD ++DCG+N DE   +C    Y+C N                                            F C N + IP  ++CD ++DC +G DE+ C
Sbjct: 3569 NSNQDCPDGSD-EDTVLCATHQCESHQWQCANKRCISEAWQCDGENDCGDGSDEDPAHCSSRTCRPGQFKCR-NGRCIPNT------WKCDVDDDCGDNSDEPIEECMGPAYRCDNHTEFDCRTNYRCVPLWAVCNGHNDCRDNSDEQNCEELTCEPSGDFRCDNHQCIPLRWRCDGDNDCGDGSDELNC 3750          

HSP 13 Score: 58.9214 bits (141), Expect = 3.504e-8
Identity = 46/142 (32.39%), Postives = 60/142 (42.25%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCN--KCDPLI------NKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDE----------SQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCIL 2599
            CP     C N  C      CDG  +C D SDE   +C    CDP        N+C IY ++V           C+  +DCG+  DE            C+ ++YKCGN       G+ IP  Y CD   DC +  DE+GC  
Sbjct: 3838 CPPFLFECKNHVCVQQHWICDGDNDCGDNSDEELHLCLDISCDPPFRFRCDNNRC-IYSHEV-----------CNSIDDCGDGTDERAEHCVTPTHGPCSADEYKCGN-------GQCIPLQYACDDYDDCEDQSDELGCYF 3960          

HSP 14 Score: 57.7658 bits (138), Expect = 8.145e-8
Identity = 41/116 (35.34%), Postives = 54/116 (46.55%), Query Frame = 2
Query: 2246 RCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            RC NG C    + CD V NC D SDE  +   +C     +C   G  +P   I      CD ++DCG+  DE  C      C    F C +G+ I + + CD E DC +  DE GC
Sbjct:  125 RCANGACFNRSQRCDQVLNCRDGSDE-ANCTQRCSSGQFQCS-NGECIPRGYI------CDHDDDCGDRSDEQNCTYP--TCRGTYFTCPSGRCIHQVWLCDGEDDCEDNADEKGC 230          

HSP 15 Score: 55.4546 bits (132), Expect = 4.788e-7
Identity = 42/128 (32.81%), Postives = 58/128 (45.31%), Query Frame = 2
Query: 2231 PQNYRRCNNGECQPSGKFCDGVANCADRSDE---NPSVCN----KCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            P    RC+N +C P    CDG  +C D SDE   +P  C     +CD L        + +P +      W CD +NDC +N DE  C      C    F C++G  I   ++CD  +DC +  DE  C
Sbjct: 3717 PSGDFRCDNHQCIPLRWRCDGDNDCGDGSDELNCSPRPCTESEYRCDNL--------HCIPDR------WVCDHDNDCEDNSDERDCELR--TCHPGYFQCASGHCIAERFKCDGNADCLDFTDESSC 3828          

HSP 16 Score: 51.9878 bits (123), Expect = 4.588e-6
Identity = 38/122 (31.15%), Postives = 54/122 (44.26%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQC---NENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDE 2584
            C ++  RC+N  C P    CD   +C D SDE       C P   +C   G+ +  +      +KCDG  DC +  DES C     N   C    F C N   + + + CD ++DC +  DE
Sbjct: 3755 CTESEYRCDNLHCIPDRWVCDHDNDCEDNSDERDCELRTCHPGYFQCA-SGHCIAER------FKCDGNADCLDFTDESSCPTRYPNSTYCPPFLFECKNHVCVQQHWICDGDNDCGDNSDE 3869          

HSP 17 Score: 51.9878 bits (123), Expect = 5.664e-6
Identity = 35/112 (31.25%), Postives = 51/112 (45.54%), Query Frame = 2
Query: 2252 NNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKV-IPRAYQCDKESDCSNGEDE 2584
            ++G C P    CDG  +C D SDE+    + C P    C     +    +     W CDG+NDC +  DE  C    ++C + ++ C    V +  +  CD   DC NG DE
Sbjct: 1211 SDGSCVPVNWECDGHPDCEDGSDEH----HACPP--RTCPTTQFRCDNGNCVYRGWICDGDNDCRDGSDERDCPTPPFRCPSWQWQCPGHSVCVNLSRVCDNTPDCPNGADE 1316          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Xenopus
Match: sel1l (SEL1L adaptor subunit of ERAD E3 ubiquitin ligase [Source:Xenbase;Acc:XB-GENE-973992])

HSP 1 Score: 130.183 bits (326), Expect = 1.001e-29
Identity = 86/252 (34.13%), Postives = 119/252 (47.22%), Query Frame = 2
Query: 2225 QCPQNYRRCNNGECQPSGKFCDGVANCADRSDE-NPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNEN--DYKCGNIKFNCSNGKV-IPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILRITNFQPGDDGIYNCETLSGPNRSFS-DDYQLILDXXXXXXXXYVKKTRNSCVSNLFY 2965
            QC ++  RC NG+C P    CDG  +C D SDE +    + C+P   KC+    +  LK      W+CDG+NDCG+  DE  C        C   +F C   +  IP +YQCD E+DC +  DEVGC  PQV +  +  +   R + +    C + GVP P I WR NWG +  S R+++ T+  G   +I    I + +  D G Y CE ++     F   D  LIL           K  R  C    FY
Sbjct:  251 QCRRDEARCPNGQCIPRDYLCDGEKDCKDGSDEMHCGTPSPCEPNEFKCK--NGRCALK-----LWRCDGDNDCGDGSDELNCPTKGPSDTCAPDQFVCVQARTCIPASYQCDDEADCPDRSDEVGCNPPQVITPPEESIMASRGD-TVRFTCVAIGVPTPIITWRLNWGHIPTSSRVSM-TSENGHGTLI----IRDVKEADQGAYTCEAINAKGMVFGIPDGVLIL-----------KPHRGPCPEGSFY 478          

HSP 2 Score: 53.1434 bits (126), Expect = 3.062e-6
Identity = 88/392 (22.45%), Postives = 134/392 (34.18%), Query Frame = 2
Query:  788 LKIGGRIYRKCEMLGIKISRNEALKFAWIKDNSFEI-------ATGSILDLPIRDESVNGDYSCVIKSEKLNKKYFKELTIRIDSNIPRNP-----NQQRINIFSQPISPELNNEFKLKCEIFPPIPNANYIWKKDNN------VVSYQQTLVIPSFQRQDIGSYSCEIVSPNGDTSSSGRQISE-NVNVKFQYSSNNKIELDKFGVQMISRVGEKKEMHCEISTSSPNRGSDVEWFFNKERLDETMKQQYKILRSDRNFVSIISLTNINPKNEGLYTCRVDNSDKK--ANLIVIQEESSL---TINPERIIRNEGEPVEFHCRGNGIPDFINTKVKWSFKSRDGTVVISSLENENRWEISNSPETPETSFISISSSLYKDGGFYICTTTEG 1891
            L  GG +  +C      +S N    F W +++   I         G  L       + +G Y C  +S         E+ +   S  P  P      +QR+    Q + P   ++    C      P    +W + +N       + +   L I   Q +D G Y C        T S+   + E N  +  Q  +           Q+  + G+  E  C  +T +P     VEW      L      Q  +LR            ++ P +EG YTCRV NS  +  A + +     SL    ++PER    EG+ V  +CR  G P      + W                  R E  + P     S + I  +   D G YIC  T G
Sbjct: 1599 LSPGGEVTLRCH-----VSGNPPYYFYWTREDGRPIPPSAKAVGEGENLHFSRVQPTDSGVYICTCRSPDSVNTSKAEILV---SAAPSKPITVTVEEQRV----QTVRP--GSDVTFICTAKSKSPAYTLVWTRQHNRKLPDRAMDFNGILTIRRVQPEDAGIYVC--------TGSNMYDMDEGNATLYVQAGTATSPNAAAEPRQLTVQRGQTAEFRC-TATGTPTPA--VEWTGPNGGLSPRAVVQGGVLR----------FHSVEPSDEGQYTCRVHNSAGQHFARVDLRVHSGSLPEVQVSPERTEVREGDTVRLYCRAGGTP---AATISW------------------RKEGGSLPPQAYGSKLRILQASTADSGEYICRVTNG 1934          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Xenopus
Match: sel1l (SEL1L adaptor subunit of ERAD E3 ubiquitin ligase [Source:Xenbase;Acc:XB-GENE-973992])

HSP 1 Score: 124.02 bits (310), Expect = 7.154e-28
Identity = 84/252 (33.33%), Postives = 115/252 (45.63%), Query Frame = 2
Query: 2225 QCPQNYRRCNNGECQPSGKFCDGVANCADRSDE-NPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNEN--DYKCGNIKFNCSNGKV-IPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILRITNFQPGDDGIYNCETLSGPNRSFS-DDYQLILDXXXXXXXXYVKKTRNSCVSNLFY 2965
            QC ++  RC NG+C P    CDG  +C D SDE +    + C+P   KC+    +  LK      W+CDG+NDCG+  DE  C        C   +F C   +  IP +YQCD E+DC +  DEVGC  PQV +  +  +   R + +    C + GVP P I WR NWG +  S      ++  G   +I    I + +  D G Y CE ++     F   D  LIL           K  R  C    FY
Sbjct:  194 QCRRDEARCPNGQCIPRDYLCDGEKDCKDGSDEMHCGTPSPCEPNEFKCK--NGRCALK-----LWRCDGDNDCGDGSDELNCPTKGPSDTCAPDQFVCVQARTCIPASYQCDDEADCPDRSDEVGCNPPQVITPPEESIMASRGD-TVRFTCVAIGVPTPIITWRLNWGHIPTS------SSENGHGTLI----IRDVKEADQGAYTCEAINAKGMVFGIPDGVLIL-----------KPHRGPCPEGSFY 416          

HSP 2 Score: 54.6842 bits (130), Expect = 1.134e-6
Identity = 81/399 (20.30%), Postives = 156/399 (39.10%), Query Frame = 2
Query:  893 IATGSILDLPIRDESVNGDYSCVIKSEKLNKKYFKELTIRIDS-NIPRNPNQQRINIFSQPISPELNNEFKLKCEIFPPIPNANYIWKKDNNVVSYQQTLVIPSFQRQDIGSYSCEIVSPNGDTSS-------SGR--QISENVNVKFQYSSNNKIELDKFGVQMISRVGEKKEMHCEISTSSPNRGSDVEWFFNKERLDETMKQQYKILRSDRNFVSIISLTNINPKNEGLYTCRVDN-SDKKANLIVIQEESS--------LTINPERIIRNEGEPVEFHCRGNGIPDFINTKVKWSFKSRDGTVVI-SSLENENRWEISNSPETPETSFISISSSLYKDGGFYICTTTEG---LRRTAELVIKRREDSTLLTITPE-IVRVRNGQPVVVECFSVSE 2017
            +  G +L     + S  G Y+C + +     ++F  + +R+ S ++P       + +  +       +  +L C      P A   W+K+    +   TLVIPS    D G+Y C   S  G   +        GR   +     V+ + SS + +E            G+  E++C ++   P+  + V W     R    +   +++  S       + +   +P + G+Y CRV + S  +   + I   SS        ++I+P       G+   F CR                   DG   I ++L   + +   N   +P  S I+I  + +K+ G Y C  +     +  +  LV++ +     +++ P   +RV+ G+P+ VEC  + +
Sbjct: 1724 VVQGGVLRFHSVEPSDEGQYTCRVHNSA--GQHFARVDLRVHSGSLPE------VQVSPERTEVREGDTVRLYCRA-GGTPAATISWRKEGGKRTDISTLVIPSISAADGGTYLCVGTSSAGSAQARIEVIVIGGRSNSLGNGPAVRIETSSGSVVE------------GQTLELNCVVA-GQPD--AVVTW----HRAGRLLSPNHQVSGSR------MRILQASPADSGIYICRVSSASGSQEASVTINVHSSAQGLQSPVISIDPHSATVQRGQNATFKCR-----------------IHDGAQPIRAALTPLSLFPTDNVHISPNGSIITIVGATHKNQGSYRCMASNAYGMVHSSVNLVVQGK----CVSVIPHGKIRVKEGEPINVECMGIGD 2067          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Xenopus
Match: sel1l (SEL1L adaptor subunit of ERAD E3 ubiquitin ligase [Source:Xenbase;Acc:XB-GENE-973992])

HSP 1 Score: 122.479 bits (306), Expect = 1.711e-27
Identity = 86/252 (34.13%), Postives = 119/252 (47.22%), Query Frame = 2
Query: 2225 QCPQNYRRCNNGECQPSGKFCDGVANCADRSDE-NPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYK--CGNIKFNCSNGKV-IPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILRITNFQPGDDGIYNCETLSGPNRSFS-DDYQLILDXXXXXXXXYVKKTRNSCVSNLFY 2965
            QC ++  RC NG+C P    CDG  +C D SDE +    + C+P   KC+    +  LK      W+CDG+NDCG+  DE  C        C   +F C   +  IP +YQCD E+DC +  DEVGC  PQV +  +  +   R + +    C + GVP P I WR NWG +  S R+++ T+  G   +I    I + +  D G Y CE ++     F   D  LIL           K  R  C    FY
Sbjct:  218 QCRRDEARCPNGQCIPRDYLCDGEKDCKDGSDEMHCGTPSPCEPNEFKCK--NGRCALK-----LWRCDGDNDCGDGSDELNCPTKGPSDTCAPDQFVCVQARTCIPASYQCDDEADCPDRSDEVGCNPPQVITPPEESIMASRGD-TVRFTCVAIGVPTPIITWRLNWGHIPTSSRVSM-TSENGHGTLI----IRDVKEADQGAYTCEAINAKGMVFGIPDGVLIL-----------KPHRGPCPEGSFY 445          

HSP 2 Score: 72.0182 bits (175), Expect = 5.330e-12
Identity = 113/508 (22.24%), Postives = 178/508 (35.04%), Query Frame = 2
Query:  779 EENLKIGGRIYRKCEMLGIKISRNEALKFAWIKDN-------SFEIATGSILDLPIRDESVNGDYSCVIKSEKLNKKYFKELTIRIDSNIPRNP-----NQQRINIFSQPISPELNNEFKLKCEIFPPIPNANYIWKKDNN------VVSYQQTLVIPSFQRQDIGSYSCEIVSPNGDTSSSGRQISE-NVNVKFQYSSNNKIELDKFGVQMISRVGEKKEMHCEISTSSPNRGSDVEWFFNKERLDETMKQQYKILRSDRNFVSIISLTNINPKNEGLYTCRVDNSDKK--ANLIVIQEESSLT---INPERIIRNEGEPVEFHCRGNGIPDFINTKVKWSFKSRDGTVVISSLENENRWEISNSPETPETSFISISSSLYKDGGFYICTTTEGL----RRTAELVIKRREDSTLLTITPEIVRVRNGQPVVVECFSVSEKTGEPYGEPKFTMEYGKSLSTDPRLVEQKVGQSRVRLSIKDGLQTSDNNLKVECHDGIRVKSATIFL 2218
            +  L  GG +  +C      +S N    F W +++       +  +  G  L       + +G Y C  +S         E+ +   S  P  P      +QR+    Q + P   ++    C      P    +W + +N       + +   L I   Q +D G Y C        T S+   + E N  +  Q  +           Q+  + G+  E  C  +T +P     VEW      L      Q  +LR            ++ P +EG YTCRV NS  +  A + +     SL    ++PER    EG+ V  +CR  G P      + W    ++G     SL  + R E +      + S + I S    DGG Y+C  T        R   +VI        L I P    V  GQ V + C S +     PY    +    G+ LS +      +VG    +L I                +G   + A+I +
Sbjct: 1546 KATLSPGGEVTLRCH-----VSGNPPYYFYWTREDGRPIPPSAKAVGEGENLHFSRVQPTDSGVYICTCRSPDSVNTSKAEILV---SAAPSKPITVTVEEQRV----QTVRP--GSDVTFICTAKSKSPAYTLVWTRQHNRKLPDRAMDFNGILTIRRVQPEDAGIYVC--------TGSNMYDMDEGNATLYVQAGTATSPNAAAEPRQLTVQRGQTAEFRC-TATGTPTPA--VEWTGPNGGLSPRAVVQGGVLR----------FHSVEPSDEGQYTCRVHNSAGQHFARVDLRVHSGSLPEVQVSPERTEVREGDTVRLYCRAGGTP---AATISW---RKEG----GSLPPQARTERT------DISTLVIPSISAADGGTYLCVGTSSAGSAQARIEVIVIGAPIHGPTLRIEPSSDTVIEGQLVELNCVSAN-----PYATVTWHRGGGRPLSPN-----HQVGAYGSKLRILQASTADSGEYICRVTNGAATQQASIII 1992          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Xenopus
Match: rabggtb (Rab geranylgeranyltransferase subunit beta [Source:Xenbase;Acc:XB-GENE-953600])

HSP 1 Score: 81.2629 bits (199), Expect = 9.039e-15
Identity = 49/148 (33.11%), Postives = 70/148 (47.30%), Query Frame = 2
Query: 2171 VECHDGIRVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDE----NPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILP 2602
            V+C DG       +     C  +  RC++  C P+   CDG  +C D SDE    N      C P    C    N+ P +      W CDG+ DC + +DE Q N     C + +F C+NG  +   ++CD+ +DC +G DE GCI P
Sbjct: 2864 VDCSDGSDEPPTCVAHVRTCSSDQFRCDDARCIPASWICDGDNDCGDMSDEDQRHNYLCLQSCAPTEFTC--INNRPPERRCIPQSWVCDGDADCSDAYDEHQ-NCTRRSCSSSEFACANGLCVRSNFRCDRRNDCGDGSDERGCIYP 3008          

HSP 2 Score: 75.0998 bits (183), Expect = 5.866e-13
Identity = 42/124 (33.87%), Postives = 66/124 (53.23%), Query Frame = 2
Query: 2228 CPQNYRR-----CNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDE 2584
            CPQ Y R     CN+G C  S   C+   +C D SDE+  +C       ++C+ +  +   K      W+CD E+DCG+N DE   + +   C   +F C+NG+ IP++++CD + DC +  DE
Sbjct: 3526 CPQRYCRVGQFQCNDGNCTSSYFMCNSYPDCPDGSDEDQILCAN-----HQCDTHQWQCANKRCIPESWQCDQEDDCGDNSDEDSAHCSTRTCNPGQFRCNNGRCIPQSWKCDVDDDCGDHSDE 3644          

HSP 3 Score: 73.9442 bits (180), Expect = 1.523e-12
Identity = 43/124 (34.68%), Postives = 57/124 (45.97%), Query Frame = 2
Query: 2225 QCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQC-NENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            QC      C NG+C P    CDGV +C D SDE       C    N C              ++W+CD  NDC +  DE  C  +    C +  F C N + IPR + CD ++DC +G DE+ C
Sbjct: 1005 QCGSYSFPCANGKCVPVYDRCDGVDDCHDNSDE-----ANCGTRNNTCSSRAFTCGNGQCIPLNWRCDSHNDCVDRSDEQNCPTQGPRSCSSTSFTCQNNRCIPRIWLCDTDNDCGDGSDELNC 1123          

HSP 4 Score: 70.0922 bits (170), Expect = 1.967e-11
Identity = 47/137 (34.31%), Postives = 63/137 (45.99%), Query Frame = 2
Query: 2231 PQNYRRCNNGECQPSGKFCDGVANCADR--SDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVR 2635
            P     CNNG C      C+GV NC D   SDE       C P   KC      +P        + CDG+NDCG+  DES  +     C   +F CS+G+ IP  + CD+  DCS+G DE    +  V + +  + R
Sbjct: 2759 PNTEFTCNNGRCISRAYVCNGVNNCFDNGTSDERNCPDRTCQPGYTKCRSTNICIPRT------YLCDGDNDCGDMSDESPTHCVTLTCTESEFRCSSGRCIPGHWYCDQGVDCSDGSDEPPTCVAHVRTCSSDQFR 2889          

HSP 5 Score: 69.3218 bits (168), Expect = 3.831e-11
Identity = 50/136 (36.76%), Postives = 64/136 (47.06%), Query Frame = 2
Query: 2213 FLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMT 2620
            F    C     RC+NG C P    CDG A+C D SDE       C P    C     +    D     W CD E DC +  DE  C      C   +F CS+G+ IPRAY+CD+  DC++G DE  C+ P  T ++
Sbjct:    8 FTFAACSSGSFRCSNGRCIPLSWRCDGTADCTDNSDEA-----GCPP--RTCSTSQFRCGDGDCITSSWVCDDEEDCDDGSDEQHCPGR--TCSAQQFTCSSGQCIPRAYRCDRMKDCTDGADERNCLYPVCTELS 134          

HSP 6 Score: 63.5438 bits (153), Expect = 2.415e-9
Identity = 43/123 (34.96%), Postives = 61/123 (49.59%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLIN-KCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            C  NYR      C P    C+G  +C D SDE       CDP  + +C+ +   +PL+      WKCDG+NDC +  DE  C+    +C   +F C N + IP  + CD ++DC +  DE  C
Sbjct: 3664 CRTNYR------CVPMWSVCNGYDDCRDNSDEQGCEQRTCDPRGDFRCDNH-RCIPLR------WKCDGDNDCNDGSDERNCSPR--ECTESEFRCDNLRCIPGRWICDHDNDCEDNSDERDC 3771          

HSP 7 Score: 62.7734 bits (151), Expect = 3.842e-9
Identity = 45/139 (32.37%), Postives = 58/139 (41.73%), Query Frame = 2
Query: 2222 NQCPQNYRRCNNGECQPSGKFCDGVANCADRSDEN------PSVC---------NKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            N C      C NG+C P    CD   +C DRSDE       P  C         N+C P I                   W CD +NDCG+  DE  C+     C   +F C + + I  +Y CD + DC +G DE+GC
Sbjct: 1045 NTCSSRAFTCGNGQCIPLNWRCDSHNDCVDRSDEQNCPTQGPRSCSSTSFTCQNNRCIPRI-------------------WLCDTDNDCGDGSDELNCSNT---CEPGQFQCPDHRCIDPSYVCDGDKDCVDGSDEMGC 1161          

HSP 8 Score: 59.6918 bits (143), Expect = 3.716e-8
Identity = 43/130 (33.08%), Postives = 65/130 (50.00%), Query Frame = 2
Query: 2222 NQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCN--KCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDE--SQCNENDYKCGN-IKFNC-SNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            +QC  +  +C N  C P    CD   +C D SDE+ + C+   C+P   +C   G  +P        WKCD ++DCG++ DE   +C    Y+C N   F+C +N + +P    C+   DC +  DE GC
Sbjct: 3570 HQCDTHQWQCANKRCIPESWQCDQEDDCGDNSDEDSAHCSTRTCNPGQFRCN-NGRCIPQS------WKCDVDDDCGDHSDEPFQECMGPAYRCDNHTDFDCRTNYRCVPMWSVCNGYDDCRDNSDEQGC 3692          

HSP 9 Score: 58.5362 bits (140), Expect = 6.996e-8
Identity = 38/125 (30.40%), Postives = 58/125 (46.40%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILP 2602
            C      C++G+C P    CD + +C D +DE   +   C  L        N+           +CDG  DC ++ DES C +   +C + +F C +G+ IPR + CD + DC +  DE  C  P
Sbjct:   91 CSAQQFTCSSGQCIPRAYRCDRMKDCTDGADERNCLYPVCTELSCGSGACYNRSQ---------RCDGIVDCRDSSDESNCTQ---RCLSSQFQCPSGECIPRDFLCDHDDDCGDESDEKNCTYP 203          

HSP 10 Score: 58.151 bits (139), Expect = 9.011e-8
Identity = 43/123 (34.96%), Postives = 60/123 (48.78%), Query Frame = 2
Query: 2225 QCPQNYRRC-NNGECQPSGKFCDGVANCADRSDE-NPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKV-IPRAYQCDKESDCSNGEDE 2584
             C QN  +C ++G C PS   CDG  +C D SDE N      C P + +C+  GN +         W CDG+NDC +  DE  C    ++C + ++ C    + I  +  CD   DC NG DE
Sbjct: 1207 MCHQNEFQCQSDGACIPSNWECDGHPDCIDGSDEHNTCPVRSCPPSMFRCD-NGNCI------YRSWICDGDNDCRDMSDEKDCPTPPFRCPSWQWQCPGNTICINVSKVCDNTPDCPNGADE 1322          

HSP 11 Score: 57.3806 bits (137), Expect = 1.861e-7
Identity = 41/121 (33.88%), Postives = 57/121 (47.11%), Query Frame = 2
Query: 2246 RCNNGECQPSGKFCDGVANCADRSDENPSVC----NKCDPLIN-KCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            RCNNG C P    CD   +C D SDE    C     +CD   +  C      VP+  +      C+G +DC +N DE  C +         F C N + IP  ++CD ++DC++G DE  C
Sbjct: 3619 RCNNGRCIPQSWKCDVDDDCGDHSDEPFQECMGPAYRCDNHTDFDCRTNYRCVPMWSV------CNGYDDCRDNSDEQGCEQRTCD-PRGDFRCDNHRCIPLRWKCDGDNDCNDGSDERNC 3732          

HSP 12 Score: 53.5286 bits (127), Expect = 2.521e-6
Identity = 52/155 (33.55%), Postives = 69/155 (44.52%), Query Frame = 2
Query: 2249 CNNGECQPSGKFCDGVANCADRSDENPSVC--NKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDC-SNG-EDEVGCILPQVTSMTDAKVRRIRREGSTELRCESYGVPRPHI 2701
            C NG C P    CD   +C D SDE   VC  + C      C   G  VP       H++CD  NDCG+N DE  C        N +F C+NG+ I RAY C+  ++C  NG  DE  C              R  + G T+ R  +  +PR ++
Sbjct: 2684 CLNGRCIPERHKCDNDNDCRDGSDELERVCAFHTCPSTSFTCG-NGRCVPY------HYRCDHYNDCGDNSDELGCLFRTCD-PNTEFTCNNGRCISRAYVCNGVNNCFDNGTSDERNC------------PDRTCQPGYTKCRSTNICIPRTYL 2818          

HSP 13 Score: 52.7582 bits (125), Expect = 4.785e-6
Identity = 41/140 (29.29%), Postives = 64/140 (45.71%), Query Frame = 2
Query: 2174 ECHDGIRVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQC---NENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDE 2584
            +C+DG   ++ +     +C ++  RC+N  C P    CD   +C D SDE       C P   +C   G+ +  +      ++CDG  DC +  DE+ C     N   C    F C N   I   ++CD ++DC +G DE
Sbjct: 3722 DCNDGSDERNCS---PRECTESEFRCDNLRCIPGRWICDHDNDCEDNSDERDCEIRTCHPGYFQCNS-GHCIAER------FRCDGTADCLDVSDEAACPTRYPNGTYCPASMFECKNHVCIQPYWRCDGDNDCGDGSDE 3851          

HSP 14 Score: 52.373 bits (124), Expect = 5.569e-6
Identity = 43/166 (25.90%), Postives = 60/166 (36.14%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNEN-------DYKCGNIK-------------------------------------FNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            C   Y +CN+G C      CDG A+C D SDE  + C    P    C     +         +W+CDG+NDCG+  DE   + +        ++CGN +                                     + C N   +P  Y CD   DC +  DE GC
Sbjct: 3776 CHPGYFQCNSGHCIAERFRCDGTADCLDVSDE--AACPTRYPNGTYCPASMFECKNHVCIQPYWRCDGDNDCGDGSDEELQHLDIPCEPPFRFRCGNNRCVYRHEICNGVDDCSDGSDETEEQCRPPTPRPCTDEEYKCGNHFCVPLHYVCDDYDDCGDHSDEAGC 3939          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Xenopus
Match: rabggtb (Rab geranylgeranyltransferase subunit beta [Source:Xenbase;Acc:XB-GENE-953600])

HSP 1 Score: 80.4925 bits (197), Expect = 1.488e-14
Identity = 49/147 (33.33%), Postives = 73/147 (49.66%), Query Frame = 2
Query: 2171 VECHDGIRVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENP--SVCNK-CDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILP 2602
            V+C DG       +     C  +  RC++  C P+   CDG  +C D SDE+   +  N+ C P    C    N+ P +      W CDG+ DC + +DE Q N     C + +F C+NG  +   ++CD+ +DC +G DE GCI P
Sbjct: 2873 VDCSDGSDEPPTCVAHVRTCSSDQFRCDDARCIPASWICDGDNDCGDMSDEDQRHNCANRSCAPTEFTC--INNRPPERRCIPQSWVCDGDADCSDAYDEHQ-NCTRRSCSSSEFACANGLCVRSNFRCDRRNDCGDGSDERGCIYP 3016          

HSP 2 Score: 75.485 bits (184), Expect = 5.211e-13
Identity = 42/124 (33.87%), Postives = 66/124 (53.23%), Query Frame = 2
Query: 2228 CPQNYRR-----CNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDE 2584
            CPQ Y R     CN+G C  S   C+   +C D SDE+  +C       ++C+ +  +   K      W+CD E+DCG+N DE   + +   C   +F C+NG+ IP++++CD + DC +  DE
Sbjct: 3534 CPQRYCRVGQFQCNDGNCTSSYFMCNSYPDCPDGSDEDQILCAN-----HQCDTHQWQCANKRCIPESWQCDQEDDCGDNSDEDSAHCSTRTCNPGQFRCNNGRCIPQSWKCDVDDDCGDHSDE 3652          

HSP 3 Score: 73.9442 bits (180), Expect = 1.319e-12
Identity = 43/124 (34.68%), Postives = 57/124 (45.97%), Query Frame = 2
Query: 2225 QCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQC-NENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            QC      C NG+C P    CDGV +C D SDE       C    N C              ++W+CD  NDC +  DE  C  +    C +  F C N + IPR + CD ++DC +G DE+ C
Sbjct: 1018 QCGSYSFPCANGKCVPVYDRCDGVDDCHDNSDEA-----NCGTRNNTCSSRAFTCGNGQCIPLNWRCDSHNDCVDRSDEQNCPTQGPRSCSSTSFTCQNNRCIPRIWLCDTDNDCGDGSDELNC 1136          

HSP 4 Score: 70.4774 bits (171), Expect = 1.733e-11
Identity = 47/137 (34.31%), Postives = 63/137 (45.99%), Query Frame = 2
Query: 2231 PQNYRRCNNGECQPSGKFCDGVANCADR--SDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVR 2635
            P     CNNG C      C+GV NC D   SDE       C P   KC      +P        + CDG+NDCG+  DES  +     C   +F CS+G+ IP  + CD+  DCS+G DE    +  V + +  + R
Sbjct: 2768 PNTEFTCNNGRCISRAYVCNGVNNCFDNGTSDERNCPDRTCQPGYTKCRSTNICIPRT------YLCDGDNDCGDMSDESPTHCVTLTCTESEFRCSSGRCIPGHWYCDQGVDCSDGSDEPPTCVAHVRTCSSDQFR 2898          

HSP 5 Score: 68.5514 bits (166), Expect = 6.466e-11
Identity = 49/131 (37.40%), Postives = 63/131 (48.09%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMT 2620
            C     RC+NG C P    CDG A+C D SDE       C P    C     +    D     W CD E DC +  DE  C      C   +F CS+G+ IPRAY+CD+  DC++G DE  C+ P  T ++
Sbjct:   26 CSSGSFRCSNGRCIPLSWRCDGTADCTDNSDEA-----GCPP--RTCSTSQFRCGDGDCITSSWVCDDEEDCDDGSDEQHCPGR--TCSAQQFTCSSGQCIPRAYRCDRMKDCTDGADERNCLYPVCTELS 147          

HSP 6 Score: 64.3142 bits (155), Expect = 1.240e-9
Identity = 46/139 (33.09%), Postives = 58/139 (41.73%), Query Frame = 2
Query: 2222 NQCPQNYRRCNNGECQPSGKFCDGVANCADRSDEN------PSVC---------NKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            N C      C NG+C P    CD   +C DRSDE       P  C         N+C P I                   W CD +NDCG+  DE  CN     C   +F C + + I  +Y CD + DC +G DE+GC
Sbjct: 1058 NTCSSRAFTCGNGQCIPLNWRCDSHNDCVDRSDEQNCPTQGPRSCSSTSFTCQNNRCIPRI-------------------WLCDTDNDCGDGSDELNCNFTS-TCEPGQFQCPDHRCIDPSYVCDGDKDCVDGSDEMGC 1176          

HSP 7 Score: 63.5438 bits (153), Expect = 2.110e-9
Identity = 43/123 (34.96%), Postives = 61/123 (49.59%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLIN-KCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            C  NYR      C P    C+G  +C D SDE       CDP  + +C+ +   +PL+      WKCDG+NDC +  DE  C+  +  C   +F C N + IP  + CD ++DC +  DE  C
Sbjct: 3672 CRTNYR------CVPMWSVCNGYDDCRDNSDEQGCEQRTCDPRGDFRCDNH-RCIPLR------WKCDGDNDCNDGSDERNCSPRE--CTESEFRCDNLRCIPGRWICDHDNDCEDNSDERDC 3779          

HSP 8 Score: 59.6918 bits (143), Expect = 3.358e-8
Identity = 43/130 (33.08%), Postives = 65/130 (50.00%), Query Frame = 2
Query: 2222 NQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCN--KCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDE--SQCNENDYKCGN-IKFNC-SNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            +QC  +  +C N  C P    CD   +C D SDE+ + C+   C+P   +C   G  +P        WKCD ++DCG++ DE   +C    Y+C N   F+C +N + +P    C+   DC +  DE GC
Sbjct: 3578 HQCDTHQWQCANKRCIPESWQCDQEDDCGDNSDEDSAHCSTRTCNPGQFRCN-NGRCIPQS------WKCDVDDDCGDHSDEPFQECMGPAYRCDNHTDFDCRTNYRCVPMWSVCNGYDDCRDNSDEQGC 3700          

HSP 9 Score: 58.9214 bits (141), Expect = 6.217e-8
Identity = 38/125 (30.40%), Postives = 58/125 (46.40%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILP 2602
            C      C++G+C P    CD + +C D +DE   +   C  L        N+           +CDG  DC ++ DES C +   +C + +F C +G+ IPR + CD + DC +  DE  C  P
Sbjct:  104 CSAQQFTCSSGQCIPRAYRCDRMKDCTDGADERNCLYPVCTELSCGSGACYNRSQ---------RCDGIVDCRDSSDESNCTQ---RCLSSQFQCPSGECIPRDFLCDHDDDCGDESDEKNCTYP 216          

HSP 10 Score: 58.5362 bits (140), Expect = 8.143e-8
Identity = 43/123 (34.96%), Postives = 60/123 (48.78%), Query Frame = 2
Query: 2225 QCPQNYRRC-NNGECQPSGKFCDGVANCADRSDE-NPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKV-IPRAYQCDKESDCSNGEDE 2584
             C QN  +C ++G C PS   CDG  +C D SDE N      C P + +C+  GN +         W CDG+NDC +  DE  C    ++C + ++ C    + I  +  CD   DC NG DE
Sbjct: 1222 MCHQNEFQCQSDGACIPSNWECDGHPDCIDGSDEHNTCPVRSCPPSMFRCD-NGNCI------YRSWICDGDNDCRDMSDEKDCPTPPFRCPSWQWQCPGNTICINVSKVCDNTPDCPNGADE 1337          

HSP 11 Score: 57.3806 bits (137), Expect = 1.668e-7
Identity = 41/121 (33.88%), Postives = 57/121 (47.11%), Query Frame = 2
Query: 2246 RCNNGECQPSGKFCDGVANCADRSDENPSVC----NKCDPLIN-KCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            RCNNG C P    CD   +C D SDE    C     +CD   +  C      VP+  +      C+G +DC +N DE  C +         F C N + IP  ++CD ++DC++G DE  C
Sbjct: 3627 RCNNGRCIPQSWKCDVDDDCGDHSDEPFQECMGPAYRCDNHTDFDCRTNYRCVPMWSV------CNGYDDCRDNSDEQGCEQRTCD-PRGDFRCDNHRCIPLRWKCDGDNDCNDGSDERNC 3740          

HSP 12 Score: 53.5286 bits (127), Expect = 2.240e-6
Identity = 52/155 (33.55%), Postives = 69/155 (44.52%), Query Frame = 2
Query: 2249 CNNGECQPSGKFCDGVANCADRSDENPSVC--NKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDC-SNG-EDEVGCILPQVTSMTDAKVRRIRREGSTELRCESYGVPRPHI 2701
            C NG C P    CD   +C D SDE   VC  + C      C   G  VP       H++CD  NDCG+N DE  C        N +F C+NG+ I RAY C+  ++C  NG  DE  C              R  + G T+ R  +  +PR ++
Sbjct: 2693 CLNGRCIPERHKCDNDNDCRDGSDELERVCAFHTCPSTSFTCG-NGRCVPY------HYRCDHYNDCGDNSDELGCLFRTCD-PNTEFTCNNGRCISRAYVCNGVNNCFDNGTSDERNC------------PDRTCQPGYTKCRSTNICIPRTYL 2827          

HSP 13 Score: 52.7582 bits (125), Expect = 3.778e-6
Identity = 44/167 (26.35%), Postives = 60/167 (35.93%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNEND--------YKCGNIK-------------------------------------FNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            C   Y +CN+G C      CDG A+C D SDE  + C    P    C     +         +W+CDG+NDCG+  DE   +  D        ++CGN +                                     + C N   +P  Y CD   DC +  DE GC
Sbjct: 3784 CHPGYFQCNSGHCIAERFRCDGTADCLDVSDE--AACPTRYPNGTYCPASMFECKNHVCIQPYWRCDGDNDCGDGSDEELQHCLDIPCEPPFRFRCGNNRCVYRHEICNGVDDCSDGSDETEEQCEPPTPRPCTDEEYKCGNHFCVPLHYVCDDYDDCGDHSDEAGC 3948          

HSP 14 Score: 52.7582 bits (125), Expect = 4.398e-6
Identity = 41/140 (29.29%), Postives = 64/140 (45.71%), Query Frame = 2
Query: 2174 ECHDGIRVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQC---NENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDE 2584
            +C+DG   ++ +     +C ++  RC+N  C P    CD   +C D SDE       C P   +C   G+ +  +      ++CDG  DC +  DE+ C     N   C    F C N   I   ++CD ++DC +G DE
Sbjct: 3730 DCNDGSDERNCS---PRECTESEFRCDNLRCIPGRWICDHDNDCEDNSDERDCEIRTCHPGYFQCNS-GHCIAER------FRCDGTADCLDVSDEAACPTRYPNGTYCPASMFECKNHVCIQPYWRCDGDNDCGDGSDE 3859          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Mouse
Match: Hspg2 (perlecan (heparan sulfate proteoglycan 2) [Source:MGI Symbol;Acc:MGI:96257])

HSP 1 Score: 114.005 bits (284), Expect = 7.141e-25
Identity = 73/218 (33.49%), Postives = 103/218 (47.25%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDE-NPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCN--ENDYKCGNIKFNC-SNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILRITNFQPGDDGIYNCETLSGPNRSF 2869
            C      C++G C P    CDG  +C D SDE   +    C+P    CE     + L       W+CDG+ DC +  DE+ C+  +    CG   F C S  + IP ++ CD+ESDC +  DE GC+ PQV +     ++  R +  T   C + GVP P I WR NWG +    R+T+  T EG       L I + +  D G Y CE ++     F
Sbjct:  285 CGPQEASCHSGHCIPRDYLCDGQEDCRDGSDELGCASPPPCEPNEFACENGHCALKL-------WRCDGDFDCEDRTDEANCSVKQPGEVCGPTHFQCVSTNRCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPQQSIQASRGQTVT-FTCVATGVPTPIINWRLNWGHIPAHPRVTM--TSEGGR---GTLIIRDVKEADQGAYTCEAMNSRGMVF 489          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Mouse
Match: Hspg2 (perlecan (heparan sulfate proteoglycan 2) [Source:MGI Symbol;Acc:MGI:96257])

HSP 1 Score: 114.005 bits (284), Expect = 7.143e-25
Identity = 73/218 (33.49%), Postives = 103/218 (47.25%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDE-NPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCN--ENDYKCGNIKFNC-SNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILRITNFQPGDDGIYNCETLSGPNRSF 2869
            C      C++G C P    CDG  +C D SDE   +    C+P    CE     + L       W+CDG+ DC +  DE+ C+  +    CG   F C S  + IP ++ CD+ESDC +  DE GC+ PQV +     ++  R +  T   C + GVP P I WR NWG +    R+T+  T EG       L I + +  D G Y CE ++     F
Sbjct:  285 CGPQEASCHSGHCIPRDYLCDGQEDCRDGSDELGCASPPPCEPNEFACENGHCALKL-------WRCDGDFDCEDRTDEANCSVKQPGEVCGPTHFQCVSTNRCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPQQSIQASRGQTVT-FTCVATGVPTPIINWRLNWGHIPAHPRVTM--TSEGGR---GTLIIRDVKEADQGAYTCEAMNSRGMVF 489          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Mouse
Match: Sorl1 (sortilin-related receptor, LDLR class A repeats-containing [Source:MGI Symbol;Acc:MGI:1202296])

HSP 1 Score: 83.1889 bits (204), Expect = 1.742e-15
Identity = 54/146 (36.99%), Postives = 79/146 (54.11%), Query Frame = 2
Query: 2162 NLKVECHDGIRVKSAT-IFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLIN-KCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            +L  +C  G + K+ T +  EN C +N  RC+NG C  S  +CD   +C D SDE       CD     +C+  G  +PL       +KCD E+DCG+N DES C    ++C + +FNCS+G  I  ++ CD ++DC +  DE  C
Sbjct: 1055 DLMCDCPQGYQRKNNTCVKEENTCLRNQYRCSNGNCINSIWWCDFDNDCGDMSDERNCPTTVCDADTQFRCQESGTCIPLS------YKCDLEDDCGDNSDESHCEM--HQCRSDEFNCSSGMCIRSSWVCDGDNDCRDWSDEANC 1192          

HSP 2 Score: 73.559 bits (179), Expect = 1.272e-12
Identity = 47/131 (35.88%), Postives = 70/131 (53.44%), Query Frame = 2
Query: 2252 NNGECQPSGKFCDGVANCADRSDENPSV--CNKCDPLINK-CEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGN----IKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC----ILPQVT 2611
            N  +C      CDG+  C D SDE+ +   C++ DP  +K C+ +G +        + WKCDG +DCG+  DE+ C EN  +  N     +F+C NG  IP  ++CD+E+DC +  DE  C    +LP  T
Sbjct: 1285 NRQQCLFHSMVCDGIVQCRDGSDEDAAFAGCSQ-DPEFHKECDEFGFQCQNGVCISLIWKCDGMDDCGDYSDEANC-ENPTEAPNCSRYFQFHCENGHCIPNRWKCDRENDCGDWSDEKDCGDSHVLPSPT 1413          

HSP 3 Score: 60.077 bits (144), Expect = 1.873e-8
Identity = 56/211 (26.54%), Postives = 89/211 (42.18%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDEN--PSVCN-----------KCDPLINKCEIYGNKVPLKDIFLIHWK-CDGENDCGNNFDESQC-NENDYKCGNIKFNCSNGKV-IPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGS-----TELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILR 2797
            C  NY  C++G C      CDG  +CAD SDE   PS+ N           +CD    +C      +P       +WK CDG  DC +  DE+ C   +   C + +F C +G+  I  + +CD   DCS+  DE  C       +T  KV+ ++         T        +P    V+   +  + +S+  T+ T     + V+ +L+
Sbjct: 1419 CLPNYFHCSSGACVMGTWVCDGYRDCADGSDEEACPSLANSTAASTPTQFGQCDRFEFECHQPKKCIP-------NWKRCDGHQDCQDGQDEANCPTHSTLTCTSREFKCEDGEACIVLSERCDGFLDCSDESDEKAC----SDELTVYKVQNLQWTADFSGDVTLTWMRPKKMPSASCVYNVYYRVVGESIWKTLETHSNKTSTVLKVLK 1618          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Mouse
Match: Vldlr (very low density lipoprotein receptor [Source:MGI Symbol;Acc:MGI:98935])

HSP 1 Score: 78.5666 bits (192), Expect = 2.667e-14
Identity = 48/143 (33.57%), Postives = 72/143 (50.35%), Query Frame = 2
Query: 2174 ECHDGIRVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILP 2602
            +C DG   K+    ++  C ++   C NG+C P+   CDG  +C D SDE+P  C+     IN+               + W+CDGENDC N  DE  C   +  C   +F CS+G+ + R + C+ + DC +G DE+ C  P
Sbjct:   57 DCADGSDEKNC---VKKTCAESDFVCKNGQCVPNRWQCDGDPDCEDGSDESPEQCHMRTCRINEISCGARST---QCIPVSWRCDGENDCDNGEDEENCG--NITCSADEFTCSSGRCVSRNFVCNGQDDCDDGSDELDCAPP 191          

HSP 2 Score: 62.003 bits (149), Expect = 4.072e-9
Identity = 45/125 (36.00%), Postives = 62/125 (49.60%), Query Frame = 2
Query: 2225 QCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDES--QCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            +C  +  +C NG C      CDG  +CAD SDE   V   C      C+  G  VP +      W+CDG+ DC +  DES  QC+    +   I     + + IP +++CD E+DC NGEDE  C
Sbjct:   32 KCDSSQFQCTNGRCITLLWKCDGDEDCADGSDEKNCVKKTCAESDFVCK-NGQCVPNR------WQCDGDPDCEDGSDESPEQCHMRTCRINEISCGARSTQCIPVSWRCDGENDCDNGEDEENC 149          

HSP 3 Score: 61.2326 bits (147), Expect = 7.266e-9
Identity = 38/122 (31.15%), Postives = 57/122 (46.72%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            C  +  +C+   C P    CD  A+C+D+SDE+   C +   +  KC     +    +     W+CDG+ DC +  DE  C      C   +F C +G  I  + QC+   DC +G DEV C
Sbjct:  193 CGAHEFQCSTSSCIPLSWVCDDDADCSDQSDESLEQCGRQPVIHTKCPTSEIQCGSGECIHKKWRCDGDPDCKDGSDEVNCPSR--TCRPDQFECEDGSCIHGSRQCNGIRDCVDGSDEVNC 312          

HSP 4 Score: 54.6842 bits (130), Expect = 6.123e-7
Identity = 40/128 (31.25%), Postives = 59/128 (46.09%), Query Frame = 2
Query: 2213 FLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCE----IYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDE 2584
             +  +CP +  +C +GEC      CDG  +C D SDE       C P   +CE    I+G++           +C+G  DC +  DE  C   +   G  KF C +G+ I  +  CD+E DC +  DE
Sbjct:  234 VIHTKCPTSEIQCGSGECIHKKWRCDGDPDCKDGSDEVNCPSRTCRPDQFECEDGSCIHGSR-----------QCNGIRDCVDGSDEVNCKNVNQCLGPGKFKCRSGECIDMSKVCDQEQDCRDWSDE 350          

HSP 5 Score: 53.5286 bits (127), Expect = 1.656e-6
Identity = 38/127 (29.92%), Postives = 56/127 (44.09%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDES--QCNEN---DYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            C  +   C++G C      C+G  +C D SDE       C P    C  +  +        + W CD + DC +  DES  QC        KC   +  C +G+ I + ++CD + DC +G DEV C
Sbjct:  154 CSADEFTCSSGRCVSRNFVCNGQDDCDDGSDEL-----DCAP--PTCGAHEFQCSTSSCIPLSWVCDDDADCSDQSDESLEQCGRQPVIHTKCPTSEIQCGSGECIHKKWRCDGDPDCKDGSDEVNC 273          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Mouse
Match: Vldlr (very low density lipoprotein receptor [Source:MGI Symbol;Acc:MGI:98935])

HSP 1 Score: 78.1814 bits (191), Expect = 3.436e-14
Identity = 48/143 (33.57%), Postives = 72/143 (50.35%), Query Frame = 2
Query: 2174 ECHDGIRVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILP 2602
            +C DG   K+    ++  C ++   C NG+C P+   CDG  +C D SDE+P  C+     IN+               + W+CDGENDC N  DE  C   +  C   +F CS+G+ + R + C+ + DC +G DE+ C  P
Sbjct:   57 DCADGSDEKNC---VKKTCAESDFVCKNGQCVPNRWQCDGDPDCEDGSDESPEQCHMRTCRINEISCGARST---QCIPVSWRCDGENDCDNGEDEENCG--NITCSADEFTCSSGRCVSRNFVCNGQDDCDDGSDELDCAPP 191          

HSP 2 Score: 61.6178 bits (148), Expect = 5.189e-9
Identity = 45/125 (36.00%), Postives = 62/125 (49.60%), Query Frame = 2
Query: 2225 QCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDES--QCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            +C  +  +C NG C      CDG  +CAD SDE   V   C      C+  G  VP +      W+CDG+ DC +  DES  QC+    +   I     + + IP +++CD E+DC NGEDE  C
Sbjct:   32 KCDSSQFQCTNGRCITLLWKCDGDEDCADGSDEKNCVKKTCAESDFVCK-NGQCVPNR------WQCDGDPDCEDGSDESPEQCHMRTCRINEISCGARSTQCIPVSWRCDGENDCDNGEDEENC 149          

HSP 3 Score: 60.8474 bits (146), Expect = 9.027e-9
Identity = 38/122 (31.15%), Postives = 57/122 (46.72%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            C  +  +C+   C P    CD  A+C+D+SDE+   C +   +  KC     +    +     W+CDG+ DC +  DE  C      C   +F C +G  I  + QC+   DC +G DEV C
Sbjct:  193 CGAHEFQCSTSSCIPLSWVCDDDADCSDQSDESLEQCGRQPVIHTKCPTSEIQCGSGECIHKKWRCDGDPDCKDGSDEVNCPSR--TCRPDQFECEDGSCIHGSRQCNGIRDCVDGSDEVNC 312          

HSP 4 Score: 54.299 bits (129), Expect = 7.493e-7
Identity = 40/128 (31.25%), Postives = 59/128 (46.09%), Query Frame = 2
Query: 2213 FLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCE----IYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDE 2584
             +  +CP +  +C +GEC      CDG  +C D SDE       C P   +CE    I+G++           +C+G  DC +  DE  C   +   G  KF C +G+ I  +  CD+E DC +  DE
Sbjct:  234 VIHTKCPTSEIQCGSGECIHKKWRCDGDPDCKDGSDEVNCPSRTCRPDQFECEDGSCIHGSR-----------QCNGIRDCVDGSDEVNCKNVNQCLGPGKFKCRSGECIDMSKVCDQEQDCRDWSDE 350          

HSP 5 Score: 53.1434 bits (126), Expect = 2.134e-6
Identity = 38/127 (29.92%), Postives = 56/127 (44.09%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDES--QCNEN---DYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            C  +   C++G C      C+G  +C D SDE       C P    C  +  +        + W CD + DC +  DES  QC        KC   +  C +G+ I + ++CD + DC +G DEV C
Sbjct:  154 CSADEFTCSSGRCVSRNFVCNGQDDCDDGSDEL-----DCAPPT--CGAHEFQCSTSSCIPLSWVCDDDADCSDQSDESLEQCGRQPVIHTKCPTSEIQCGSGECIHKKWRCDGDPDCKDGSDEVNC 273          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. UniProt/SwissProt
Match: sp|P98160|PGBM_HUMAN (Basement membrane-specific heparan sulfate proteoglycan core protein OS=Homo sapiens OX=9606 GN=HSPG2 PE=1 SV=4)

HSP 1 Score: 114.775 bits (286), Expect = 2.451e-24
Identity = 76/219 (34.70%), Postives = 102/219 (46.58%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKD--IFLIHWKCDGENDCGNNFDESQC--NENDYKCGNIKFNC-SNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILRITNFQPGDDGIYNCETLSGPNRSF 2869
            C      C NG C P    CDG  +C D SDE    C    P    CE   N+ P  +    L  W+CDG+ DC +  DE+ C     +  CG  +F C S    IP ++ CD+ESDC +  DE GC+ PQV +     ++  R +  T   C + GVP P I WR NWG +    R+T+  T EG       L I + +  D G Y CE ++     F
Sbjct:  285 CGPQEAACRNGHCIPRDYLCDGQEDCEDGSDELD--CGPPPP----CE--PNEFPCGNGHCALKLWRCDGDFDCEDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPRESIQASRGQTVT-FTCVAIGVPTPIINWRLNWGHIPSHPRVTV--TSEGGR---GTLIIRDVKESDQGAYTCEAMNARGMVF 489          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. UniProt/SwissProt
Match: sp|Q05793|PGBM_MOUSE (Basement membrane-specific heparan sulfate proteoglycan core protein OS=Mus musculus OX=10090 GN=Hspg2 PE=1 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 8.331e-24
Identity = 73/218 (33.49%), Postives = 103/218 (47.25%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDE-NPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCN--ENDYKCGNIKFNC-SNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILRITNFQPGDDGIYNCETLSGPNRSF 2869
            C      C++G C P    CDG  +C D SDE   +    C+P    CE     + L       W+CDG+ DC +  DE+ C+  +    CG   F C S  + IP ++ CD+ESDC +  DE GC+ PQV +     ++  R +  T   C + GVP P I WR NWG +    R+T+  T EG       L I + +  D G Y CE ++     F
Sbjct:  285 CGPQEASCHSGHCIPRDYLCDGQEDCRDGSDELGCASPPPCEPNEFACENGHCALKL-------WRCDGDFDCEDRTDEANCSVKQPGEVCGPTHFQCVSTNRCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPQQSIQASRGQTVT-FTCVATGVPTPIINWRLNWGHIPAHPRVTM--TSEGGR---GTLIIRDVKEADQGAYTCEAMNSRGMVF 489          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. UniProt/SwissProt
Match: sp|Q06561|UNC52_CAEEL (Basement membrane proteoglycan OS=Caenorhabditis elegans OX=6239 GN=unc-52 PE=1 SV=2)

HSP 1 Score: 100.523 bits (249), Expect = 5.972e-20
Identity = 95/326 (29.14%), Postives = 148/326 (45.40%), Query Frame = 2
Query: 1943 LTITPEIVRVRNGQPVVVECFSVSE-----------KTGEPYGEPKFTMEYGKSLSTDPRLVEQKVGQSRVRLSIKDGLQTSDNNLKVECHDGIRVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDEN--PSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNE--NDYKCGNIKFNCSNGK-VIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILRITNFQPGDDGIYNCETLSGPNRSFS 2872
            +T+ P    VR+G+ V  EC + +            + G P   P    + G  L+ +P  V+     + + +S  +G              G +  S  +    QC  + + C N EC  +   CDG  +C DRSDE   P++   C+P   KC    NK   K      W CDG++DCG+N DE  CN   +   C   +F C + +  +P ++ CD  +DC +G DEVGC+ P V       + ++ R  +  L C++  VP P+I WR NWG + +  R  ++T+  G       L I + QP D G Y CE ++   R  +
Sbjct:   47 ITVFPSEKEVRDGRDVSFECRARTSDNSVYPTVRWARVGGPL--PSSAHDSGGRLTINP--VQLSDAGTYICVSDYNGNTVEARATLSVVSYGPQEVSNGLRQAGQCMADEKACGNNECVKNDYVCDGEPDCRDRSDEANCPAISRTCEPNEFKCN--NNKCVQK-----MWLCDGDDDCGDNSDELNCNAKPSSSDCKPTEFQCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQTNL-QVPRGTTFSLTCKAVAVPEPYINWRLNWGPVCEPPRC-LQTSEGG----YGTLTIHDAQPVDQGAYTCEAINVKGRVLA 355          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. UniProt/SwissProt
Match: sp|Q92673|SORL_HUMAN (Sortilin-related receptor OS=Homo sapiens OX=9606 GN=SORL1 PE=1 SV=2)

HSP 1 Score: 83.1889 bits (204), Expect = 1.011e-14
Identity = 53/146 (36.30%), Postives = 80/146 (54.79%), Query Frame = 2
Query: 2162 NLKVECHDGIRVKSAT-IFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLIN-KCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            +L  +C  G ++K+ T +  EN C +N  RC+NG C  S  +CD   +C D SDE       CD     +C+  G  +PL       +KCD E+DCG+N DES C    ++C + ++NCS+G  I  ++ CD ++DC +  DE  C
Sbjct: 1055 DLMCDCPQGYQLKNNTCVKQENTCLRNQYRCSNGNCINSIWWCDFDNDCGDMSDERNCPTTICDLDTQFRCQESGTCIPLS------YKCDLEDDCGDNSDESHCEM--HQCRSDEYNCSSGMCIRSSWVCDGDNDCRDWSDEANC 1192          

HSP 2 Score: 72.7886 bits (177), Expect = 1.706e-11
Identity = 48/131 (36.64%), Postives = 69/131 (52.67%), Query Frame = 2
Query: 2252 NNGECQPSGKFCDGVANCADRSDENPSV--CNKCDPLINK-CEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGN----IKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC----ILPQVT 2611
            N  +C      CDG+  C D SDE+ +   C++ DP  +K C+ +G +        + WKCDG +DCG+  DE+ C EN  +  N     +F C NG  IP  ++CD+E+DC +  DE  C    ILP  T
Sbjct: 1285 NRQQCLFHSMVCDGIIQCRDGSDEDAAFAGCSQ-DPEFHKVCDEFGFQCQNGVCISLIWKCDGMDDCGDYSDEANC-ENPTEAPNCSRYFQFRCENGHCIPNRWKCDRENDCGDWSDEKDCGDSHILPFST 1413          

HSP 3 Score: 63.929 bits (154), Expect = 8.541e-9
Identity = 56/211 (26.54%), Postives = 88/211 (41.71%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDE-------------NPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWK-CDGENDCGNNFDESQC-NENDYKCGNIKFNCSNGKV-IPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGS-----TELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILR 2797
            C  NY RC++G C      CDG  +CAD SDE              P+   +CD    +C      +P       +WK CDG  DC +  DE+ C   +   C + +F C +G+  I  + +CD   DCS+  DE  C       +T  KV+ ++         T        +P    V+   +  + +S+  T+ T     N V+ +L+
Sbjct: 1419 CLPNYYRCSSGTCVMDTWVCDGYRDCADGSDEEACPLLANVTAASTPTQLGRCDRFEFECHQPKTCIP-------NWKRCDGHQDCQDGRDEANCPTHSTLTCMSREFQCEDGEACIVLSERCDGFLDCSDESDEKAC----SDELTVYKVQNLQWTADFSGDVTLTWMRPKKMPSASCVYNVYYRVVGESIWKTLETHSNKTNTVLKVLK 1618          

HSP 4 Score: 63.1586 bits (152), Expect = 1.531e-8
Identity = 46/140 (32.86%), Postives = 66/140 (47.14%), Query Frame = 2
Query: 2246 RCNNGECQPSGKFCDGVANCADRSDE----NPSVCNKCDPLIN-KCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDY---------KCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC-ILPQVTSMT 2620
            +C NG C      CDG+ +C D SDE    NP+    C      +CE  G+ +P +      WKCD ENDCG+  DE  C ++            C    + CS+G  +   + CD   DC++G DE  C +L  VT+ +
Sbjct: 1331 QCQNGVCISLIWKCDGMDDCGDYSDEANCENPTEAPNCSRYFQFRCE-NGHCIPNR------WKCDRENDCGDWSDEKDCGDSHILPFSTPGPSTCLPNYYRCSSGTCVMDTWVCDGYRDCADGSDEEACPLLANVTAAS 1463          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. UniProt/SwissProt
Match: sp|O88307|SORL_MOUSE (Sortilin-related receptor OS=Mus musculus OX=10090 GN=Sorl1 PE=1 SV=3)

HSP 1 Score: 83.1889 bits (204), Expect = 1.218e-14
Identity = 54/146 (36.99%), Postives = 79/146 (54.11%), Query Frame = 2
Query: 2162 NLKVECHDGIRVKSAT-IFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLIN-KCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            +L  +C  G + K+ T +  EN C +N  RC+NG C  S  +CD   +C D SDE       CD     +C+  G  +PL       +KCD E+DCG+N DES C    ++C + +FNCS+G  I  ++ CD ++DC +  DE  C
Sbjct: 1055 DLMCDCPQGYQRKNNTCVKEENTCLRNQYRCSNGNCINSIWWCDFDNDCGDMSDERNCPTTVCDADTQFRCQESGTCIPLS------YKCDLEDDCGDNSDESHCEM--HQCRSDEFNCSSGMCIRSSWVCDGDNDCRDWSDEANC 1192          

HSP 2 Score: 73.559 bits (179), Expect = 8.895e-12
Identity = 47/131 (35.88%), Postives = 70/131 (53.44%), Query Frame = 2
Query: 2252 NNGECQPSGKFCDGVANCADRSDENPSV--CNKCDPLINK-CEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGN----IKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC----ILPQVT 2611
            N  +C      CDG+  C D SDE+ +   C++ DP  +K C+ +G +        + WKCDG +DCG+  DE+ C EN  +  N     +F+C NG  IP  ++CD+E+DC +  DE  C    +LP  T
Sbjct: 1285 NRQQCLFHSMVCDGIVQCRDGSDEDAAFAGCSQ-DPEFHKECDEFGFQCQNGVCISLIWKCDGMDDCGDYSDEANC-ENPTEAPNCSRYFQFHCENGHCIPNRWKCDRENDCGDWSDEKDCGDSHVLPSPT 1413          

HSP 3 Score: 60.077 bits (144), Expect = 1.310e-7
Identity = 56/211 (26.54%), Postives = 89/211 (42.18%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDEN--PSVCN-----------KCDPLINKCEIYGNKVPLKDIFLIHWK-CDGENDCGNNFDESQC-NENDYKCGNIKFNCSNGKV-IPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGS-----TELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILR 2797
            C  NY  C++G C      CDG  +CAD SDE   PS+ N           +CD    +C      +P       +WK CDG  DC +  DE+ C   +   C + +F C +G+  I  + +CD   DCS+  DE  C       +T  KV+ ++         T        +P    V+   +  + +S+  T+ T     + V+ +L+
Sbjct: 1419 CLPNYFHCSSGACVMGTWVCDGYRDCADGSDEEACPSLANSTAASTPTQFGQCDRFEFECHQPKKCIP-------NWKRCDGHQDCQDGQDEANCPTHSTLTCTSREFKCEDGEACIVLSERCDGFLDCSDESDEKAC----SDELTVYKVQNLQWTADFSGDVTLTWMRPKKMPSASCVYNVYYRVVGESIWKTLETHSNKTSTVLKVLK 1618          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. TrEMBL
Match: T1DBM0 (LDL-1 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 560.451 bits (1443), Expect = 0.000e+0
Identity = 304/814 (37.35%), Postives = 469/814 (57.62%), Query Frame = 2
Query:  473 DPPIISFKNINEGSIDVQETDFLYTVCEVSNWQQSEYTSSWWFNQAPINGANKILFVSSLDADKNAGYYTCRINH-KLYSQKTYEKQLLVNIKKPEISIISFPEENLKIGGRIYRKC-EMLGIKISRNEALKFAWIKDNSFEIATGSILDLPIRDESVNGDYSCVIKSEKLNKKYFKELTIRIDSNIPRNPNQQRINIFSQPISPELNNEFKLKCEIFPPIPNANYIWKKDNNVVSYQQTLVIPSFQRQDIGSYSCEIVSP--NGDTSSSGRQISENVNVKFQYSSNNKIELDKF-GVQMISRVGEKKEMHCEISTSSPNRGSDVEWFFNKERLDETMKQQYK-ILRSDRNFVSIISLTNINPKNEGLYTCRVDNSDKKANLIVIQEESSLTINPERIIRNEGEPVEFHCRGNGIPDFINTKVKWSFKSRDGTVVISSLENENRWEISNSPETPETSFISISSSLYKDGGFYICTTTEGLRRTAELVIKRREDSTLLTITPEIVRVRNGQPVVVECFSVSEKTGEPYGEPKFTMEYGKSLSTDPRLVEQKVGQSRVRLSIKDGLQTSDNNLKVECHDGIRVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYK-CGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILRITNFQPGDDGIYNCETLSGPNRSFSDDYQLIL 2893
            D  +I+F N+   SI   E ++LY +C V+N + + +T+ W      +   NKIL+  SL   +  G Y C +    + S KT++    +NI  P ISI   P+E+L+IGG+I R C +   + +S  + L   W+ + +  ++  + L +PI+DESV+G Y C +KS   +K Y  +  + +   +       +I I + P +      F L C++ P      Y W KDN  +S  +T+ IPSF++++IG Y C  +    NG+  +   +  + + + F++S   K+ELD+  G  +I   GEKKE+HCEI   +  RG +VEW+ N        +  ++ I R D+  VS++ + NI  +NEG Y CR  +  K+ N++V+ E+  +  NP  +   EG+ VEFHCR +   +  N  +KW F+S+DG+V    + N+ RWE +N   T ETSF+ ++S++  D G+ ICT   G    +EL++   E   ++TITP+ +RVR  Q   +ECF+ + + G   G+PKF     K++  D R VE  VGQS +RLS  +GL  S++N+ V C  G +  S+ I++++ CP  +R C NG+C  + KFCDG  +C D+SDE+P++C  CDP+  KCE++   +P K+ +L+HW CDGE DCGN +DE  C E   + CG   F CS+GK IPR Y CD+ +DC NG+DE  C  P +   +  +++  R +  T + CE+ G P P IVWR+NWGC+    R ++R+    C  V S L I NFQPGDDGIYNCE LS   R+FSDD+Q++L
Sbjct:   34 DEAVINF-NMKNDSIVKSEMEYLYVLCNVTNLKPNTFTARWLDKNGVVVSPNKILYFKSLLKHRE-GIYKCEVEKDSVKSNKTFQ----LNITIPSISINVLPDESLQIGGQISRNCSDFKSMNLSITDTLSHEWVDEKNKTVSNSNFLVIPIKDESVSGTYECRLKSFATSKVYTAKTMVNVQRKVV--SANYKIQISTTPGTITFAKMFTLNCDVTPS-NGIQYRWLKDNIEISTNKTIYIPSFKKENIGVYKCIAIVKLENGNNLTLEAESLQQLTL-FRHS---KVELDETPGYTIIVHSGEKKELHCEIEVEAKKRGVEVEWYINNTLF---RRGDFRNIGRLDKELVSMLVIRNIVAQNEGKYECRYADKRKEINIVVLTEQGIIQTNPPLLRVKEGQSVEFHCRVDNFANVKNVDLKWKFRSKDGSVTYD-IPND-RWETTNPDITEETSFLELNSAVMADNGYLICTEPNGQSAQSELIVTAGE-GNVITITPKEIRVRPHQRFDIECFTKT-REGRASGQPKFFFSNNKAVGRDARFVETTVGQSHIRLSAPNGLPLSEDNMDVFCGSGDQRVSSKIYIKDTCPPGHRYCQNGQCLENAKFCDGKVDCEDKSDEDPNLCKACDPISKKCEVHRGIIPTKNYYLVHWACDGEEDCGNGYDEENCGEGYLENCGGKFFKCSDGKNIPRGYLCDQNADCDNGDDENLCTYPTIIKTSTKEIKAARTQQVT-MTCEASGKPLPAIVWRFNWGCIQQLPRFSVRSYSSNCTTVSSTLTINNFQPGDDGIYNCEALSSRQRAFSDDFQVVL 826          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. TrEMBL
Match: A0A1Z1R275 (Low density lipoprotein receptor-related 1 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 553.903 bits (1426), Expect = 3.123e-180
Identity = 315/824 (38.23%), Postives = 454/824 (55.10%), Query Frame = 2
Query:  437 SDSEETTPPIFVDPPIISFKNINEGSIDVQETDFLYTVCEVSNWQQSEYTSSWWFNQAPINGANKILFVSSLDADKNAGYYTCRINHKLYSQKTYEKQLLVNIKKPEISIISFPEENLKIGGRIYRKCEMLGI-KISRNEALKFAWIKDNSFEIATGSILDLPIRDESVNGDYSCVIKSEKLNKKYFKELTIRIDSNIPRNPNQQRINIFSQPISPELNNEFKLKCEIFPPIPNANYIWKKDNNVVSYQQTLVIPSFQRQDIGSYSC--EIVSPNGDTSSSGRQISENVNVKFQYSSNNKIELD-KFGVQMISRVGEKKEMHCEISTSSPNRGSDVEWFFNKERLDETMKQQYKILRSDRNFVSIISLTNINPKNEGLYTCRVDNSDKKANLIVIQEESSLTINPERIIRNEGEPVEFHCRGNGIPDFINTKVKWSFKSRDGTVVISSLENENRWEISNSPETPETSFISISSSLYKDGGFYICTTTEGLRRTAELVIKRREDSTLLTITPEIVRVRNGQPVVVECFSVSEKTGEPYGEPKFTMEYGKSLSTDPRLVEQKVGQSRVRLSIKDGLQTSDNNLKVECHDGIRVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDY-KCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILRITNFQPGDDGIYNCETLSGPNRSFSDDYQLIL 2893
            S+ EET+PP       I+F  +   SI   E  F+   C V+N+  +E +  W      +  AN+ L++ SL   ++ G Y C +      Q  + + L + I  P ISI   PEE+LKIGG+I R+C  LG+ + +  +   + W+   +  I   +IL +P+ DESV G Y C  KS++ +K Y     + +  ++       +I I + P        F L+CE+ P   N  Y W K +  +   Q LVI SF++ ++G+Y C   +  P+G        I +     F +   +KIEL  K G Q+    GEKKE+HCEI TSS NRG + EW+ N ++          + R D  +VS++ +++I+  NEG Y CRV +S K+ NLIV+ +E  +  +P  +   EG+ VEFHCR   IP   N  +KW+F+S++G  ++ +   ++RW++ N     +TSFI +  +   D G+YICT   G    +EL++   +D   LTITP  +RVR GQ V +ECFS + + G   G P+F+    K +  D R     VG +  RL+   GL  SDNN+ V C    R  S+ I++ + CP  YR C NGEC  + KFCD + +CAD+SDE+P  C +CDP+  KCEI    +P K+ FLIHW CDGE DCGN +DE  C+      CG   F CS+ K IPR Y CD+  DCS GEDE GC  PQ+T  +  KV   + +  T L CE+ G P P +VWR+NWGC+ +S R +       CN V S L I +F+ GDDGIYNCE LS   RSFS+D+Q+IL
Sbjct:   20 SEEEETSPPN------ITFFPLKNDSIVKSEMQFINIACNVTNYALNETSIRWLDKDGKVAAANRYLYIKSL-LKQDEGIYNCSVEKVKDPQIRFNRTLHLKITIPSISIDILPEESLKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSV-----SYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQ-----FAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNG--DIPLVNRLDGQYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEG--LVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQ-GRASGNPEFSFTNNKPIGRDGRFKISNVGPAHKRLTAPGGLSLSDNNMDVFCSLEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQVLPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSPQITKTSATKVVATKSQLVT-LTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNSVTSSLTIKDFKAGDDGIYNCEALSSRQRSFSNDFQVIL 820          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. TrEMBL
Match: A0A3Q0KD55 (Low-density lipoprotein receptor (Ldl) OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 438.343 bits (1126), Expect = 2.584e-134
Identity = 303/951 (31.86%), Postives = 465/951 (48.90%), Query Frame = 2
Query:  176 EISRKTMYIGQSAKLRCGPQQDKFYNIK-VSYKWEKPLGNVISTDPEYKIQGATLNDGGIYTCRIT--------QVINGQITEKTISTELGIQSKDSDSEETTPPIFVDPPIISFKNINEGSIDVQETDFLYTVCEVSNWQQSEYTSSWWFNQAPINGANKI-----LFVSSLDADKNAGYYTCRINHKLYSQKTYEKQLLVNI------------KKPEISIISFPEENLKIGGRIYRKCEMLGIKISRNEALKFAWIKDNSFEIATGSILDLPIRDESVNGDYSCVIKSEKLNKKYFKELTIRIDSNIPRNPNQQRINIFSQPISPE--LNNEFKLKCEIFPPIPNA-NYIWKKDNNVVSYQQTLVIPSFQRQDIGSYSC--EIVSPNGDTSSSGRQISENVNVKFQYSSNNKIELDKF-GVQMISRVGEKKEMHCEISTSSPNRGSDVEWFFNKERLDE--TMKQQYKILRSDRNFVSIISLTNINPKNEGLYTCRVDNSDKKANLIVIQEESSLTINPERIIRNEGEPVEFHCRGNGIPDFINTKVKWSFKS-RDGTVVISSLENENRWEISNSPETPETSFISISSSLYKDGGFYICTTTEGLRRTAELVIKRREDSTLLTITPEIVRVRNGQPVVVECFSVSEKTGEPYGEPKFTMEYGK-SLSTDPRLVEQKVGQSRVRLSIKDGLQTSDNNLKVEC--HDGIRVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNEN-DYKCGNIKFNCS-NGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCESYGVPRPHIVWRYNWGCLSDS-LRMTIRTTIEGCNK----VISILRITNFQPGDDGIYNCETLSGPNRSFSDDYQLIL 2893
            ++ R  + +G+   L C        N + V Y+WE P GN++     Y I   T+ND G+YTC  +        Q ++       +  ++ +   D +SE   P I ++P        + G +DV   + LY+ C V +  Q  Y    W  +AP     +I     L++++   +       C +  +L   +T+EK L + +            K   ++I   P E+ +  G I R+C +       NE   F WI  N   +  G  L L I D S   +Y+C   + +    Y  +   R+     +   Q  +NI  +PI+ +  +   +++ CE+ PP     +++W  +  VV  + +L + S   +DIG Y C  E       T+ S    +E   +    +   KIE+    G  M+S  GE +E+HCE   ++P    DV W+F  + L+   T+    K+ R DR  VSI+++  I   + G Y CR+    K+ +L+V  EE  L INP+    +EGE VEFHCR +G+   IN +++W ++     T V   ++  + +   +      TSFIS + +   D G YIC            +  R   S +LTITP+ + VR  QPV  ECF+ SE        P+F +   + S  T       +V ++RVR  ++ GL    N   VEC   +  R  SA I +E+ CP   RRC +G+C P+G+FCDG  +C D SDE+P +CN CDPL  KCE Y  + P+K  F++HW CDGE+DCGN FDES C      +C +  FNC  +G+ IP A+ CDK+ DCS+GEDE+ C  P +      +   +RR  +  L CE  G P P+++WR+NWGCL D   R  I      C+     V+S L I+N +PGDDGIYNCE LSG  R+ S+D  +++
Sbjct:   46 QVRRWIVLLGRKVVLNCSVNLPPEVNPRQVQYRWEHPEGNILGYSKLYVIPNVTMNDAGVYTCHSSAYVGFGGEQWVDQHRLYLEVQDDISMAGGDRNSE---PTIVLNPG-------DPGPLDVNFGELLYSRCSVLDSNQYSYR---WIQRAPDGTIKEISSDARLYITNFGPEHLQYPIRCEVT-RLSDDETFEKVLNLRLASSGDLSTDDEYKTLNLTIKPLPNEDFR-QGTIMRQC-LFENDPEINELFDFRWIDQNGRIVTNGDTLYLLIEDPSELSNYTCEATNRQTGVIY--QAKYRVSMLNGQQAMQHIVNI--RPITGDVIIGRPYEMVCEVEPPPEEPISFVWYHNAKVVHREASLRLTSLSYRDIGMYICRAEWTPRYSRTAISANATAE---LSLALTRETKIEMSPPPGSVMVSLPGETRELHCEFPVANPR---DVRWYFENQLLENHPTINATGKVYRIDRLRVSIVTIRGIEQDHGGTYECRIGRDIKQTHLVVRAEEG-LEINPKSDTVDEGEAVEFHCRVHGMNGNINRQLEWYYRPFYSSTRVRLDVDTPDGFMRHDDLVAQHTSFISKARARVADQGEYICRLPSQNEEIVGKLFVRAVRSYVLTITPQRLTVRPYQPVEFECFAASEDGQPASFTPRFQVRDSRISFET------TRVSENRVRFVLQRGLGPDQNGTVVECLSDEPSRPASAIITVEDICPDGSRRCRSGQCLPAGRFCDGARDCDDGSDEDPKMCNICDPLSRKCEYYQGREPIKSTFMVHWTCDGESDCGNGFDESNCEARASERCQDRMFNCKRDGRQIPMAFVCDKDRDCSDGEDELTCAPPMIAEPRTTRY-SVRRGDTVVLVCEVTGNPVPYVIWRFNWGCLPDEPSRFRISNVPRNCDSPMPTVVSTLTISNVRPGDDGIYNCEGLSGATRALSNDLVVMI 962          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. TrEMBL
Match: A0A183A6H7 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS2562 PE=4 SV=1)

HSP 1 Score: 419.853 bits (1078), Expect = 1.986e-128
Identity = 259/837 (30.94%), Postives = 421/837 (50.30%), Query Frame = 2
Query:  473 DPPIISFKNINEGSIDVQETDFLYTVCEVSNWQQSEYTSSWWFNQAPINGANKI-----LFVSSLDADKNAGYYTCRINHKLYSQKTYEKQLLVNI--------KKPEISIISFPEENLKIGGRIYRKCEMLGIKISRNEALKFAWIKDNSFEIATGSILDLPIRDESVNGDYSCVIKSEKLNKKYFKELTIRIDSNIPRNPNQQRINIFSQPISPELNNEFKLKCEIFP-PIPNANYIWKKDNNVVSYQQTLVIPSFQRQDIGSYSCEIVSPNGDTSSSGRQISENVNVKFQYSSNNKIELDKF-GVQMISRVGEKKEMHCEISTSSPNRGSDVEWFFNKERLDE--TMKQQYKILRSDRNFVSIISLTNINPKNEGLYTCRVDNSDKKANLIVIQEESSLTINPERIIRNEGEPVEFHCRGNGIPDFINTKVKWSFKS-RDGTVVISSLENENRWEISNSPETPETSFISISSSLYKDGGFYIC-TTTEGLRRTAELVIKRREDSTLLTITPEIVRVRNGQPVVVECFSVSEKTGEPYGE-PKFTMEYGKSLSTDPRLVEQKVGQSRVRLSIKDGLQTSDNNLKVECH-DGI-RVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDY-KCGNIKFNCSNG-KVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCESYGVPRPHIVWRYNWGCLSDSL-RMTIRTTIEGCN----KVISILRITNFQPGDDGIYNCETLSGPNRSFSDDYQLILD 2896
            D P I     + G ++V     +Y+ C V +  +  +    W  + P + + ++     L++S +  +       C++  +L   + +EK L + +         +  ++I S P E+L   GRI R+C +       N+   F W+  N   +  G  L L + D +  G+Y+C       +  Y  +  +   S      +Q  + I        L   +++ C + P P    ++ W   + +V     L +PS    D+GSY C        + +     +  V++    +   +IE+    G  +++  GE +E+HCE    S      V+WFF  + L+   T+    ++ R DR  VSII+L  +   + G Y CRV+   K+ ++IV + E  L +NP     +EG PVEFHCR +G    +N +++W ++    G V   +L  E  +   + P    TSFIS   +   D G YIC   ++G      L + R      + ITP +V+VR   P+ +EC+ V E TG P    P F++     + +  R  +++V  +RVR  I+ GL    N  +V C  DG  R  ++TI +E+ CP  +RRC +G+C P+G+FCDGV +CAD SDE+P +CN+C+P + KCE Y N+ PLK   ++HW CDGE+DCGN FDE+ C +  + +CG+  F C N  + IPR++ CDK+ DC  GEDE  C  P + S  + +   +R      L C   G P P ++WR+NWGCL ++  R  + +  + C+     V+S L I+N +PGDDGIYNCE L+G  R+ S+DY ++++
Sbjct:   37 DGPEIILNPGDPGPLEVNMGGHVYSRCSVRDNHEYSFK---WIRRLPDHSSQEVSSTAVLYLSDVRVEDMQHPLYCQVT-RLSDGQVFEKVLNIRMVGYGGSLPAELTLTIRSLPAEDLS-AGRIMRQC-LFENNEEINQQFDFRWLDQNGRVVTNGDALYLMLEDPADLGNYTCEATHRSSSNIYQAKYHVTRSSRA--QASQYIVTIVPDTTQVLLGRPYEMLCRVEPMPSEPVSFRWYHKDRMVGSDARLRLPSLTYPDLGSYVCRAEWTPAYSRTGSMAANATVDLSLALTKEAEIEMSPPPGSVLVTLPGETRELHCEYGQLS---NPSVQWFFEGQPLERHPTLNASSRVYRMDRLRVSIITLRGVEVGHGGTYECRVNGQIKQTHVIV-RVEDGLEVNPSEDTVDEGTPVEFHCRAHGADRNVNQEMQWFYQPFSGGPVEPVNLHPETGFVRQDHPYASHTSFISRLRARKSDEGIYICRLPSQGAEARGRLYV-RATVQYRVVITPSVVKVRVNNPIEMECY-VMEDTGRPADVLPTFSL-----MDSRIRFEQERVAANRVRFIIRSGLGAEYNGTQVRCSVDGTDRFATSTIVIEDTCPHGFRRCRSGDCLPAGRFCDGVRDCADGSDEDPRLCNECEPTVRKCEYYQNRAPLKSTHMVHWICDGEDDCGNGFDEANCPDPLFAQCGDYMFTCPNSQRRIPRSFVCDKDQDCEYGEDERNCAGPTIESSGNYR-HSVRAGTQVVLTCRVTGHPLPRVIWRFNWGCLPENDNRYRVTSVAQNCDSPMPSVVSTLTISNVRPGDDGIYNCEGLAGSMRAMSNDYFVMIE 853          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. TrEMBL
Match: A0A504YLF0 (Basement membrane-specific heparan sulfate proteoglycan core protein OS=Fasciola gigantica OX=46835 GN=FGIG_04893 PE=4 SV=1)

HSP 1 Score: 417.542 bits (1072), Expect = 8.434e-128
Identity = 265/843 (31.44%), Postives = 420/843 (49.82%), Query Frame = 2
Query:  473 DPPIISFKNINEGSIDVQETDFLYTVCEVSNWQQSEYTSSWWFNQAPINGANKI-----LFVSSLDADKNAGYYTCRINHKLYSQKTYEKQLLVNI---------KKPEISIISFPEENLKIGGRIYRKCEMLGIKISRNEALKFAWIKDNSFEIATGSILDLPIRDESVNGDYSCVIKSEKLNKKYFKELTIRIDSNIPRNPNQQRINIFSQPISPE------LNNEFKLKCEIFP-PIPNANYIWKKDNNVVSYQQTLVIPSFQRQDIGSYSCEIVSPNGDTSSSGRQISENVNVKFQYSSNNKIELDKFGVQMISRVGEKKEMHCEIS-TSSPNRGSDVEWFFNKERLDE--TMKQQYKILRSDRNFVSIISLTNINPKNEGLYTCRVDNSDKKANLIVIQEESSLTINPERIIRNEGEPVEFHCRGNGIPDFINTKVKWSFKS-RDGTVVISSLENENRWEISNSPETPETSFISISSSLYKDGGFYIC-TTTEGLRRTAELVIKRREDSTLLTITPEIVRVRNGQPVVVECFSVSEKTGEPYGEPKFTMEYGKSLSTDPRLVEQKVGQSRVRLSIKDGLQTSDNNLKVECH-DGI-RVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQC-NENDYKCGNIKFNCSNG-KVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCESYGVPRPHIVWRYNWGCLSDSL-RMTIRTTIEGCN----KVISILRITNFQPGDDGIYNCETLSGPNRSFSDDYQLILD 2896
            D P I+    + G ++V     +Y+ C VSN   S   S  W  + P +   ++     L++    A++      C+   +L   +T+EK L + +             ++I S P E+L  G RI R+C   G +   NE   F W+  N   +  G  L L + D +  G+Y+C       N  Y  +  +         P+  + + +   + P+      L   +++ C + P P     Y W  ++ +V     L +PS    DIGSY C                         YS + K+     G  +++  GE +E+HCE    SSP+    V+WFF  + L+   T+    ++ R DR  VSI++L+ +   + G Y CR++   K+ ++IV + E  L +NP     +EG PVEFHCR +G    +N +++W ++    G +    L  E  +   + P    TSFIS   +   D G YIC   +EG      L + R      + ITP +++VR   P+  EC+ V +   +    P F++     L +  R  +++V  +RVR  I+ GL +  N  +V C  +G  R  ++ I +E+ CP  +RRC +G+C P+G+FCDG  +C D SDE+P +CN+C+P + KCE Y N+ PLK  ++IHWKCDGE+DCGN FDE+ C + +  +CG+  F C N  + IPR++ CDK+ DC  GEDE  C+ P + S+ D +   +R      L C   G P P ++WR+NWGCL ++  R  I    + C+     VIS L I+N +PGDDGIYNCE L+G  R+ S+DY ++++
Sbjct:   37 DEPEITLMPGDPGPLEVNLGGQVYSRCTVSN---SHEYSVKWIRRLPDHSTQEVSSTAMLYIPEARAEEMQHPLYCQAT-RLSDGQTFEKALNIRMVGYGGASLPADLTLTIRSLPAEDLSTG-RIMRQCLFEGNE-EVNEQFDFRWLDQNGRVVTNGDALYLMLEDPADLGNYTCEATHRSSNNIYQAKYHVT-------RPSHAQASQYVVTVVPDAASQVLLGRPYEMLCRVEPMPSEPVTYRWYHNDRMVGSDARLRLPSLAYPDIGSYVCR------------------AEWTPAYSRSGKMSPPP-GSVLVTLPGETRELHCEFGQLSSPS----VQWFFEGQPLERHPTLNASRRVYRMDRLRVSIVTLSGVEVGHGGTYECRINGQIKQTHVIV-RVEDGLEVNPSEDTVDEGTPVEFHCRAHGADQNVNREMQWFYQPFSGGPIQPVDLNPETGFVRQDHPYASHTSFISRLRARKSDEGIYICRLPSEGSEARGRLYV-RSTVQYRVVITPPVLKVRVNNPIEFECYVVEDTGRQADVLPNFSV-----LDSRVRFDQERVAANRVRFLIRSGLTSEYNGTQVRCAVEGTDRYATSIIVIEDTCPHGFRRCRSGDCLPAGRFCDGRRDCPDGSDEDPRLCNECEPTVKKCEYYQNRPPLKSTYMIHWKCDGEDDCGNGFDEANCPDPSIAQCGDYMFTCPNSQRRIPRSFVCDKDQDCEYGEDERNCVGPTIESIADYR-HSVRAGTQVTLTCRVTGNPLPRVIWRFNWGCLPENDNRYRITNVAQNCDSPMPSVISTLTISNVRPGDDGIYNCEGLAGSMRAMSNDYFVMIE 835          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Cavefish
Match: hspg2 (heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZDB-GENE-080807-4])

HSP 1 Score: 120.168 bits (300), Expect = 6.975e-27
Identity = 79/222 (35.59%), Postives = 108/222 (48.65%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDE----NPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQC--NENDYKCGNIKFNC-SNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILRITNFQPGDDGIYNCETLSGPNRSFS 2872
            C  +   C NG+C      CDG  +C D SDE     PS    C+P   KC+    +  LK      W+CDG+NDC +N DE  C        C   +F C S+   IP +YQCD+E DC++  DE GC  P VTS  +  V  + R G+    C++ GVP P I WR NWG +  S R+T+ +           L I + + GD G Y CE ++     F+
Sbjct:  196 CRGDQAMCQNGQCISRDYLCDGERDCTDGSDEMKCGTPS---PCEPNEFKCK--NGRCALK-----LWRCDGDNDCKDNSDEMDCPVRRPGDACAPEQFVCLSDRACIPASYQCDEEPDCADRSDEYGCAPPTVTSPPEDSVTAM-RGGTVTFTCKAVGVPTPIITWRLNWGHIPVSSRITMTS-----ENGQGTLTIRDVKEGDQGAYTCEAINAKGLVFA 401          

HSP 2 Score: 70.4774 bits (171), Expect = 9.911e-12
Identity = 106/514 (20.62%), Postives = 195/514 (37.94%), Query Frame = 2
Query:  662 KNAGYYTCRINHKLYSQKTYEKQLLVNIKKPEISIISFPEENLKIGGRIYRKCEMLG-----IKISRNEALKFAWIKDNSFEIATGSILDLPIRDESVNGDYSCVIKSEKLNKKYFKELTIRIDSNIPRNPNQQRINIFSQPISPEL-NNEFKLKCEIFPPIPNANYIWKKDNNVVSYQQ-----TLVIPSFQRQDIGSYSCEIVSPNGDTSSSGRQISENVNVKFQYSSNNKIELDKFGVQMISRVGEKKEMHCEISTSSPNRGSDVEWFFNKERLDETMKQQYKILRSDRNFVSIISLTNINPKNEGLYTC----RVDNSDKKANLIVIQEESSLTINPERIIRNEGEPVEFHCRGNGIPDFINTKVKW---------SFKSRDGTVVISSLENENRWEISNSPETPETSFISISSSLYKDGGFYICTTTEG---LRRTAELVIKRREDSTLLTITPEIVRVRNGQPVVVECFSVSEKTGEPYGEPKFTMEYGKSLSTDPRLVEQKVGQSRV 2122
            KN G Y C  ++     ++     L+  + P  ++      ++K+G  I  +C+  G     +   R +  +   +  +   + + ++L + +     +G Y C  ++ +   +   E+ +     +P  P         +P+   +  +   L C+ +   P     W K    + ++      +LV+PS  RQD G Y C + +  G + ++       + +  + +    +  D   V    RVGE   + C    + P R    EW      L  T +QQ   L+        I+L +  P + G Y C    +V +S+  A  + ++   S+ ++P+  ++  G   EF C  NG PD    K++W         +   RDG + I +LE  N                          G YIC  T      + +A L I+      ++ +   +  V  G  V  EC +V        GEPK T+ + K     P  V+ K G  R+
Sbjct: 2197 KNKGTYRCVASNPFGITQSIVS--LIVRESPRATVTPTGPVHVKVGDPINLECQAAGEPRPSVSWHRLDNARKTMLS-SPVPMESNAVLQILVARAEDSGTYVCTAQNNQGTTETRIEVIVEGGPAVPTVPRAS----VREPMKVVVEGSTTTLHCDGYG-FPKPTISWSKLRAPLPWRHKIVNGSLVLPSVGRQDSGQYICNVTNHMGTSEAT-------IMLDVETTPYTTLLPDDVSV----RVGEVIRLQCLAHGTPPLR---FEWSKVGGVLPATAEQQGGDLQ--------INLAS--PDDAGTYKCVASNKVGHSEAMAK-VSVRSPLSVRVSPQVDVKALGSAAEFTCSANGGPDI---KLEWLKEGGALPPNHHVRDGVLRIENLEKSNE-------------------------GVYICRATSSYGQAQDSARLTIQALP-KVMINVRTSVQTVMVGNSVEFECQAV--------GEPKPTIRWSKVGGKLPDHVQVKGGMLRI 2640          

HSP 3 Score: 68.5514 bits (166), Expect = 3.518e-11
Identity = 133/651 (20.43%), Postives = 234/651 (35.94%), Query Frame = 2
Query:  266 YKWEKPLGNVISTDPEYKIQGATLN-------DGGIYTC-----------RITQVINGQITE---------KTISTELGIQSKDSDSEETTPPIFVDPPIISFKNINEGSIDVQETDFLYTVCEVSNWQQSEY-----TSSWWFNQAPINGANKILFVSSLDADKNAGYYTCRINHKLYSQKTYEKQLLVNIKKPEISIISFPEENLKIGGRIYRKCEMLGIKISRNEALKFAWIKDNSFEIAT-----GSILDLPIRDESVNGDYSCVIKSEKLNKKYFKELTIRIDS-NIPRNPNQQRINIFSQPISPELNNEFKLKCEIFPPIPNANYIWKKDNNVVSYQQ--------TLVIPSFQRQDIGSYSCEIVSPNGDTSSSGR---QISENVNVKFQYSSNNKIELDKFGVQMISRVGEKKEMHCEISTSSPNRGSDVEWFFNKERLD---ETMKQQYKILRSDRNFVSIISLTNINPKNEGLYTCRVDNSDKKANLIVIQ---------EESSLTINPERIIRNEGEPVEFHCRGNGIPDFINTKVKWSFKSRDGTVVISSLENENRWEISNSPETPETSFISISSSLYKDGGFYICTTTEGLRRTAELVIKRREDSTLLTITPE-IVRVRNGQPVVVECFSVSEKTGEP 2032
            + W +  G  IS+  E + QG  L+       D G+Y C           R   ++    T+         K  S   G+      + ++  P +     I +     G +  +  DF   +  + N Q  +Y     T S  F    ++ ++ +L V   +A+    +YT     + + Q     Q +  I+ P ++I        + G R   +C   G     N A    W       I++     G +L     D S  GDY C  ++   + ++     + + S ++P       + +  Q +        +L C      P+    WKK    +  Q         TL +P+ +R D G+Y C  V  N   SS  R    + +  +V  Q S  + +E            GE  +++C +  + P     V W      L    + +  Q +ILR+ +             ++ G Y CRVD         V           +   ++I P       GEP  F CR +     +  +++W   +             N+    N+  +P+ S I+I+++  K+ G Y C  +     T  +V     +S   T+TP   V V+ G P+ +EC    +  GEP
Sbjct: 1681 FHWSREDGRPISSSAERRRQGEELHFSSVQPADAGVYICTCRDSLDTTRGRAEIIVRSSPTKPIEVFIEEPKVQSVAAGVTVNFICTAKSKSPAYT----IVWTRQGNGKLPNRAMDF-NGILTIQNVQPEDYGVYVCTGSNMFG---MDESSAVLHVQEANAEM---FYTAYEMFEGHRQPGEGSQPVATIQPPVLTI--------QQGQRAEFRCTASG-----NPAPAVEWTGGPGKRISSNAVIRGGVLTFTSVDRSDEGDYIC--RALNTHGEHTARAVLYVHSTSVPY--LLPHVQVSPQQVELHEGETLRLYCRAG-GTPSPGLTWKKRGGTLPPQARVERTDFGTLTVPNMKRSDGGTYLC--VGTNAVGSSEARIEVTVVKGNDVSIQPSEASVVE------------GETLDLNCFVPGNPP---PSVTWSRANGYLSPNHQVIGTQLRILRASQ-------------EDSGEYICRVDGGPHVRQASVSVSVTSESSRLQSPIISIEPHSAAVKLGEPASFRCRVHSGAQPV--RLEWKLTN-------------NQPIPDNAKISPDGSVITITNAQSKNKGTYRCVASNPFGITQSIVSLIVRESPRATVTPTGPVHVKVGDPINLEC----QAAGEP 2253          

HSP 4 Score: 53.9138 bits (128), Expect = 9.928e-7
Identity = 75/392 (19.13%), Postives = 136/392 (34.69%), Query Frame = 2
Query: 1052 INIFSQPISPELNNEFKLKCEIFPPIPNANYIWKKDNN--------VVSYQQTLVIPSFQRQDIGSYSCEIVSPNGDTSSSGRQISENVNVKFQYSSNNKIELDKFGVQMISRVGEKKEMHCEISTSSPNRGSDVEWFFNKERLDETMKQQYKILRSDRNFVS--IISLTNINPKNEGLYTCRVDNSDKKANL---IVIQEESSLTINPERIIRN------EGEPVEFHCRGNGIP------DFINTKVKWSFKSRDGTVVISSLENENRWEISNSPETPETSFISISSSLYKDGGFYICTTTEGLRRTAELVIKRREDSTLLTITPEIVRVRNGQPVVVECFSVSEKTGEPYGEPKFTMEYGKSLSTDPRLVEQKVGQSRVRLSIKDGLQT 2152
            I+I     + +L      +C +          WK  NN        +      + I + Q ++ G+Y C   +P G T S          V      + +  +   G   + +VG+   + C+ +   P     V W     RLD   K    +L S     S  ++ +     ++ G Y C   N+         ++++   ++   P   +R       EG     HC G G P        +   + W  K  +G++V+ S+  +                         D G YIC  T  +  +   ++   E +   T+ P+ V VR G+ + ++C +        +G P    E+ K     P   EQ+ G  ++ L+  D   T
Sbjct: 2136 ISIEPHSAAVKLGEPASFRCRVHSGAQPVRLEWKLTNNQPIPDNAKISPDGSVITITNAQSKNKGTYRCVASNPFGITQSI---------VSLIVRESPRATVTPTGPVHV-KVGDPINLECQ-AAGEPR--PSVSW----HRLDNARK---TMLSSPVPMESNAVLQILVARAEDSGTYVCTAQNNQGTTETRIEVIVEGGPAVPTVPRASVREPMKVVVEGSTTTLHCDGYGFPKPTISWSKLRAPLPWRHKIVNGSLVLPSVGRQ-------------------------DSGQYICNVTNHMGTSEATIMLDVETTPYTTLLPDDVSVRVGEVIRLQCLA--------HGTPPLRFEWSKVGGVLPATAEQQGGDLQINLASPDDAGT 2474          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Cavefish
Match: hspg2 (heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZDB-GENE-080807-4])

HSP 1 Score: 120.168 bits (300), Expect = 7.393e-27
Identity = 79/222 (35.59%), Postives = 108/222 (48.65%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDE----NPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQC--NENDYKCGNIKFNC-SNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILRITNFQPGDDGIYNCETLSGPNRSFS 2872
            C  +   C NG+C      CDG  +C D SDE     PS    C+P   KC+    +  LK      W+CDG+NDC +N DE  C        C   +F C S+   IP +YQCD+E DC++  DE GC  P VTS  +  V  + R G+    C++ GVP P I WR NWG +  S R+T+ +           L I + + GD G Y CE ++     F+
Sbjct:  196 CRGDQAMCQNGQCISRDYLCDGERDCTDGSDEMKCGTPS---PCEPNEFKCK--NGRCALK-----LWRCDGDNDCKDNSDEMDCPVRRPGDACAPEQFVCLSDRACIPASYQCDEEPDCADRSDEYGCAPPTVTSPPEDSVTAM-RGGTVTFTCKAVGVPTPIITWRLNWGHIPVSSRITMTS-----ENGQGTLTIRDVKEGDQGAYTCEAINAKGLVFA 401          

HSP 2 Score: 70.4774 bits (171), Expect = 1.007e-11
Identity = 106/514 (20.62%), Postives = 195/514 (37.94%), Query Frame = 2
Query:  662 KNAGYYTCRINHKLYSQKTYEKQLLVNIKKPEISIISFPEENLKIGGRIYRKCEMLG-----IKISRNEALKFAWIKDNSFEIATGSILDLPIRDESVNGDYSCVIKSEKLNKKYFKELTIRIDSNIPRNPNQQRINIFSQPISPEL-NNEFKLKCEIFPPIPNANYIWKKDNNVVSYQQ-----TLVIPSFQRQDIGSYSCEIVSPNGDTSSSGRQISENVNVKFQYSSNNKIELDKFGVQMISRVGEKKEMHCEISTSSPNRGSDVEWFFNKERLDETMKQQYKILRSDRNFVSIISLTNINPKNEGLYTC----RVDNSDKKANLIVIQEESSLTINPERIIRNEGEPVEFHCRGNGIPDFINTKVKW---------SFKSRDGTVVISSLENENRWEISNSPETPETSFISISSSLYKDGGFYICTTTEG---LRRTAELVIKRREDSTLLTITPEIVRVRNGQPVVVECFSVSEKTGEPYGEPKFTMEYGKSLSTDPRLVEQKVGQSRV 2122
            KN G Y C  ++     ++     L+  + P  ++      ++K+G  I  +C+  G     +   R +  +   +  +   + + ++L + +     +G Y C  ++ +   +   E+ +     +P  P         +P+   +  +   L C+ +   P     W K    + ++      +LV+PS  RQD G Y C + +  G + ++       + +  + +    +  D   V    RVGE   + C    + P R    EW      L  T +QQ   L+        I+L +  P + G Y C    +V +S+  A  + ++   S+ ++P+  ++  G   EF C  NG PD    K++W         +   RDG + I +LE  N                          G YIC  T      + +A L I+      ++ +   +  V  G  V  EC +V        GEPK T+ + K     P  V+ K G  R+
Sbjct: 2160 KNKGTYRCVASNPFGITQSIVS--LIVRESPRATVTPTGPVHVKVGDPINLECQAAGEPRPSVSWHRLDNARKTMLS-SPVPMESNAVLQILVARAEDSGTYVCTAQNNQGTTETRIEVIVEGGPAVPTVPRAS----VREPMKVVVEGSTTTLHCDGYG-FPKPTISWSKLRAPLPWRHKIVNGSLVLPSVGRQDSGQYICNVTNHMGTSEAT-------IMLDVETTPYTTLLPDDVSV----RVGEVIRLQCLAHGTPPLR---FEWSKVGGVLPATAEQQGGDLQ--------INLAS--PDDAGTYKCVASNKVGHSEAMAK-VSVRSPLSVRVSPQVDVKALGSAAEFTCSANGGPDI---KLEWLKEGGALPPNHHVRDGVLRIENLEKSNE-------------------------GVYICRATSSYGQAQDSARLTIQALP-KVMINVRTSVQTVMVGNSVEFECQAV--------GEPKPTIRWSKVGGKLPDHVQVKGGMLRI 2603          

HSP 3 Score: 61.2326 bits (147), Expect = 6.381e-9
Identity = 135/674 (20.03%), Postives = 244/674 (36.20%), Query Frame = 2
Query:  266 YKWEKPLGNVISTDPEYKIQGATLN-------DGGIYTC-----------RITQVINGQITE---------KTISTELGIQSKDSDSEETTPPIFVDPPIISFKNINEGSIDVQETDFLYTVCEVSNWQQSEY-----TSSWWFNQAPINGANKILFVSSLDADKNAGYYTCRINHKLYSQKTYEKQLLVNIKKPEISIISFPEENLKIGGRIYRKCEMLGIKISRNEALKFAWIKDNSFEIAT-----GSILDLPIRDESVNGDYSCVIKSEKLNKKYFKELTIRIDS--------NIPRNPNQ------QRINIFSQP-ISPELNNEFKLKCEIFPP--IPNANYIWKKDNNVVSYQQ---------------TLVIPSFQRQDIGSYSCEIVSPNGDTSSSGR---QISENVNVKFQYSSNNKIELDKFGVQMISRVGEKKEMHCEISTSSPNRGSDVEWFFNKERLD---ETMKQQYKILRSDRNFVSIISLTNINPKNEGLYTCRVDNSDKKANLIVIQ---------EESSLTINPERIIRNEGEPVEFHCRGNGIPDFINTKVKWSFKSRDGTVVISSLENENRWEISNSPETPETSFISISSSLYKDGGFYICTTTEGLRRTAELVIKRREDSTLLTITPE-IVRVRNGQPVVVECFSVSEKTGEP 2032
            + W +  G  IS+  E + QG  L+       D G+Y C           R   ++    T+         K  S   G+      + ++  P +     I +     G +  +  DF   +  + N Q  +Y     T S  F    ++ ++ +L V   +A+    +YT     + + Q     Q +  I+ P ++I        + G R   +C   G     N A    W       I++     G +L     D S  GDY C  ++   + ++     + + S        ++  +P Q      + + ++ +   +P     +K +    PP  IP+  +   K N++   Q+               TL +P+ +R D G+Y C  V  N   SS  R    + +  +V  Q S  + +E            GE  +++C +  + P     V W      L    + +  Q +ILR+ +             ++ G Y CRVD         V           +   ++I P       GEP  F CR +     +  +++W   +             N+    N+  +P+ S I+I+++  K+ G Y C  +     T  +V     +S   T+TP   V V+ G P+ +EC    +  GEP
Sbjct: 1618 FHWSREDGRPISSSAERRRQGEELHFSSVQPADAGVYICTCRDSLDTTRGRAEIIVRSSPTKPIEVFIEEPKVQSVAAGVTVNFICTAKSKSPAYT----IVWTRQGNGKLPNRAMDF-NGILTIQNVQPEDYGVYVCTGSNMFG---MDESSAVLHVQEANAEM---FYTAYEMFEGHRQPGEGSQPVATIQPPVLTI--------QQGQRAEFRCTASG-----NPAPAVEWTGGPGKRISSNAVIRGGVLTFTSVDRSDEGDYIC--RALNTHGEHTARAVLYVHSTSVPYLLPHVQVSPQQVELHEGETLRLYCRAGGTPSPGLTWKKRGGTLPPQAIPSHGFHQFKSNSLDVLQRRIEELQARVERTDFGTLTVPNMKRSDGGTYLC--VGTNAVGSSEARIEVTVVKGNDVSIQPSEASVVE------------GETLDLNCFVPGNPP---PSVTWSRANGYLSPNHQVIGTQLRILRASQ-------------EDSGEYICRVDGGPHVRQASVSVSVTSESSRLQSPIISIEPHSAAVKLGEPASFRCRVHSGAQPV--RLEWKLTN-------------NQPIPDNAKISPDGSVITITNAQSKNKGTYRCVASNPFGITQSIVSLIVRESPRATVTPTGPVHVKVGDPINLEC----QAAGEP 2216          

HSP 4 Score: 54.299 bits (129), Expect = 8.744e-7
Identity = 75/392 (19.13%), Postives = 136/392 (34.69%), Query Frame = 2
Query: 1052 INIFSQPISPELNNEFKLKCEIFPPIPNANYIWKKDNN--------VVSYQQTLVIPSFQRQDIGSYSCEIVSPNGDTSSSGRQISENVNVKFQYSSNNKIELDKFGVQMISRVGEKKEMHCEISTSSPNRGSDVEWFFNKERLDETMKQQYKILRSDRNFVS--IISLTNINPKNEGLYTCRVDNSDKKANL---IVIQEESSLTINPERIIRN------EGEPVEFHCRGNGIP------DFINTKVKWSFKSRDGTVVISSLENENRWEISNSPETPETSFISISSSLYKDGGFYICTTTEGLRRTAELVIKRREDSTLLTITPEIVRVRNGQPVVVECFSVSEKTGEPYGEPKFTMEYGKSLSTDPRLVEQKVGQSRVRLSIKDGLQT 2152
            I+I     + +L      +C +          WK  NN        +      + I + Q ++ G+Y C   +P G T S          V      + +  +   G   + +VG+   + C+ +   P     V W     RLD   K    +L S     S  ++ +     ++ G Y C   N+         ++++   ++   P   +R       EG     HC G G P        +   + W  K  +G++V+ S+  +                         D G YIC  T  +  +   ++   E +   T+ P+ V VR G+ + ++C +        +G P    E+ K     P   EQ+ G  ++ L+  D   T
Sbjct: 2099 ISIEPHSAAVKLGEPASFRCRVHSGAQPVRLEWKLTNNQPIPDNAKISPDGSVITITNAQSKNKGTYRCVASNPFGITQSI---------VSLIVRESPRATVTPTGPVHV-KVGDPINLECQ-AAGEPR--PSVSW----HRLDNARK---TMLSSPVPMESNAVLQILVARAEDSGTYVCTAQNNQGTTETRIEVIVEGGPAVPTVPRASVREPMKVVVEGSTTTLHCDGYGFPKPTISWSKLRAPLPWRHKIVNGSLVLPSVGRQ-------------------------DSGQYICNVTNHMGTSEATIMLDVETTPYTTLLPDDVSVRVGEVIRLQCLA--------HGTPPLRFEWSKVGGVLPATAEQQGGDLQINLASPDDAGT 2437          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Cavefish
Match: hspg2 (heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZDB-GENE-080807-4])

HSP 1 Score: 119.783 bits (299), Expect = 8.704e-27
Identity = 79/222 (35.59%), Postives = 108/222 (48.65%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDE----NPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQC--NENDYKCGNIKFNC-SNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILRITNFQPGDDGIYNCETLSGPNRSFS 2872
            C  +   C NG+C      CDG  +C D SDE     PS    C+P   KC+    +  LK      W+CDG+NDC +N DE  C        C   +F C S+   IP +YQCD+E DC++  DE GC  P VTS  +  V  + R G+    C++ GVP P I WR NWG +  S R+T+ +           L I + + GD G Y CE ++     F+
Sbjct:  191 CRGDQAMCQNGQCISRDYLCDGERDCTDGSDEMKCGTPS---PCEPNEFKCK--NGRCALK-----LWRCDGDNDCKDNSDEMDCPVRRPGDACAPEQFVCLSDRACIPASYQCDEEPDCADRSDEYGCAPPTVTSPPEDSVTAM-RGGTVTFTCKAVGVPTPIITWRLNWGHIPVSSRITMTS-----ENGQGTLTIRDVKEGDQGAYTCEAINAKGLVFA 396          

HSP 2 Score: 70.0922 bits (170), Expect = 1.444e-11
Identity = 106/521 (20.35%), Postives = 196/521 (37.62%), Query Frame = 2
Query:  662 KNAGYYTCRINHKLYSQKTYEKQLLVNIKKPEISIISFPEENLKIGGRIYRKCEMLG-----IKISRNEALKFAWIKDNSFEIATGSILDLPIRDESVNGDYSCVIKSEKLNKKYFKELTIRIDSNIPRNPNQQRINIFSQPISPEL-NNEFKLKCEIFPPIPNANYIWKKDNNVVSYQQ-----TLVIPSFQRQDIGSYSCEIVSPNGDTSSSGRQISENVNVKFQYSSNNKIELDKFGVQMISRVGEKKEMHCEISTSSPNRGSDVEWFFNKERLDETMKQQYKILRSDRNFVSIISLTNINPKNEGLYTC----RVDNSDKKA--------NLIVIQEESSLTINPERIIRNEGEPVEFHCRGNGIPDFINTKVKW---------SFKSRDGTVVISSLENENRWEISNSPETPETSFISISSSLYKDGGFYIC--TTTEGLRRTAELVIKRREDSTLLTITPEIVRVRNGQPVVVECFSVSEKTGEPYGEPKFTMEYGKSLSTDPRLVEQKVGQSRV 2122
            KN G Y C  ++     ++     L+  + P  ++      ++K+G  I  +C+  G     +   R +  +   +  +   + + ++L + +     +G Y C  ++ +   +   E+ +     +P  P         +P+   +  +   L C+ +   P     W K    + ++      +LV+PS  RQD G Y C + +  G + ++       + +  + +    +  D   V    RVGE   + C    + P R    EW      L  T +QQ   L+        I+L +  P + G Y C    +V +S+  A        N +V     S+ ++P+  ++  G   EF C  NG PD    K++W         +   RDG + I +LE  N                          G YIC  T++ G  + +  +  +     ++ +   +  V  G  V  EC +V        GEPK T+ + K     P  V+ K G  R+
Sbjct: 2052 KNKGTYRCVASNPFGITQSIVS--LIVRESPRATVTPTGPVHVKVGDPINLECQAAGEPRPSVSWHRLDNARKTMLS-SPVPMESNAVLQILVARAEDSGTYVCTAQNNQGTTETRIEVIVEGGPAVPTVPRAS----VREPMKVVVEGSTTTLHCDGYG-FPKPTISWSKLRAPLPWRHKIVNGSLVLPSVGRQDSGQYICNVTNHMGTSEAT-------IMLDVETTPYTTLLPDDVSV----RVGEVIRLQCLAHGTPPLR---FEWSKVGGVLPATAEQQGGDLQ--------INLAS--PDDAGTYKCVASNKVGHSEAMAKVSVRLICNRVVCSAPLSVRVSPQVDVKALGSAAEFTCSANGGPDI---KLEWLKEGGALPPNHHVRDGVLRIENLEKSNE-------------------------GVYICRATSSYGQAQDSARLTIQALPKVMINVRTSVQTVMVGNSVEFECQAV--------GEPKPTIRWSKVGGKLPDHVQVKGGMLRI 2504          

HSP 3 Score: 54.299 bits (129), Expect = 7.430e-7
Identity = 75/392 (19.13%), Postives = 136/392 (34.69%), Query Frame = 2
Query: 1052 INIFSQPISPELNNEFKLKCEIFPPIPNANYIWKKDNN--------VVSYQQTLVIPSFQRQDIGSYSCEIVSPNGDTSSSGRQISENVNVKFQYSSNNKIELDKFGVQMISRVGEKKEMHCEISTSSPNRGSDVEWFFNKERLDETMKQQYKILRSDRNFVS--IISLTNINPKNEGLYTCRVDNSDKKANL---IVIQEESSLTINPERIIRN------EGEPVEFHCRGNGIP------DFINTKVKWSFKSRDGTVVISSLENENRWEISNSPETPETSFISISSSLYKDGGFYICTTTEGLRRTAELVIKRREDSTLLTITPEIVRVRNGQPVVVECFSVSEKTGEPYGEPKFTMEYGKSLSTDPRLVEQKVGQSRVRLSIKDGLQT 2152
            I+I     + +L      +C +          WK  NN        +      + I + Q ++ G+Y C   +P G T S          V      + +  +   G   + +VG+   + C+ +   P     V W     RLD   K    +L S     S  ++ +     ++ G Y C   N+         ++++   ++   P   +R       EG     HC G G P        +   + W  K  +G++V+ S+  +                         D G YIC  T  +  +   ++   E +   T+ P+ V VR G+ + ++C +        +G P    E+ K     P   EQ+ G  ++ L+  D   T
Sbjct: 1991 ISIEPHSAAVKLGEPASFRCRVHSGAQPVRLEWKLTNNQPIPDNAKISPDGSVITITNAQSKNKGTYRCVASNPFGITQSI---------VSLIVRESPRATVTPTGPVHV-KVGDPINLECQ-AAGEPR--PSVSW----HRLDNARK---TMLSSPVPMESNAVLQILVARAEDSGTYVCTAQNNQGTTETRIEVIVEGGPAVPTVPRASVREPMKVVVEGSTTTLHCDGYGFPKPTISWSKLRAPLPWRHKIVNGSLVLPSVGRQ-------------------------DSGQYICNVTNHMGTSEATIMLDVETTPYTTLLPDDVSVRVGEVIRLQCLA--------HGTPPLRFEWSKVGGVLPATAEQQGGDLQINLASPDDAGT 2329          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Cavefish
Match: hspg2 (heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZDB-GENE-080807-4])

HSP 1 Score: 119.783 bits (299), Expect = 9.321e-27
Identity = 79/222 (35.59%), Postives = 108/222 (48.65%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDE----NPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQC--NENDYKCGNIKFNC-SNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILRITNFQPGDDGIYNCETLSGPNRSFS 2872
            C  +   C NG+C      CDG  +C D SDE     PS    C+P   KC+    +  LK      W+CDG+NDC +N DE  C        C   +F C S+   IP +YQCD+E DC++  DE GC  P VTS  +  V  + R G+    C++ GVP P I WR NWG +  S R+T+ +           L I + + GD G Y CE ++     F+
Sbjct:  191 CRGDQAMCQNGQCISRDYLCDGERDCTDGSDEMKCGTPS---PCEPNEFKCK--NGRCALK-----LWRCDGDNDCKDNSDEMDCPVRRPGDACAPEQFVCLSDRACIPASYQCDEEPDCADRSDEYGCAPPTVTSPPEDSVTAM-RGGTVTFTCKAVGVPTPIITWRLNWGHIPVSSRITMTS-----ENGQGTLTIRDVKEGDQGAYTCEAINAKGLVFA 396          

HSP 2 Score: 67.3958 bits (163), Expect = 7.560e-11
Identity = 106/527 (20.11%), Postives = 196/527 (37.19%), Query Frame = 2
Query:  662 KNAGYYTCRINHKLYSQKTYEKQLLVNIKKPEISIISFPEENLKIGGRIYRKCEMLG-----IKISRNEALKFAWIKDNSFEIATGSILDLPIRDESVNGDYSCVIKSEKLNKKYFKELTIRIDSNIPRNPNQQRINIFSQPISPEL-NNEFKLKCEIFPPIPNANYIWKKDNNVVSYQQ-----TLVIPSFQRQDIGSYSCEIVSPNGDTSSSGRQISENVNVKFQYSSNNKIELDKFGVQMISRVGEKKEMHCEISTSSPNRGSDVEWFFNKERLDETMKQQYKILRSDRNFVSIISLTNINPKNEGLYTC----RVDNSDKKA--------------NLIVIQEESSLTINPERIIRNEGEPVEFHCRGNGIPDFINTKVKW---------SFKSRDGTVVISSLENENRWEISNSPETPETSFISISSSLYKDGGFYIC--TTTEGLRRTAELVIKRREDSTLLTITPEIVRVRNGQPVVVECFSVSEKTGEPYGEPKFTMEYGKSLSTDPRLVEQKVGQSRV 2122
            KN G Y C  ++     ++     L+  + P  ++      ++K+G  I  +C+  G     +   R +  +   +  +   + + ++L + +     +G Y C  ++ +   +   E+ +     +P  P         +P+   +  +   L C+ +   P     W K    + ++      +LV+PS  RQD G Y C + +  G + ++       + +  + +    +  D   V    RVGE   + C    + P R    EW      L  T +QQ   L+        I+L +  P + G Y C    +V +S+  A              N +V     S+ ++P+  ++  G   EF C  NG PD    K++W         +   RDG + I +LE  N                          G YIC  T++ G  + +  +  +     ++ +   +  V  G  V  EC +V        GEPK T+ + K     P  V+ K G  R+
Sbjct: 2056 KNKGTYRCVASNPFGITQSIVS--LIVRESPRATVTPTGPVHVKVGDPINLECQAAGEPRPSVSWHRLDNARKTMLS-SPVPMESNAVLQILVARAEDSGTYVCTAQNNQGTTETRIEVIVEGGPAVPTVPRAS----VREPMKVVVEGSTTTLHCDGYG-FPKPTISWSKLRAPLPWRHKIVNGSLVLPSVGRQDSGQYICNVTNHMGTSEAT-------IMLDVETTPYTTLLPDDVSV----RVGEVIRLQCLAHGTPPLR---FEWSKVGGVLPATAEQQGGDLQ--------INLAS--PDDAGTYKCVASNKVGHSEAMAKVSVRCDTFTFLICNRVVCSAPLSVRVSPQVDVKALGSAAEFTCSANGGPDI---KLEWLKEGGALPPNHHVRDGVLRIENLEKSNE-------------------------GVYICRATSSYGQAQDSARLTIQALPKVMINVRTSVQTVMVGNSVEFECQAV--------GEPKPTIRWSKVGGKLPDHVQVKGGMLRI 2514          

HSP 3 Score: 54.299 bits (129), Expect = 7.817e-7
Identity = 75/392 (19.13%), Postives = 136/392 (34.69%), Query Frame = 2
Query: 1052 INIFSQPISPELNNEFKLKCEIFPPIPNANYIWKKDNN--------VVSYQQTLVIPSFQRQDIGSYSCEIVSPNGDTSSSGRQISENVNVKFQYSSNNKIELDKFGVQMISRVGEKKEMHCEISTSSPNRGSDVEWFFNKERLDETMKQQYKILRSDRNFVS--IISLTNINPKNEGLYTCRVDNSDKKANL---IVIQEESSLTINPERIIRN------EGEPVEFHCRGNGIP------DFINTKVKWSFKSRDGTVVISSLENENRWEISNSPETPETSFISISSSLYKDGGFYICTTTEGLRRTAELVIKRREDSTLLTITPEIVRVRNGQPVVVECFSVSEKTGEPYGEPKFTMEYGKSLSTDPRLVEQKVGQSRVRLSIKDGLQT 2152
            I+I     + +L      +C +          WK  NN        +      + I + Q ++ G+Y C   +P G T S          V      + +  +   G   + +VG+   + C+ +   P     V W     RLD   K    +L S     S  ++ +     ++ G Y C   N+         ++++   ++   P   +R       EG     HC G G P        +   + W  K  +G++V+ S+  +                         D G YIC  T  +  +   ++   E +   T+ P+ V VR G+ + ++C +        +G P    E+ K     P   EQ+ G  ++ L+  D   T
Sbjct: 1995 ISIEPHSAAVKLGEPASFRCRVHSGAQPVRLEWKLTNNQPIPDNAKISPDGSVITITNAQSKNKGTYRCVASNPFGITQSI---------VSLIVRESPRATVTPTGPVHV-KVGDPINLECQ-AAGEPR--PSVSW----HRLDNARK---TMLSSPVPMESNAVLQILVARAEDSGTYVCTAQNNQGTTETRIEVIVEGGPAVPTVPRASVREPMKVVVEGSTTTLHCDGYGFPKPTISWSKLRAPLPWRHKIVNGSLVLPSVGRQ-------------------------DSGQYICNVTNHMGTSEATIMLDVETTPYTTLLPDDVSVRVGEVIRLQCLA--------HGTPPLRFEWSKVGGVLPATAEQQGGDLQINLASPDDAGT 2333          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Cavefish
Match: lrp1aa (low density lipoprotein receptor-related protein 1Aa [Source:ZFIN;Acc:ZDB-GENE-030131-7889])

HSP 1 Score: 86.2705 bits (212), Expect = 1.735e-16
Identity = 54/142 (38.03%), Postives = 77/142 (54.23%), Query Frame = 2
Query: 2174 ECHDGIRVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCD-PLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSN-GEDEVGC 2593
            +C DG   K+ +  +  QCP  ++ CNN  C+P+G  CDG  +C D SDENP  C +   P   +   Y ++V L     +  +CDG +DCG+N DE  C      CG  +F CSNGK I    +C+  +DC + G DE+ C
Sbjct: 3620 DCMDGSDEKNCSSEVTRQCPLEFQ-CNNTLCKPAGWRCDGEDDCGDNSDENPEDCKRFQCPPTRQFRCYNDRVCLP----VSKQCDGIDDCGDNSDELNCQTPSTTCGKDEFTCSNGKCISSNLRCNYFNDCGDYGSDEIKC 3756          

HSP 2 Score: 73.559 bits (179), Expect = 1.278e-12
Identity = 53/163 (32.52%), Postives = 80/163 (49.08%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCN--KCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCESYGVPRPHIVWR 2710
            CP N   C +G C P    CD   +C DRSDE P+ C    C PL       G  +       I+W+CD +NDCG+N DE+ C    + C + +F C++G+ IP  ++CD ++DC +  DE         + T+   R      + E +C+  G+  P + WR
Sbjct:  920 CPPNQFSCASGRCIPISWTCDLDDDCGDRSDE-PASCAYPTCFPLTQFTCDNGRCIN------INWRCDNDNDCGDNSDEAGCT---HSCSSTQFKCNSGRCIPDYWKCDGDNDCGDYSDE------NNANCTNHATRPPGGCHTDEFQCQMDGLCIP-LRWR 1065          

HSP 3 Score: 71.2478 bits (173), Expect = 5.793e-12
Identity = 44/134 (32.84%), Postives = 68/134 (50.75%), Query Frame = 2
Query: 2225 QCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNK-VPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDE-VGCILPQVTSMT 2620
            QC      C N  C      CDG  +C D SDE P +C++     ++ +   N+ +P++      W CDG+NDCGN+ DES    +   C   +F+C++G+ IP ++ CD + DC +  DE   C  P    +T
Sbjct:  837 QCQPGEFACENNRCIQERWKCDGDNDCLDNSDEAPELCHQHTCPTDRFKCQNNRCIPMR------WLCDGDNDCGNDEDESNSTCSARTCPPNQFSCASGRCIPISWTCDLDDDCGDRSDEPASCAYPTCFPLT 964          

HSP 4 Score: 70.0922 bits (170), Expect = 1.359e-11
Identity = 44/129 (34.11%), Postives = 59/129 (45.74%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLIN---KCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQC----NENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            CP +  +C +G C  +   C+ V +C D +DE       C        K   Y         +   W CDG NDCG+  DE  C    + +  KC    F C +G+ IP  + CDKE+DC NG DEV C
Sbjct: 2586 CPADQFQCRDGRCISNSSRCNQVVDCEDATDEMNCSATNCSSYFRLGVKGVTYQRCEFTTLCYAPSWVCDGANDCGDYSDEMNCPGPTDPSKRKCPPSFFACPSGRCIPMTWTCDKENDCENGADEVNC 2714          

HSP 5 Score: 68.5514 bits (166), Expect = 4.004e-11
Identity = 49/144 (34.03%), Postives = 71/144 (49.31%), Query Frame = 2
Query: 2249 CNNGECQPSGKFCDGVANCADRSDENPSVCNK--CDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCE 2674
            C NG+C      CDG A+C D+SDE  S C+   C     +C      V  + + L+ W C+G NDCG+N DE  CN     C   +F C +G+ I  + +C++  DC +  DE+ C     +S       R+  +G T  RCE
Sbjct: 2513 CGNGDCINYTLTCDGTAHCKDKSDEKQSYCSNRDCKRGYKRC------VNGRCVRLVSW-CNGRNDCGDNSDELFCNAT--LCPADQFQCRDGRCISNSSRCNQVVDCEDATDEMNCSATNCSSYF-----RLGVKGVTYQRCE 2642          

HSP 6 Score: 68.1662 bits (165), Expect = 5.612e-11
Identity = 45/125 (36.00%), Postives = 60/125 (48.00%), Query Frame = 2
Query: 2219 ENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            E  C     RC N  C P    CD   +C D SDE+  V  +C      C   G  +  +      WKCDG++DC +  DE+ C   D KC + +F C NG  IP  ++CD + DC +G DE  C
Sbjct: 3516 ERTCEPYQFRCKNNRCVPGRWQCDYDNDCGDNSDEDDCVPRQCSESEFAC-TNGRCIAGR------WKCDGDHDCVDGSDENGC---DVKCDSDEFQCKNGHCIPFRWRCDADPDCMDGSDEKNC 3630          

HSP 7 Score: 64.3142 bits (155), Expect = 7.059e-10
Identity = 43/134 (32.09%), Postives = 68/134 (50.75%), Query Frame = 2
Query: 2219 ENQCPQNYRRCN-NGECQPSGKFCDGVANCADRSDENPSVCNKCDPLIN--KCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILPQVT 2611
            E  C  N  +C     C P    CD   +C D SDE P+ C +    ++  +C+  G  +P +      WKCDGE+DCG++ DE +   ++  C   +F C N + +P  +QCD ++DC +  DE  C+  Q +
Sbjct: 3433 EVTCAPNQFQCTITKRCIPRVWMCDRDNDCVDGSDE-PANCTQMTCGVDEFRCKDSGRCIPAR------WKCDGEDDCGDSSDEPKEECDERTCEPYQFRCKNNRCVPGRWQCDYDNDCGDNSDEDDCVPRQCS 3559          

HSP 8 Score: 64.3142 bits (155), Expect = 7.745e-10
Identity = 45/129 (34.88%), Postives = 61/129 (47.29%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNK-CDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYK--CGNIKFNCSNGKVIPRAYQCDKESDCSNGEDE-VGCILP 2602
            C  N   C N  C  +   CDG  +C D +DE+    NK C P   +C      VP +      W CDG+ DC +  DES      +K  C   +F C N + IP+ + CD ++DC +G DE V C  P
Sbjct: 2718 CTANQFECGNHRCISNSWVCDGADDCGDGTDEDSRCKNKTCSPDAFQCPDSHKCVPQR------WVCDGDRDCPDGADESVKARCTFKNTCEAGEFMCQNKQCIPKHFVCDHDNDCGDGSDESVECEYP 2840          

HSP 9 Score: 63.929 bits (154), Expect = 9.565e-10
Identity = 52/157 (33.12%), Postives = 75/157 (47.77%), Query Frame = 2
Query: 2225 QCPQNYRRCNNGECQPSGKFCDGVANCADRSDE---NPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIK-FNCSNGKV-IPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCESY 2680
            +C  +  +C NG C P    CD   +C D SDE   +  V  +C PL  +C    N    K      W+CDGE+DCG+N DE+  +   ++C   + F C N +V +P + QCD   DC +  DE+ C  P  T   D       +  S+ LRC  +
Sbjct: 3595 KCDSDEFQCKNGHCIPFRWRCDADPDCMDGSDEKNCSSEVTRQC-PLEFQC----NNTLCKPA---GWRCDGEDDCGDNSDENPEDCKRFQCPPTRQFRCYNDRVCLPVSKQCDGIDDCGDNSDELNCQTPSTTCGKDEFTCSNGKCISSNLRCNYF 3743          

HSP 10 Score: 63.5438 bits (153), Expect = 1.352e-9
Identity = 41/127 (32.28%), Postives = 60/127 (47.24%), Query Frame = 2
Query: 2219 ENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNK--CDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            ++ CP +  +C N  C P    CDG  +C +  DE+ S C+   C P    C   G  +P      I W CD ++DCG+  DE             +F C NG+ I   ++CD ++DC +  DE GC
Sbjct:  876 QHTCPTDRFKCQNNRCIPMRWLCDGDNDCGNDEDESNSTCSARTCPPNQFSCA-SGRCIP------ISWTCDLDDDCGDRSDEPASCAYPTCFPLTQFTCDNGRCININWRCDNDNDCGDNSDEAGC 995          

HSP 11 Score: 62.3882 bits (150), Expect = 2.589e-9
Identity = 49/176 (27.84%), Postives = 75/176 (42.61%), Query Frame = 2
Query: 2174 ECHDGI--RVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSV-CNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNEN----DYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCESY 2680
            +C DG    VK+   F +N C      C N +C P    CD   +C D SDE+       C P   +C         + +    W+CDGE DC +  DE+  N N    + KC   ++ C NGK +     CD   DC +G DE+ C + +  +   +   ++  +     +C  Y
Sbjct: 2783 DCPDGADESVKARCTF-KNTCEAGEFMCQNKQCIPKHFVCDHDNDCGDGSDESVECEYPTCKPNEFRC------ANGRCLIQSSWQCDGEFDCHDQSDEAPKNPNCSGPEKKCNETEYTCRNGKCVNETLLCDYSDDCGDGSDELNCFVNECLNSKLSGCSQLCEDQKIGFKCRCY 2951          

HSP 12 Score: 61.6178 bits (148), Expect = 5.674e-9
Identity = 41/121 (33.88%), Postives = 61/121 (50.41%), Query Frame = 2
Query: 2225 QCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCN-KCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDE 2584
            QC ++   C NG C      CDG  +C D SDEN   C+ KCD    +C+  G+ +P +      W+CD + DC +  DE  C+    +   ++F C+N    P  ++CD E DC +  DE
Sbjct: 3557 QCSESEFACTNGRCIAGRWKCDGDHDCVDGSDENG--CDVKCDSDEFQCK-NGHCIPFR------WRCDADPDCMDGSDEKNCSSEVTRQCPLEFQCNNTLCKPAGWRCDGEDDCGDNSDE 3668          

HSP 13 Score: 61.2326 bits (147), Expect = 5.869e-9
Identity = 75/306 (24.51%), Postives = 129/306 (42.16%), Query Frame = 2
Query: 1703 DFINTKVKWSFKSRDGTVVISSLENENRWEISNSPETPETSFISISSSLYKDGGFYICTTTEGLRRTAELVIKRREDSTLLTITPEIVRVRNGQPVVVECFSVSEKTGEPYGEPKFTMEYGKSLSTDPRLVEQKVGQSRVRLSIKDGLQTSDNNLKVECHDGIRVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCN--KCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSN-GKVIPRAYQCDKESDCSNGEDEVGCILPQVT 2611
            DFIN ++ W+  +R+  +  S L+  NR  + N  + P       + +L+++  ++    T+ + R  + +   +   T+L  T         +P+ +  F        PY +P+ T          P   +     +   LS   G        K  C     + +      + C  +   C N +C P    CD   +C DRSDE P+ C   KC P   +C++     P        + CDG+NDC +  DE+ C+   + C   +F C+N  + IP  ++C+ + +C  GEDE  C  P+VT
Sbjct: 3180 DFINDRIYWA-DAREDYIEFSDLDGTNRHTVLNQ-DIPHI----FAMTLFEEFIYWTDWETKSINRAHKTLGTNK---TMLISTLH-------RPMDIHIF-------HPYRQPEVT--------NHPCQTDNGGCSNLCLLSPGGGY-------KCACPTNFYLAADGKQCLSNCTASQFVCKNDKCIPFWWKCDTEDDCGDRSDE-PADCPEFKCRPGQFQCKMGICTNPA-------YICDGDNDCQDGSDETNCDI--HVCLPSQFKCTNPSRCIPGIFRCNGQDNCGEGEDEKDC--PEVT 3435          

HSP 14 Score: 58.9214 bits (141), Expect = 3.226e-8
Identity = 41/116 (35.34%), Postives = 50/116 (43.10%), Query Frame = 2
Query: 2240 YRRCN-NGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDE 2584
            Y+RC     C      CDG  +C D SDE  +     DP   KC       P      + W CD ENDC N  DE  C   D  C   +F C N + I  ++ CD   DC +G DE
Sbjct: 2638 YQRCEFTTLCYAPSWVCDGANDCGDYSDEM-NCPGPTDPSKRKCPPSFFACPSGRCIPMTWTCDKENDCENGADEVNC---DKICTANQFECGNHRCISNSWVCDGADDCGDGTDE 2749          

HSP 15 Score: 56.9954 bits (136), Expect = 1.182e-7
Identity = 41/123 (33.33%), Postives = 59/123 (47.97%), Query Frame = 2
Query: 2219 ENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCS-NGKVIPRAYQCDKESDCSNGEDE 2584
            E +C     +C  G C      CDG  +C D SDE     + C P   KC      +P   IF    +C+G+++CG   DE  C E    C   +F C+   + IPR + CD+++DC +G DE
Sbjct: 3354 EFKCRPGQFQCKMGICTNPAYICDGDNDCQDGSDETNCDIHVCLPSQFKCTNPSRCIP--GIF----RCNGQDNCGEGEDEKDCPE--VTCAPNQFQCTITKRCIPRVWMCDRDNDCVDGSDE 3468          

HSP 16 Score: 53.9138 bits (128), Expect = 9.821e-7
Identity = 37/119 (31.09%), Postives = 56/119 (47.06%), Query Frame = 2
Query: 2222 NQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNK--------CDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCG-NIKFNCSN-GKVIPRAYQC 2548
            + C     +CN+G C P    CDG  +C D SDEN + C          C     +C++ G  +PL+      W+CDG+ DC +  DE  C    + C   +KF C +  + I +A+ C
Sbjct:  997 HSCSSTQFKCNSGRCIPDYWKCDGDNDCGDYSDENNANCTNHATRPPGGCHTDEFQCQMDGLCIPLR------WRCDGDTDCMDLSDEKNCEGVTHMCDPAVKFGCRDSARCISKAWVC 1109          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001137.1 (pep scaffold:Pmarinus_7.0:GL476464:95621:179961:-1 gene:ENSPMAG00000001008.1 transcript:ENSPMAT00000001137.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.7146 bits (182), Expect = 8.787e-14
Identity = 49/132 (37.12%), Postives = 65/132 (49.24%), Query Frame = 2
Query: 2222 NQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLIN------KCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCG-NIKFNC-SNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            N C  +   C NG C PS   CDG  +C D SDE  +      PL        +C I GN +PL+      W+CDG+ DC +  DE +C+     C     F C SNG  I +A+ CD ++DC +  DE GC
Sbjct:  148 NTCADSQFSCKNGHCIPSQWVCDGDNDCGDVSDETHTCEFPARPLRQCREDEFRCAINGNCIPLR------WRCDGDADCMDISDEKECDGQRRTCNPGTHFTCVSNGICIRKAWVCDGDNDCEDNSDEAGC 273          

HSP 2 Score: 73.559 bits (179), Expect = 2.015e-13
Identity = 58/192 (30.21%), Postives = 79/192 (41.15%), Query Frame = 2
Query: 2198 KSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFL-------IHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCESYGVPRPHIVWRYNWGCLSDSLRMTI 2752
            +S T      CP     C NG+C P    CD   +C+D SDE PS              Y   +PL            I W+CD +NDC ++ DE+ CN     C + +F+C NG  IP  + CD ++DC +  DE        T   +   R +R+    E RC   G   P       W C  D+  M I
Sbjct:   61 ESNTTCTVRTCPAEQFTCGNGKCIPIAWKCDLDNDCSDNSDEPPSC------------AYPTCLPLTQFSCNNGRCINIRWRCDSDNDCADSSDEAGCNNT---CADSQFSCKNGHCIPSQWVCDGDNDCGDVSDE--------THTCEFPARPLRQCREDEFRCAINGNCIP-----LRWRCDGDADCMDI 224          

HSP 3 Score: 72.0182 bits (175), Expect = 6.006e-13
Identity = 43/114 (37.72%), Postives = 62/114 (54.39%), Query Frame = 2
Query: 2285 CDGVANCADRSDENPSVCNKCDPLINKCEIYGNK-VPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDE-VGCILPQVTSMT 2620
            CDG  +C D SDE P +C +   + ++ +   N+ +P++      W CDG+NDCG N DES        C   +F C NGK IP A++CD ++DCS+  DE   C  P    +T
Sbjct:    8 CDGDNDCQDGSDELPEICQQHTCISDRFKCKNNRCIPMR------WLCDGDNDCGENEDESNTTCTVRTCPAEQFTCGNGKCIPIAWKCDLDNDCSDNSDEPPSCAYPTCLPLT 115          

HSP 4 Score: 62.7734 bits (151), Expect = 4.345e-10
Identity = 39/116 (33.62%), Postives = 55/116 (47.41%), Query Frame = 2
Query: 2246 RCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            RC N  C P    CD   +C D SDE       C      C   G  +  +      W+CDG++DC +  DE  C+    +C   +F C NG  IP+ ++CD ++DC +G DE  C
Sbjct:  882 RCKNNRCIPGRWHCDYDNDCGDNSDEEGCTPRPCSESEFSC-ANGRCIAGR------WRCDGDHDCMDGSDEKDCS---LRCEQDQFQCQNGHCIPQRWRCDNDADCLDGSDEENC 987          

HSP 5 Score: 61.6178 bits (148), Expect = 9.147e-10
Identity = 38/128 (29.69%), Postives = 59/128 (46.09%), Query Frame = 2
Query: 2210 IFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            I  ++ C  +  +C N  C P    CDG  +C +  DE+ + C      +  C              I WKCD +NDC +N DE             +F+C+NG+ I   ++CD ++DC++  DE GC
Sbjct:   24 ICQQHTCISDRFKCKNNRCIPMRWLCDGDNDCGENEDESNTTCT-----VRTCPAEQFTCGNGKCIPIAWKCDLDNDCSDNSDEPPSCAYPTCLPLTQFSCNNGRCINIRWRCDSDNDCADSSDEAGC 146          

HSP 6 Score: 55.0694 bits (131), Expect = 9.107e-8
Identity = 29/78 (37.18%), Postives = 40/78 (51.28%), Query Frame = 2
Query: 2366 CEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCIL 2599
            CE Y  +          W CD +NDCG+N DE  C      C   +F+C+NG+ I   ++CD + DC +G DE  C L
Sbjct:  876 CEPYQFRCKNNRCIPGRWHCDYDNDCGDNSDEEGCTPR--PCSESEFSCANGRCIAGRWRCDGDHDCMDGSDEKDCSL 951          

HSP 7 Score: 51.9878 bits (123), Expect = 9.079e-7
Identity = 36/119 (30.25%), Postives = 56/119 (47.06%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDE 2584
            C ++   C NG C      CDG  +C D SDE      +C+    +C+  G+ +P +      W+CD + DC +  DE  C      C   +F C++    P +++CD E DC +  DE
Sbjct:  915 CSESEFSCANGRCIAGRWRCDGDHDCMDGSDEKDCSL-RCEQDQFQCQ-NGHCIPQR------WRCDNDADCLDGSDEENCGSAVRLCPKDEFQCNSTLCKPFSWRCDGEDDCGDNSDE 1025          

HSP 8 Score: 48.9062 bits (115), Expect = 6.562e-6
Identity = 40/136 (29.41%), Postives = 65/136 (47.79%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCN--KCDPLIN-KCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNE----------NDYKCGNIKFNCSNGKVIPRAYQCDKESDCSN-GEDEVGC 2593
            CP++  +CN+  C+P    CDG  +C D SDE+   C   +C P    +C      V L  +      CDG N+CG++ DE  C E           ++KC +++  C + +++     C+   DC + G DE+ C
Sbjct:  994 CPKDEFQCNSTLCKPFSWRCDGEDDCGDNSDEDADHCRAFQCPPRRQFRCRNDRVCVSLDRV------CDGINNCGDHSDEEHCGEPARGARACTAEEFKCDSLERKCIDVRLL-----CNHHDDCGDGGSDEMAC 1118          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Sea Lamprey
Match: lrp1ab (low density lipoprotein receptor-related protein 1Ab [Source:ZFIN;Acc:ZDB-GENE-030131-7126])

HSP 1 Score: 73.9442 bits (180), Expect = 1.818e-13
Identity = 46/134 (34.33%), Postives = 68/134 (50.75%), Query Frame = 2
Query: 2225 QCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNK-VPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDE-VGCILPQVTSMT 2620
            QC      C NG C      CDG  +C D SDE P +C++     ++ +   N+ +PL+      W CDG+NDCGN+ DES        C   +F+C++G  IP +++CD + DC +  DE   C  P    +T
Sbjct:  826 QCHPGEFACKNGRCIQERWRCDGDNDCLDNSDEAPEICHQHTCPSDRFKCQNNRCIPLR------WLCDGDNDCGNSEDESNTTCAARTCPPNQFSCASGHCIPMSWKCDLDDDCGDRSDEPPSCAYPTCFPLT 953          

HSP 2 Score: 70.8626 bits (172), Expect = 1.647e-12
Identity = 45/131 (34.35%), Postives = 63/131 (48.09%), Query Frame = 2
Query: 2198 KSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCN-KCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEV 2587
            +S T      CP N   C +G C P    CD   +C DRSDE PS     C PL       G  + +      +W+CD +NDC +  DE  CN   + C   +F C++G+ IP  + CD ++DC +  DE 
Sbjct:  899 ESNTTCAARTCPPNQFSCASGHCIPMSWKCDLDDDCGDRSDEPPSCAYPTCFPLTQFACNNGRCINM------NWRCDADNDCADASDEIGCN---HSCSISQFKCNSGRCIPSHWTCDGDNDCGDFSDET 1020          

HSP 3 Score: 70.4774 bits (171), Expect = 2.104e-12
Identity = 50/170 (29.41%), Postives = 72/170 (42.35%), Query Frame = 2
Query: 2225 QCPQNYRRCNNGECQPSGKFCDGVANCADRSDE---NPSVCN----------------KCDPLINKCEIYGNKVPLKDIFLIH------------------------WKCDGENDCGNNFDESQCNENDYK--CGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCIL 2599
            QC   Y  C NG C  + K C+GV +C D SDE   N S C                 +C+ +++ C+   +++    +   H                        W CDG NDCG+  DE  C +      C    FNC +G  IP A++CD+E DC +G DE+ C +
Sbjct: 2542 QCKNGYVNCLNGRCMETLKLCNGVNDCGDNSDEIACNNSTCGADEFRCGDGSCIANVTRCNQVVD-CDDISDEIGCGPMNCTHYHRLGVQASGYVSCNSTSLCVLPAWICDGANDCGDYADEKNCKKKSGSPGCSPDYFNCPSGPCIPTAWKCDREPDCDDGADELNCDM 2710          

HSP 4 Score: 69.3218 bits (168), Expect = 4.349e-12
Identity = 60/184 (32.61%), Postives = 85/184 (46.20%), Query Frame = 2
Query: 2144 LQTSDNNLKVECHDGIRV---KSATIFLENQCP-QNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCN--KCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCES 2677
            L T D  +  +C  G RV    +  +  +N C  Q    CNNG+C      CDGVA+C D+SDE P  C   +C      C    N   ++ + L    C+G NDCG+N DE  CN +   CG  +F C +G  I    +C++  DC +  DE+GC       M      R+  + S  + C S
Sbjct: 2471 LITEDGRVNCKCR-GERVLVDGTRCVARKNSCDLQTEFECNNGDCIRYHLTCDGVADCKDKSDEKPFYCTSRQCKNGYVNCL---NGRCMETLKL----CNGVNDCGDNSDEIACNNS--TCGADEFRCGDGSCIANVTRCNQVVDCDDISDEIGC-----GPMNCTHYHRLGVQASGYVSCNS 2639          

HSP 5 Score: 68.1662 bits (165), Expect = 1.073e-11
Identity = 46/141 (32.62%), Postives = 70/141 (49.65%), Query Frame = 2
Query: 2201 SATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNK--------CDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCG-NIKFNCSN-GKVIPRAYQCDKESDCSNGEDEVGC 2593
            S  I   + C  +  +CN+G C PS   CDG  +C D SDE    C K        C     +C+  G  +PL+      W+CDG+ DC +  DE +C+     C   ++F+C + G+ I + + CD ++DC +  DE GC
Sbjct:  979 SDEIGCNHSCSISQFKCNSGRCIPSHWTCDGDNDCGDFSDETNPNCTKLATRPPGGCHGDEFQCKADGQCIPLR------WRCDGDTDCIDTSDEKECDGVVRTCDPTLQFSCRDTGRCISKTWFCDGDNDCEDNSDEEGC 1113          

HSP 6 Score: 67.781 bits (164), Expect = 1.249e-11
Identity = 41/134 (30.60%), Postives = 67/134 (50.00%), Query Frame = 2
Query: 2198 KSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNK--CDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            ++  I  ++ CP +  +C N  C P    CDG  +C +  DE+ + C    C P    C   G+ +P+       WKCD ++DCG+  DE             +F C+NG+ I   ++CD ++DC++  DE+GC
Sbjct:  858 EAPEICHQHTCPSDRFKCQNNRCIPLRWLCDGDNDCGNSEDESNTTCAARTCPPNQFSCA-SGHCIPMS------WKCDLDDDCGDRSDEPPSCAYPTCFPLTQFACNNGRCINMNWRCDADNDCADASDEIGC 984          

HSP 7 Score: 63.929 bits (154), Expect = 1.860e-10
Identity = 51/154 (33.12%), Postives = 70/154 (45.45%), Query Frame = 2
Query: 2225 QCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGK-VIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCESYG 2683
            +C     +C NG C      CDG  +C D SDE     + C P   KC      +P   IF    +C+G+++CG+  DE  C E    C   +F CS+ K  IPR + CD+++DC +G DE        T MT          G  E RC+  G
Sbjct: 3342 KCRPGQFQCKNGICTNPAFICDGDNDCGDGSDEANCDVHVCLPSQFKCRTTHRCIP--GIF----RCNGQDNCGDGEDEKDCPE--VTCAPNQFQCSSTKRCIPRVWVCDRDNDCGDGSDEPA----NCTQMT---------CGQEEFRCKGTG 3474          

HSP 8 Score: 62.003 bits (149), Expect = 7.612e-10
Identity = 39/116 (33.62%), Postives = 55/116 (47.41%), Query Frame = 2
Query: 2246 RCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            RC N  C P    CD   +C D SDE       C      C   G  +  +      W+CDG++DC +  DE  C+    +C + +F C NG  IP+ ++CD + DC +G DE  C
Sbjct: 3511 RCKNNRCVPGRWQCDYDNDCGDNSDEEGCTPRPCSESEFSCA-NGRCIAGR------WRCDGDHDCSDGSDEKDCSP---RCDHDQFQCRNGHCIPQRWRCDADIDCIDGSDEDNC 3616          

HSP 9 Score: 60.8474 bits (146), Expect = 1.815e-9
Identity = 46/157 (29.30%), Postives = 74/157 (47.13%), Query Frame = 2
Query: 2171 VECHDGIRVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNK--CDPLINKCEIYGNKVPLKDIFLIHW---KCDGENDCGNNFDESQ----------CNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSN-GEDEVGC 2593
            ++C DG    +    +   CP +  +CNN  C+P    CDG  +C D SDE P +C K  C P        G +   ++  +  W   +CDG ++CG+  DE            CN +++KCG  +  C + +++     C++  DC + G DEV C
Sbjct: 3605 IDCIDGSDEDNCAAIVRT-CPHHEFQCNNTLCKPLSWKCDGEDDCGDNSDETPEMCLKFQCPP--------GRQFRCRNNRVCFWAGRQCDGVDNCGDGSDEENCEKPSPKPRICNSSEFKCGGTERKCISTQLV-----CNRFDDCGDGGSDEVAC 3747          

HSP 10 Score: 60.077 bits (144), Expect = 3.011e-9
Identity = 45/124 (36.29%), Postives = 67/124 (54.03%), Query Frame = 2
Query: 2249 CNNGECQPSGKFCDGVANCADRSDENPSVCN--KCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNC-SNGKVIPRAYQCDKESDCSNGEDEVGCILPQVT 2611
            C N +C P    CD   +C DRSDE P+ C   KC P   +C+   N +     F+    CDG+NDCG+  DE+ C+   + C   +F C +  + IP  ++C+ + +C +GEDE  C  P+VT
Sbjct: 3310 CKNDKCIPFWWKCDTEDDCGDRSDE-PADCPDFKCRPGQFQCK---NGICTNPAFI----CDGDNDCGDGSDEANCDV--HVCLPSQFKCRTTHRCIPGIFRCNGQDNCGDGEDEKDC--PEVT 3421          

HSP 11 Score: 59.6918 bits (143), Expect = 4.149e-9
Identity = 42/128 (32.81%), Postives = 61/128 (47.66%), Query Frame = 2
Query: 2225 QCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCG-NIKFNCSNGKVIPRA-YQCDKESDCSNGEDEVGCILP 2602
            +C  +  +C NG C P    CD   +C D SDE+      C  ++  C  +  +        + WKCDGE+DCG+N DE+      ++C    +F C N +V   A  QCD   +C +G DE  C  P
Sbjct: 3581 RCDHDQFQCRNGHCIPQRWRCDADIDCIDGSDED-----NCAAIVRTCPHHEFQCNNTLCKPLSWKCDGEDDCGDNSDETPEMCLKFQCPPGRQFRCRNNRVCFWAGRQCDGVDNCGDGSDEENCEKP 3703          

HSP 12 Score: 56.6102 bits (135), Expect = 3.418e-8
Identity = 38/120 (31.67%), Postives = 57/120 (47.50%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEV 2587
            C ++   C NG C      CDG  +C+D SDE      +CD    +C   G+ +P +      W+CD + DC +  DE  C      C + +F C+N    P +++CD E DC +  DE 
Sbjct: 3544 CSESEFSCANGRCIAGRWRCDGDHDCSDGSDEK-DCSPRCDHDQFQCR-NGHCIPQR------WRCDADIDCIDGSDEDNCAAIVRTCPHHEFQCNNTLCKPLSWKCDGEDDCGDNSDET 3655          

HSP 13 Score: 51.9878 bits (123), Expect = 7.615e-7
Identity = 32/85 (37.65%), Postives = 43/85 (50.59%), Query Frame = 2
Query: 2417 WKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRC 2671
            WKCD E+DCG+  DE   +  D+KC   +F C NG     A+ CD ++DC +G DE  C +  V   +  K R   R      RC
Sbjct: 3320 WKCDTEDDCGDRSDEPA-DCPDFKCRPGQFQCKNGICTNPAFICDGDNDCGDGSDEANCDV-HVCLPSQFKCRTTHRCIPGIFRC 3402          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Sea Lamprey
Match: lrp2a (low density lipoprotein receptor-related protein 2a [Source:ZFIN;Acc:ZDB-GENE-050119-2])

HSP 1 Score: 68.5514 bits (166), Expect = 8.129e-12
Identity = 44/128 (34.38%), Postives = 58/128 (45.31%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENP-SVCNK--CDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILP 2602
            CP     C++G C P    CDG  +C D SDE+    C    C P    C       P +      + CDG+ DC +  DE Q N     C   +F C NG  +   Y+CD+ +DC +G DE GC  P
Sbjct: 2868 CPGTQFTCDSGRCIPGSWICDGDNDCGDGSDEDGRHACGARTCGPHEFTCA--DASPPRRRCIQRRFVCDGDADCSDALDEHQ-NCTRRSCTAGEFACDNGLCVHSRYRCDRRNDCGDGSDERGCTYP 2992          

HSP 2 Score: 65.4698 bits (158), Expect = 6.593e-11
Identity = 43/133 (32.33%), Postives = 59/133 (44.36%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDA 2626
            C     RC +G C P    CD + +C+D SDE       C  L  +C    +   +   F+    CDGE DC +  DE Q N     C +  F C++G  +  A++CD   DC +  DE  C  P    MT A
Sbjct:    1 CDSGQFRCGSGACIPRSWVCDSINDCSDDSDERGCSPATCTTLQFRCR--SDNRCIARAFV----CDGEADCADRSDEHQ-NCPGSTCSSSHFTCASGHCVQSAFRCDHFQDCDDRSDEQSCQYPTCAEMTCA 126          

HSP 3 Score: 65.4698 bits (158), Expect = 6.762e-11
Identity = 44/128 (34.38%), Postives = 64/128 (50.00%), Query Frame = 2
Query: 2219 ENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLIN-KCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCIL 2599
            E  C  NYR      C P+   C+G+ +C D SDE       CDPL + +C+ +   +PL+      W+CD  +DCG+  DE  C      C   +F C+N + IP  + C+ E+DC +  DE  C L
Sbjct: 3648 EFACRTNYR------CIPTWAVCNGMDDCRDNSDEQGCAEITCDPLGDYRCDNH-RCIPLR------WRCDRYDDCGDGSDERNCAPR--PCSESEFRCTNQRCIPGRWVCNHENDCGDNSDERDCEL 3760          

HSP 4 Score: 63.929 bits (154), Expect = 1.991e-10
Identity = 50/154 (32.47%), Postives = 66/154 (42.86%), Query Frame = 2
Query: 2216 LENQCPQ----NYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNK--CDPLINKCE----IYGNKVPLK-------DIFLI---------HWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCIL 2599
            LE   PQ     +  C NG C P    CDG  +C D SDE         C P    C     I  +  P +       D F           +W CD +NDCG+  DE  C+ +   C  ++F C + + I  AY CD +SDC +G DE GC+ 
Sbjct:  995 LEPPTPQCSSTEFFACANGRCVPRLFLCDGYDDCHDGSDERGCGTGNVTCSPYAFTCTNRRCIPIDWRPTRLATTCRADQFTCASGNRCIPRYWICDTDNDCGDGSDERGCDMSG-TCHPMQFQCPDHRCIDNAYVCDGDSDCVDGADERGCVF 1147          

HSP 5 Score: 61.6178 bits (148), Expect = 9.094e-10
Identity = 45/159 (28.30%), Postives = 65/159 (40.88%), Query Frame = 2
Query: 2231 PQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVC--NKCDPLINKC----------EIYGNK-------------VPLKDIFL-------------IHWKCDGENDCGNNFDE-SQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVG 2590
            P     C NG C    + C+GV NC D +  +   C    C P + KC           + G               +PL   F+             + W CD E DC +N DE S C++    C   +F C +G+ IP ++ CD ++DC +G DE G
Sbjct: 2743 PAAEFACTNGRCIARSQVCNGVNNCRDNATSDEQRCPERTCQPGLLKCLTTNICVLRHYLSGGAAEWRRNDLRRPPPLPLHTCFIANEFRCGNGQCIPLSWVCDSEQDCTDNADEPSSCSDPGRTCPGTQFTCDSGRCIPGSWICDGDNDCGDGSDEDG 2901          

HSP 6 Score: 59.3066 bits (142), Expect = 5.673e-9
Identity = 37/123 (30.08%), Postives = 57/123 (46.34%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCI 2596
            C  ++  C +G C  S   CD   +C DRSDE       C  +                F    +CDG  +C +  DE+ C     +C   +F C+N + +P++Y+CD   DC++G DE GC+
Sbjct:   81 CSSSHFTCASGHCVQSAFRCDHFQDCDDRSDEQSCQYPTCAEMT---------CANGACFNTAQRCDGVVNCRDLSDEANCTA---RCPVGEFQCANERCVPQSYRCDHIDDCTDGSDENGCV 191          

HSP 7 Score: 58.9214 bits (141), Expect = 7.686e-9
Identity = 42/121 (34.71%), Postives = 54/121 (44.63%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNI-KFNCSNGKVIPRAYQCDKESDCSNGEDEV 2587
            C   Y +C +G C P    CDG A+C D SDE  S+C    P    C     +          WKCDG+NDCG+  DE   +  D  C    +F C N + I     C+   DC +G DE 
Sbjct: 3763 CLPGYFQCGSGHCIPERLKCDGSADCQDFSDE--SLCPTRYPNGTWCPPSSFECDNHVCIPPSWKCDGDNDCGDGSDEELHHCLDTPCNPPGRFRCDNNRCIYSHEICNAVDDCGDGSDET 3881          

HSP 8 Score: 58.151 bits (139), Expect = 1.182e-8
Identity = 41/122 (33.61%), Postives = 56/122 (45.90%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQC---NENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDE 2584
            C ++  RC N  C P    C+   +C D SDE       C P   +C   G+ +P +       KCDG  DC +  DES C     N   C    F C N   IP +++CD ++DC +G DE
Sbjct: 3724 CSESEFRCTNQRCIPGRWVCNHENDCGDNSDERDCELQTCLPGYFQCG-SGHCIPER------LKCDGSADCQDFSDESLCPTRYPNGTWCPPSSFECDNHVCIPPSWKCDGDNDCGDGSDE 3838          

HSP 9 Score: 55.4546 bits (132), Expect = 6.947e-8
Identity = 42/133 (31.58%), Postives = 64/133 (48.12%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVC--NKCDPLI------NKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDES--QCNENDYK-CGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            CP +   C+N  C P    CDG  +C D SDE    C    C+P        N+C IY +++           C+  +DCG+  DE+  +C E  +  C   +F C++G+ IP A  C+  ++C +  DE GC
Sbjct: 3807 CPPSSFECDNHVCIPPSWKCDGDNDCGDGSDEELHHCLDTPCNPPGRFRCDNNRC-IYSHEI-----------CNAVDDCGDGSDETPDKCKEPTFAPCTEEEFKCASGRCIPMAAVCNNYNECRDNTDETGC 3927          

HSP 10 Score: 55.4546 bits (132), Expect = 7.246e-8
Identity = 41/126 (32.54%), Postives = 62/126 (49.21%), Query Frame = 2
Query: 2249 CNNG-ECQPSGKFCDGVANCADRSDE------NPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQ-CNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILP 2602
            C++G +C  +   CDG  +C DRSDE       P +C+  D    +C+  G  +P        W+CDG  DC +  DE   C       G ++  C NG  +P +++CD ++DC +G DE  C  P
Sbjct: 1156 CSSGDQCIATYYRCDGAFDCRDRSDEVGCPTRAPGLCHN-DEF--QCQSDGLCIPAG------WECDGHPDCDDGSDEHPGCPPRTCAAGYLR--CDNGNCVPESWRCDGDNDCRDGTDERDCPTP 1270          

HSP 11 Score: 55.0694 bits (131), Expect = 9.411e-8
Identity = 40/117 (34.19%), Postives = 54/117 (46.15%), Query Frame = 2
Query: 2249 CNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQ--CNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            C+NG C  S   CD   +C D SDE       C      CE   N   +  IF     CDG+NDCG+  DE    C++    C    F C  G+ +     C++ +DC++G DE GC
Sbjct: 2962 CDNGLCVHSRYRCDRRNDCGDGSDERGCTYPTCRQNQFTCE---NGRCIPRIF----ACDGDNDCGDGSDEDTHLCHQPSPTCAPGFFRCGAGECVAIHLVCNQANDCADGSDEKGC 3071          

HSP 12 Score: 54.6842 bits (130), Expect = 1.222e-7
Identity = 40/114 (35.09%), Postives = 58/114 (50.88%), Query Frame = 2
Query: 2252 NNGECQPSGKFCDGVANCADRSDENPSVCNK-CDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGN-IKFNCSNGKV-IPRAYQCDKESDCSNGEDE 2584
            ++G C P+G  CDG  +C D SDE+P    + C     +C+  GN VP        W+CDG+NDC +  DE  C    Y+C +  ++ C N +  +     CD   DC +G DE
Sbjct: 1201 SDGLCIPAGWECDGHPDCDDGSDEHPGCPPRTCAAGYLRCD-NGNCVPES------WRCDGDNDCRDGTDERDCPTPPYRCQSPSQWLCPNHRACVDLRKVCDGNFDCPDGGDE 1307          

HSP 13 Score: 51.2174 bits (121), Expect = 1.434e-6
Identity = 38/126 (30.16%), Postives = 54/126 (42.86%), Query Frame = 2
Query: 2216 LENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKD-IFLIHWKCDGENDCGNNFDESQC-NENDYKCGNIKFNC-SNGKVIPRAYQCDKESDCSNGEDE 2584
            +   C     +C +  C  +   CDG ++C D +DE   V N        C  Y       D     +++CDG  DC +  DE  C       C N +F C S+G  IP  ++CD   DC +G DE
Sbjct: 1107 MSGTCHPMQFQCPDHRCIDNAYVCDGDSDCVDGADERGCVFN--------CTSYQFSCSSGDQCIATYYRCDGAFDCRDRSDEVGCPTRAPGLCHNDEFQCQSDGLCIPAGWECDGHPDCDDGSDE 1224          

HSP 14 Score: 50.0618 bits (118), Expect = 3.656e-6
Identity = 42/170 (24.71%), Postives = 66/170 (38.82%), Query Frame = 2
Query: 2207 TIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVC--------------------------------------NKCDPLINKCEIYGNKVPLKDIFLI-HWK-CDGENDCGNNFDESQCNENDYKCGNI-KFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            T+   ++C  N  +C N  C P+   CDG  +C D SDE+ + C                                      + C    ++C+ +       +   I  W  C+G +DC +N DE  C E    C  +  + C N + IP  ++CD+  DC +G DE  C
Sbjct: 3552 TLCFNHRCNSNQWQCMNKRCIPAAWLCDGGPDCQDGSDEDSATCAARTCAPGQFRCNNGRCIPRSWVCDVDDDCGDGSDEPHDTCMGPSHRCDSHTEFACRTNYRCIPTWAVCNGMDDCRDNSDEQGCAE--ITCDPLGDYRCDNHRCIPLRWRCDRYDDCGDGSDERNC 3719          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Sea Lamprey
Match: sorl1 (sortilin-related receptor, L(DLR class) A repeats containing [Source:ZFIN;Acc:ZDB-GENE-050208-22])

HSP 1 Score: 65.0846 bits (157), Expect = 7.201e-11
Identity = 46/137 (33.58%), Postives = 64/137 (46.72%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDE-------------NPSVCNKCDPLIN-KCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQC-NENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            C  +  +C +G C      CDGV +C D SDE              P+V  +C PL   +C  +   VP      + WKCD +NDCG+  DE  C ++    C   +F C +G  I   + CD   DC++G DE GC
Sbjct:  794 CTSSEFQCRSGVCISLHWKCDGVDDCGDYSDEANCRASCIICWSSGPTVAPRCLPLFQFQCRNH-RCVP------VWWKCDNDNDCGDWSDEDTCPSKLPSGCPAHQFRCGDGTCIFDHFVCDGSPDCADGSDEYGC 923          

HSP 2 Score: 64.6994 bits (156), Expect = 8.610e-11
Identity = 47/135 (34.81%), Postives = 62/135 (45.93%), Query Frame = 2
Query: 2228 CPQNYRRC-NNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQC--NENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEV----GCILPQVT 2611
            C  N  RC N+G C P    CD   +C D SDE P+ C        KC+               W+CDG+NDC +  DE  C  ++ +  C    F C +G  IPR + CD + DC +G DE     G + PQ T
Sbjct:  660 CGTNQFRCQNSGRCIPMSYKCDQEDDCGDNSDE-PADCPH-----QKCQATEFSCSNGRCVRSAWRCDGDNDCHDWSDEVNCSSSQGNISCSADGFQCPSGPCIPRRWLCDGDKDCLDGADEQQQCGGLVPPQPT 788          

HSP 3 Score: 60.077 bits (144), Expect = 2.313e-9
Identity = 40/142 (28.17%), Postives = 62/142 (43.66%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFL--------IHWKCDGENDCGNNFDESQCNENDYKCGN------------IKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            C  +  +C +G C P    CDG  +C D +DE      +C  L+      G+       F         +HWKCDG +DCG+  DE+ C  +   C +             +F C N + +P  ++CD ++DC +  DE  C
Sbjct:  744 CSADGFQCPSGPCIPRRWLCDGDKDCLDGADEQ----QQCGGLVPPQPTPGHLNCTSSEFQCRSGVCISLHWKCDGVDDCGDYSDEANCRASCIICWSSGPTVAPRCLPLFQFQCRNHRCVPVWWKCDNDNDCGDWSDEDTC 881          

HSP 4 Score: 52.373 bits (124), Expect = 6.254e-7
Identity = 41/134 (30.60%), Postives = 55/134 (41.04%), Query Frame = 2
Query: 2219 ENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDE-SQCN--------ENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
              +C      C+NG C  S   CDG  +C D SDE    C+     I+ C   G + P        W CDG+ DC +  DE  QC              C + +F C +G  I   ++CD   DC +  DE  C
Sbjct:  698 HQKCQATEFSCSNGRCVRSAWRCDGDNDCHDWSDE--VNCSSSQGNIS-CSADGFQCPSGPCIPRRWLCDGDKDCLDGADEQQQCGGLVPPQPTPGHLNCTSSEFQCRSGVCISLHWKCDGVDDCGDYSDEANC 828          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Sea Lamprey
Match: sorl1 (sortilin-related receptor, L(DLR class) A repeats containing [Source:ZFIN;Acc:ZDB-GENE-050208-22])

HSP 1 Score: 61.6178 bits (148), Expect = 7.614e-10
Identity = 41/135 (30.37%), Postives = 58/135 (42.96%), Query Frame = 2
Query: 2234 QNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKD---------IFLIHWKCDGENDCGNNFDESQCNEN---DYKCGNI---KFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            Q    C +G C P    CDG  +C D +DE      +  P    C +    +                +HWKCDG +DCG+  DE+ C E    +  C  +   +F C +G  I   + CD   DC++G DE GC
Sbjct: 1050 QGMECCPSGPCIPRRWLCDGDKDCLDGADEQQQCGTR--PPAMWCSMLHQPINCTSSEFQCRSGVCISLHWKCDGVDDCGDYSDEANCREMPSPEVVCCTVMIGEFRCGDGTCIFDHFVCDGSPDCADGSDEYGC 1182          

HSP 2 Score: 59.6918 bits (143), Expect = 3.533e-9
Identity = 48/152 (31.58%), Postives = 73/152 (48.03%), Query Frame = 2
Query: 2195 VKSATIFLENQCPQNYRRCNNGEC------QPSGKFC---DGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFL--------IHWKCDG-ENDCGNNFDE-SQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            +    IF   +    YR   NG C      +P+G+ C   DG+++    S +   +CN  DP ++        V  +  F         I WKCD  E+DCG+N DE + C     KC   +F+CSNG+ +  A++CD ++DC +  DEV C
Sbjct:  899 IMDMKIFYSGKQNSAYRTDKNGGCSHLCLPKPNGRTCQCPDGMSSVQQSSGD--FICNSRDPPVSDVRCGPELVCAESQFKCANGRCINILWKCDHDEDDCGDNSDEPADCPHQ--KCQATEFSCSNGRCVRSAWRCDGDNDCHDWSDEVNC 1046          

HSP 3 Score: 54.299 bits (129), Expect = 1.615e-7
Identity = 41/129 (31.78%), Postives = 59/129 (45.74%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKC-DPLINKCEIYGNKVPLKDIFLI--HWKCDGENDCGNNFDESQCNENDYK---CGNIKFNCSNGKV-IPRAYQCDKESDCSNGEDEVGC 2593
            C  +  +C +G C      CDGV +C D SDE  + C +   P +  C +   +    D   I  H+ CDG  DC +  DE  C     +   C   +F C   K  +P + +CD   DC +G DE+GC
Sbjct: 1101 CTSSEFQCRSGVCISLHWKCDGVDDCGDYSDE--ANCREMPSPEVVCCTVMIGEFRCGDGTCIFDHFVCDGSPDCADGSDEYGCPTQHGRPSPCSFTQFQCLKDKTCVPASARCDGRKDCVDGSDELGC 1227          

HSP 4 Score: 49.2914 bits (116), Expect = 4.588e-6
Identity = 44/152 (28.95%), Postives = 67/152 (44.08%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVAN-CADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNEND-YKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCES 2677
            C ++  +C NG C      CD   + C D SDE P+ C        KC+               W+CDG+NDC +  DE  C+ +   +C      C +G  IPR + CD + DC +G DE      +  +M  + + +     S+E +C S
Sbjct:  971 CAESQFKCANGRCINILWKCDHDEDDCGDNSDE-PADCPH-----QKCQATEFSCSNGRCVRSAWRCDGDNDCHDWSDEVNCSSSQGMEC------CPSGPCIPRRWLCDGDKDCLDGADEQQQCGTRPPAMWCSMLHQPINCTSSEFQCRS 1110          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Nematostella
Match: EDO45218 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTH9])

HSP 1 Score: 86.6557 bits (213), Expect = 3.562e-17
Identity = 50/148 (33.78%), Postives = 67/148 (45.27%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRC 2671
            C  NY RC N  C P    CD   +C D SDE       C P  + C     +   +    + W CD +NDC +N DE  C      C + +F+CSNG+ I R++ CD+++DC +G DE  C  P     T      I    S E  C
Sbjct: 1105 CASNYFRCANQRCIPMRWVCDFDNDCRDNSDER-----DCTPTFSTCASNYFRCANQRCIPMRWVCDFDNDCRDNSDERDCTPTGRSCNSGQFSCSNGRCISRSWVCDRDNDCGDGSDERNCSYPTTGPWTTRPWTPIFSCRSWEFSC 1247          

HSP 2 Score: 86.2705 bits (212), Expect = 4.874e-17
Identity = 70/227 (30.84%), Postives = 102/227 (44.93%), Query Frame = 2
Query: 1913 VIKRREDSTLLTITPEIVRVRNGQPVVVECFSVSEKTGEPYGEPKFTMEYGKSLSTDPRLVEQKVGQSRVRLSIKDGLQTSDNNLKVECHDGIRVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            V+ RR  + LL +   +V  R+    +   +++S      Y +   T    ++L  D        G SR   +IK GL T   +LKV   D     +        C     +C NG+C PS   CD   +C D SDEN    + C+P   KC+  G  +  K      W+CD +NDCG+  DE  C      C   +F C NGK IP +++CD ++DC +  DE  C
Sbjct:  868 VLTRRVSALLLAVLIHVVTSRS----IPHPYAISIFQQYMYWDDWSTRSIQRALKRD--------GSSR--FTIKSGL-TGVMDLKVFHQDAQTAGT--------CAPGQFKCGNGKCIPSSWKCDHDNDCGDNSDENNCPYSTCNPSQFKCD-NGRCISSK------WRCDHDNDCGDMSDERNCTGT---CAPGQFKCGNGKCIPSSWKCDHDNDCGDNSDENNC 1061          

HSP 3 Score: 73.559 bits (179), Expect = 3.331e-13
Identity = 44/122 (36.07%), Postives = 62/122 (50.82%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            C     +C NG+C PS   CD   +C D SDEN    + C+P   KC+  G  +  K      W+CD +NDCG+  DE  C  +   C +  F C+N + IP  + CD ++DC +  DE  C
Sbjct: 1027 CAPGQFKCGNGKCIPSSWKCDHDNDCGDNSDENNCPYSTCNPSQFKCD-NGRCISSK------WRCDHDNDCGDMSDERNCTFS--TCASNYFRCANQRCIPMRWVCDFDNDCRDNSDERDC 1139          

HSP 4 Score: 65.4698 bits (158), Expect = 1.147e-10
Identity = 43/141 (30.50%), Postives = 63/141 (44.68%), Query Frame = 2
Query: 2198 KSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDEN----PSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDE--SQCNENDY---KCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
             +AT F+   C     +C N  C  + + CDG  +C D SDE     P +   C     +C    + + +       W C+G  DC + +DE  +QC  +      C   ++ C NG  IP  Y+CD    CS+G DE GC
Sbjct: 1276 ATATPFVPRSCHYWEFQCANRRCVYNSQRCDGQNDCGDWSDETGCSTPPIPTTCPADWVRCFYNSSGLCIS----TSWLCNGRVDCPDAWDEQPAQCRTSPAPTRTCSPQEYQCDNGACIPSRYECDGRIQCSDGSDETGC 1412          

HSP 5 Score: 56.225 bits (134), Expect = 7.114e-8
Identity = 39/143 (27.27%), Postives = 58/143 (40.56%), Query Frame = 2
Query: 2249 CNNGECQPSGKFCDGVANCADRSDE--------NPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDY-----KCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRR 2638
            C+NG C      CD   +C D SDE         P       P+ + C  +               CDG +DCG++ DE  CN          C   +F C+N + +  + +CD ++DC +  DE GC  P + +   A   R
Sbjct: 1194 CSNGRCISRSWVCDRDNDCGDGSDERNCSYPTTGPWTTRPWTPIFS-CRSWEFSCLNGRCVFYRLVCDGVDDCGDSSDEMSCNATATPFVPRSCHYWEFQCANRRCVYNSQRCDGQNDCGDWSDETGCSTPPIPTTCPADWVR 1335          

HSP 6 Score: 54.6842 bits (130), Expect = 2.228e-7
Identity = 39/144 (27.08%), Postives = 61/144 (42.36%), Query Frame = 2
Query: 2216 LENQCPQNYRRC---NNGECQPSGKFCDGVANCADRSDENPSVCNK-------CDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNC-SNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTS 2614
            +   CP ++ RC   ++G C  +   C+G  +C D  DE P+ C         C P   +C+  G  +P +      ++CDG   C +  DE+ C           F C  N   +P   +CD   DC +  DE  C +P + S
Sbjct: 1325 IPTTCPADWVRCFYNSSGLCISTSWLCNGRVDCPDAWDEQPAQCRTSPAPTRTCSPQEYQCD-NGACIPSR------YECDGRIQCSDGSDETGCTATISPSSCPGFLCDGNTLCLPFYKRCDGSYDCKDYTDEFNCSMPLMVS 1461          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Nematostella
Match: EDO49498 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGB0])

HSP 1 Score: 81.6481 bits (200), Expect = 7.150e-16
Identity = 46/130 (35.38%), Postives = 67/130 (51.54%), Query Frame = 2
Query: 2204 ATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            A   +   C  +  RC NG+C+P    CDG  +C D SDE     + C P    C   G  +PL+      W+CDG+ DC +  DE  C   +  C + +F+CSNG+ I  A++CD + DC++  DE  C
Sbjct:   78 ANCSVATNCSASMFRCANGQCKPRDWVCDGFDDCGDGSDEKGCANHSCTPAQFSCP-SGRCIPLR------WRCDGDGDCSDGADERGCPPKN--CTDSQFSCSNGQCISLAWRCDGDHDCADKSDERNC 198          

HSP 2 Score: 67.781 bits (164), Expect = 1.319e-11
Identity = 48/131 (36.64%), Postives = 62/131 (47.33%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSN-GKVIPRAYQCDKESDCSNGEDE-VGCILPQVTS 2614
            C  +   C+NG+C      CDG  +CAD+SDE       C P    C    + +  K      W CDGENDCG+  DE  C      CGN ++ CSN  + I ++  CD   DC +  DE  GC L Q  S
Sbjct:  164 CTDSQFSCSNGQCISLAWRCDGDHDCADKSDERNCTGKTCKPFEFACANGRHCIQRK------WICDGENDCGDRSDEVDCGLE--SCGNDRWRCSNTSRCIAKSQVCDGRVDCPDASDEGPGCGLDQCHS 286          

HSP 3 Score: 62.003 bits (149), Expect = 9.381e-10
Identity = 46/129 (35.66%), Postives = 65/129 (50.39%), Query Frame = 2
Query: 2219 ENQCPQNYRRCNNG-ECQPSGKFCDGVANC--ADRSDE-NPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            E  C  +  RC    +C P    CDG  +C   D SDE N SV   C   + +C     +   +D     W CDG +DCG+  DE  C   ++ C   +F+C +G+ IP  ++CD + DCS+G DE GC
Sbjct:   40 EWSCRASEFRCQASRKCIPLSWRCDGDYDCLAPDLSDEANCSVATNCSASMFRCA--NGQCKPRD-----WVCDGFDDCGDGSDEKGCA--NHSCTPAQFSCPSGRCIPLRWRCDGDGDCSDGADERGC 159          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Nematostella
Match: EDO43726 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXU8])

HSP 1 Score: 74.3294 bits (181), Expect = 1.590e-13
Identity = 46/131 (35.11%), Postives = 68/131 (51.91%), Query Frame = 2
Query: 2216 LENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEI--YGNKVPLKDIFLIHWKCDGENDCGNNFDESQC---NENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            ++  C  N   C+NG+C  +   CDG  +C D SDE  S+C         C+I  +  +   +      WKCDG+NDC ++ DES C   + +  +C    F C NG+ +   ++CD E DCS+G DE GC
Sbjct:  116 VQRTCASNQFTCSNGDCISNSWTCDGDNDCNDGSDEKESLCAS-----KSCKITEFTCRTSRRKCIPSQWKCDGDNDCPDSSDESGCPTASVSPRRCSVGMFKCRNGECVLGHWRCDGEKDCSDGSDEKGC 241          

HSP 2 Score: 72.7886 bits (177), Expect = 4.116e-13
Identity = 42/114 (36.84%), Postives = 61/114 (53.51%), Query Frame = 2
Query: 2261 ECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILP 2602
            +C PS   CDG  +C D SDE  S C        +C +   K    +  L HW+CDGE DC +  DE  C +++  C + +F C+NG+ IP + +CD  S+C +  DE  C+ P
Sbjct:  174 KCIPSQWKCDGDNDCPDSSDE--SGCPTASVSPRRCSVGMFKCRNGECVLGHWRCDGEKDCSDGSDEKGCRKSN--CASSEFTCANGQCIPSSQRCDGTSNCRDSSDEKACVTP 283          

HSP 3 Score: 56.9954 bits (136), Expect = 3.155e-8
Identity = 37/108 (34.26%), Postives = 50/108 (46.30%), Query Frame = 2
Query: 2285 CDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIH--------WKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDE 2584
            CDG  +C+D SDE  S                 K  L+D F           WKCDGE+DC + +   + N  +  CG  +F CSN K I R++ CD + DC +  DE
Sbjct:   21 CDGEDDCSDGSDEQGSP----------------KTCLQDQFTCRNGKCIQATWKCDGEDDCRDGYRSDESNCGNVTCGADEFMCSNRKCISRSWTCDNQDDCGDNSDE 112          

HSP 4 Score: 56.225 bits (134), Expect = 5.266e-8
Identity = 40/127 (31.50%), Postives = 58/127 (45.67%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLI--------HWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDE 2584
            C Q+   C NG+C  +   CDG  +C D    + S C             GN     D F+          W CD ++DCG+N DE +       C + +F CSNG  I  ++ CD ++DC++G DE
Sbjct:   40 CLQDQFTCRNGKCIQATWKCDGEDDCRDGYRSDESNC-------------GNVTCGADEFMCSNRKCISRSWTCDNQDDCGDNSDEDR--NVQRTCASNQFTCSNGDCISNSWTCDGDNDCNDGSDE 151          

HSP 5 Score: 54.299 bits (129), Expect = 2.427e-7
Identity = 44/148 (29.73%), Postives = 62/148 (41.89%), Query Frame = 2
Query: 2174 ECHDGIRVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNC--SNGKVIPRAYQCDKESDCSNGEDEVGCILPQVT 2611
            +C DG R   +       C  +   C+N +C      CD   +C D SDE+ +V   C      C          D     W CDG+NDC +  DE +       C   +F C  S  K IP  ++CD ++DC +  DE GC    V+
Sbjct:   64 DCRDGYRSDESNCG-NVTCGADEFMCSNRKCISRSWTCDNQDDCGDNSDEDRNVQRTCASNQFTCSN-------GDCISNSWTCDGDNDCNDGSDEKESLCASKSCKITEFTCRTSRRKCIPSQWKCDGDNDCPDSSDESGCPTASVS 203          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Nematostella
Match: EDO43937 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXB7])

HSP 1 Score: 70.4774 bits (171), Expect = 9.050e-13
Identity = 47/128 (36.72%), Postives = 63/128 (49.22%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDE------NPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            C  +   CNNG+C  +   CDG ++C D SDE      +P  C   +          N   + D F    KCDGENDC +  DE  C    + C   +F C+NG+ I RA++CD E DC +  DE GC
Sbjct:   70 CDPSQHTCNNGQCIKASWLCDGASDCQDNSDEMNCPSRSPHTCAWSEFTC------ANGACVPDSF----KCDGENDCADGSDEKNCA---HTCSATEFRCNNGRCITRAFRCDDEDDCLDNSDEQGC 184          

HSP 2 Score: 51.9878 bits (123), Expect = 8.115e-7
Identity = 43/125 (34.40%), Postives = 63/125 (50.40%), Query Frame = 2
Query: 2225 QCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQC-NENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCI 2596
            +C     +C+N  C  S   CD   +C D SDE       CDP  + C    N   +K      W CDG +DC +N DE  C + + + C   +F C+NG  +P +++CD E+DC++G DE  C 
Sbjct:   30 KCASGMFQCHNQRCIQSSWRCDDRDDCGDNSDEKNCTRMTCDPSQHTCN---NGQCIK----ASWLCDGASDCQDNSDEMNCPSRSPHTCAWSEFTCANGACVPDSFKCDGENDCADGSDEKNCA 147          

HSP 3 Score: 48.9062 bits (115), Expect = 7.396e-6
Identity = 39/123 (31.71%), Postives = 59/123 (47.97%), Query Frame = 2
Query: 2228 CPQNYRRCNNGE-CQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            C  + RRC+NG  C    K CDG+ +CAD SDE       C      C+     +P+        +CDG ++CG+N DE  C+ +     ++   C NG+ + + + CD   DC +  DE  C
Sbjct:  240 CRISQRRCDNGSGCVDRMKICDGMRDCADGSDERGCGTVSCTHFEFSCKNQA-CIPMVQ------RCDGVDNCGDNSDEMSCSSDKICDLSLNHKCRNGRCVVKGWVCDGFDDCGDNSDEEKC 355          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Nematostella
Match: EDO49499 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGB1])

HSP 1 Score: 71.633 bits (174), Expect = 1.076e-12
Identity = 46/120 (38.33%), Postives = 55/120 (45.83%), Query Frame = 2
Query: 2228 CPQNYRRC-NNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDE 2584
            C   Y  C N+  C P    CDG+A C D SDE       C P    C   G            W CDG+NDCG+N DE  C      C   KF C+NG  IP++  CD E+DC +  DE
Sbjct:  122 CASTYFLCPNSSHCIPRRWLCDGLAECEDGSDEKNCQKFTCAPDKFACASGG-------CIASRWVCDGDNDCGDNSDELNCTR--LTCPPTKFLCANGMCIPKSAVCDGENDCGDMSDE 232          

HSP 2 Score: 64.6994 bits (156), Expect = 1.593e-10
Identity = 49/142 (34.51%), Postives = 67/142 (47.18%), Query Frame = 2
Query: 2171 VECHDGIRVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCG-NIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
             EC DG   K+   F    C  +   C +G C  S   CDG  +C D SDE       C P    C   G  +P   +      CDGENDCG+  DE   N + + C   ++F C+NG+ I + ++CD   DC++G DE  C
Sbjct:  146 AECEDGSDEKNCQKF---TCAPDKFACASGGCIASRWVCDGDNDCGDNSDELNCTRLTCPPTKFLCA-NGMCIPKSAV------CDGENDCGDMSDEPS-NCSAHICDPKLEFQCANGRCINKKWRCDGMKDCADGSDESTC 276          

HSP 3 Score: 59.6918 bits (143), Expect = 5.313e-9
Identity = 46/137 (33.58%), Postives = 59/137 (43.07%), Query Frame = 2
Query: 2192 RVKSATIFLENQCPQNYRRC-NNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDC-GNNFDESQCNENDYKCGNIKFNCSN-GKVIPRAYQCDKESDCSNGEDEVGC 2593
             V +  +     C   + +C ++G+C P    CDG  +C D SDE   V   C      C      VPL       WKCDGE DC    FDE  C      C +  F C N    IPR + CD  ++C +G DE  C
Sbjct:   31 HVHAKILQQAKNCGSRHFKCVSDGKCIPKSWRCDGEMDCPDSSDEEGCVNRTCSSKEFNCN--NQCVPLS------WKCDGEKDCRPGGFDEEGCEP--VTCASTYFLCPNSSHCIPRRWLCDGLAECEDGSDEKNC 157          

HSP 4 Score: 52.7582 bits (125), Expect = 7.460e-7
Identity = 52/160 (32.50%), Postives = 72/160 (45.00%), Query Frame = 2
Query: 2231 PQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDE-SQCNENDYKCGNIKFNCSNGKV-IPRAYQCDKESDCSNGEDEVGCI-LPQVTSMTDAKVRRIRREGSTELRC-ESYGVPRPH 2698
            P+   +C NG C      CDG+ +CAD SDE+      C P    C      +PL  +      CDG NDCG+N+DE S C + D K    K NCS   V  PR  +C      +  +D + C  + + +S+           GS +  C E Y + RPH
Sbjct:  243 PKLEFQCANGRCINKKWRCDGMKDCADGSDESTCGEGTCRPDEWHCIGTSRCIPLSRV------CDGTNDCGDNYDEGSHCLDLDCK----KKNCSQRCVQTPRGGECRCFPGYTISKDLITCKDINECSSIGRCDHFCYNTPGSYKCACDEGYVLERPH 392          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Medaka
Match: hspg2 (heparan sulfate proteoglycan 2 [Source:NCBI gene;Acc:101159991])

HSP 1 Score: 120.939 bits (302), Expect = 4.152e-27
Identity = 77/220 (35.00%), Postives = 112/220 (50.91%), Query Frame = 2
Query: 2219 ENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNEN-DYKCGNIKFNC-SNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTEL-RCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILRITNFQPGDDGIYNCETLSGPNRSF 2869
            E  C  +   C +GEC      CDG  +CAD SDE     + C+P   +C+    +  LK      W+CDG+NDC +N DE  C +  + +C +  F C S+ K IP +YQCD+E DC++  DE GC  P VT+  +  ++ +R  GST +  C + GVP P I WR NWG +  S R+++             L I + +  D G Y CE ++     F
Sbjct:  180 ETCCRADQATCQSGECISRDYICDGERDCADGSDEFRCTPSPCEPNEFRCK--NGRCALK-----LWRCDGDNDCEDNSDEMDCTKGPEEQCASKHFECVSDRKCIPASYQCDEEPDCADRSDEYGCP-PTVTTPPEESIQAVR--GSTVMFTCRAVGVPTPMITWRLNWGHIPVSGRVSMNN-----KNGFGTLTIRDVKESDQGAYTCEAINAKGLVF 384          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Medaka
Match: lrp8 (low-density lipoprotein receptor-related protein 8 [Source:NCBI gene;Acc:101167610])

HSP 1 Score: 83.9593 bits (206), Expect = 4.982e-16
Identity = 47/120 (39.17%), Postives = 61/120 (50.83%), Query Frame = 2
Query: 2249 CNNGECQPSGKFCDGVANCADRSDENPSVCNK--CDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILP 2602
            C NG+C PS   CDG   CAD SDE  ++C++  C P    C    +K        + W+CDGE DC N  DE QC  +   C +  F C NGK I   + CD ++DC +  DE  C  P
Sbjct:   89 CKNGQCLPSKWRCDGEPECADGSDEADAICSRQTCPPEKFDCGGAASKC-----VSLSWRCDGERDCENGADEEQCAADAKACASKDFQCRNGKCIGPTFVCDGDNDCGDSSDEEKCSSP 203          

HSP 2 Score: 76.2554 bits (186), Expect = 1.165e-13
Identity = 44/124 (35.48%), Postives = 66/124 (53.23%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKC-DPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCI 2596
            C Q+  RCNN EC P+   CDG  +C D+SDE+   C++  +P   +C +   +    +   ++WKCDG+ DC +  DE+ C      C   +F C +G  I    QC+K  DC +  DE GC+
Sbjct:  205 CGQHEFRCNNSECIPALWSCDGDPDCKDKSDESAERCSRGKEPQKPRCPVGEFQCGSGECVHMNWKCDGDADCKDKSDEANCPL--LTCRPDEFQCGDGTCIHGTKQCNKVHDCPDYSDEAGCV 326          

HSP 3 Score: 52.373 bits (124), Expect = 2.379e-6
Identity = 40/131 (30.53%), Postives = 59/131 (45.04%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCD-PLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDES--QCNENDY----KCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCIL 2599
            C     +C NG+C      CDG  +C D SDE      KC  P   + E   N     +     W CDG+ DC +  DES  +C+        +C   +F C +G+ +   ++CD ++DC +  DE  C L
Sbjct:  166 CASKDFQCRNGKCIGPTFVCDGDNDCGDSSDEE-----KCSSPTCGQHEFRCNN---SECIPALWSCDGDPDCKDKSDESAERCSRGKEPQKPRCPVGEFQCGSGECVHMNWKCDGDADCKDKSDEANCPL 288          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Medaka
Match: lrp8 (low-density lipoprotein receptor-related protein 8 [Source:NCBI gene;Acc:101167610])

HSP 1 Score: 83.9593 bits (206), Expect = 5.403e-16
Identity = 47/120 (39.17%), Postives = 61/120 (50.83%), Query Frame = 2
Query: 2249 CNNGECQPSGKFCDGVANCADRSDENPSVCNK--CDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILP 2602
            C NG+C PS   CDG   CAD SDE  ++C++  C P    C    +K        + W+CDGE DC N  DE QC  +   C +  F C NGK I   + CD ++DC +  DE  C  P
Sbjct:   22 CKNGQCLPSKWRCDGEPECADGSDEADAICSRQTCPPEKFDCGGAASKC-----VSLSWRCDGERDCENGADEEQCAADAKACASKDFQCRNGKCIGPTFVCDGDNDCGDSSDEEKCSSP 136          

HSP 2 Score: 76.2554 bits (186), Expect = 1.239e-13
Identity = 44/124 (35.48%), Postives = 66/124 (53.23%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKC-DPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCI 2596
            C Q+  RCNN EC P+   CDG  +C D+SDE+   C++  +P   +C +   +    +   ++WKCDG+ DC +  DE+ C      C   +F C +G  I    QC+K  DC +  DE GC+
Sbjct:  138 CGQHEFRCNNSECIPALWSCDGDPDCKDKSDESAERCSRGKEPQKPRCPVGEFQCGSGECVHMNWKCDGDADCKDKSDEANCPL--LTCRPDEFQCGDGTCIHGTKQCNKVHDCPDYSDEAGCV 259          

HSP 3 Score: 52.373 bits (124), Expect = 2.501e-6
Identity = 40/131 (30.53%), Postives = 59/131 (45.04%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCD-PLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDES--QCNENDY----KCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCIL 2599
            C     +C NG+C      CDG  +C D SDE      KC  P   + E   N     +     W CDG+ DC +  DES  +C+        +C   +F C +G+ +   ++CD ++DC +  DE  C L
Sbjct:   99 CASKDFQCRNGKCIGPTFVCDGDNDCGDSSDEE-----KCSSPTCGQHEFRCNN---SECIPALWSCDGDPDCKDKSDESAERCSRGKEPQKPRCPVGEFQCGSGECVHMNWKCDGDADCKDKSDEANCPL 221          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Medaka
Match: sorl1 (sortilin related receptor 1 [Source:NCBI gene;Acc:101160573])

HSP 1 Score: 83.5741 bits (205), Expect = 8.767e-16
Identity = 53/154 (34.42%), Postives = 77/154 (50.00%), Query Frame = 2
Query: 2156 DNNLKVECHDGIRVKSAT-IFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLIN-KCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILPQVT 2611
            +  L+ +C  G ++++ T +  E  C  N   C NG C  S   CD   +C D SDE       CDP    +C   G+ +PL       +KCD E+DCG+N DE QC    ++CG  +F C+ G  I  A+ CD ++DC +  DE  C +   T
Sbjct:  950 EGELQCKCPFGYQLRNKTCVKTERTCLPNQYHCRNGRCISSIWKCDSDNDCGDMSDEQECPTTTCDPSHQFRCMASGSCIPLA------FKCDHEDDCGDNSDEEQCEA--HQCGPGEFTCARGVCIREAWLCDGDNDCRDWSDESNCTVGHHT 1095          

HSP 2 Score: 69.707 bits (169), Expect = 1.494e-11
Identity = 43/127 (33.86%), Postives = 59/127 (46.46%), Query Frame = 2
Query: 2246 RCNNGECQPSGKFCDGVANCADRSDEN----PSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYK-------CGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            +C NG C      CDG+ +C D SDE     P+    C          G  +P        WKCDGENDCG+  DE+ C    +        C + +F+C +G  I   + CD  +DC +G DE+GC
Sbjct: 1228 QCANGVCVSLEWKCDGMDDCGDYSDEANCAAPTEAPGCSRFFQYECRNGRCIP------TWWKCDGENDCGDWSDEALCGVTPHTVTPGPTTCASNRFHCGSGACIINTWVCDGYADCRDGSDELGC 1348          

HSP 3 Score: 58.9214 bits (141), Expect = 3.517e-8
Identity = 39/126 (30.95%), Postives = 57/126 (45.24%), Query Frame = 2
Query: 2249 CNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIF--LIHWKCDGENDCGNNFDE------SQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILP 2602
            C+N  C P+   C+GV +C D +DEN      CDPL  +   +  +   + +F  L+   CDG   C +  DE      S  +E    C    F C+NG  +   ++CD   DC +  DE  C  P
Sbjct: 1142 CSNASCLPAAAHCNGVKDCPDGADEN-----NCDPLCTRYMEFVCRNRAQCLFQSLV---CDGIKHCEDGSDEDAAYAGSTPSEFGKVCDAYTFQCANGVCVSLEWKCDGMDDCGDYSDEANCAAP 1259          

HSP 4 Score: 53.5286 bits (127), Expect = 1.288e-6
Identity = 35/116 (30.17%), Postives = 49/116 (42.24%), Query Frame = 2
Query: 2219 ENQCP-------QNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQ 2545
            E +CP         +R   +G C P    CD   +C D SDE     ++C P    C      V +++     W CDG+NDC +  DES C    + C    F C  G  IP  ++
Sbjct: 1006 EQECPTTTCDPSHQFRCMASGSCIPLAFKCDHEDDCGDNSDEEQCEAHQCGPGEFTC---ARGVCIREA----WLCDGDNDCRDWSDESNCTVGHHTCEPSSFQCRTGHCIPLRWK 1114          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Medaka
Match: lrp2a (LDL receptor related protein 2 [Source:NCBI gene;Acc:101157655])

HSP 1 Score: 77.411 bits (189), Expect = 7.188e-14
Identity = 49/128 (38.28%), Postives = 67/128 (52.34%), Query Frame = 2
Query: 2225 QCPQNYRRCNNGECQPSGKFCDGVANCADRSDE-NPSVCNKCDPLINKCEIYGNK--VPLKDIFLIHWKCDGENDCGNNFDESQC-NENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCI 2596
            QC  N   C NG+C P+   CDGV +C D SDE +  V   C P    C    N+  VP      + W+CDG NDC ++ DE  C       C   +F C+N + IP  ++CD ++DC +G DEV C+
Sbjct:  979 QCGANSFSCGNGKCVPNSYRCDGVDDCHDNSDEMSCGVNTTCSPSAFTC---ANRRCVP------VGWRCDGHNDCLDDSDEINCPTRVPGTCPANQFTCANHRCIPHTWRCDTDNDCGDGSDEVDCL 1097          

HSP 2 Score: 76.6406 bits (187), Expect = 1.389e-13
Identity = 48/134 (35.82%), Postives = 71/134 (52.99%), Query Frame = 2
Query: 2198 KSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNG-----KVIPRAYQCDKESDCSNGEDE 2584
            +S T    + C Q+  RC++G C P+  +CDG ++C+D SDE P  C     LI  C     +        + W CDG+NDCG+  DE Q   N+  C + +F C+N      K IPR + CD ++DC++  DE
Sbjct: 2793 ESPTHCATSTCSQSEFRCSSGRCIPAHWYCDGGSDCSDGSDE-PLSCT----LIRTCNTDQFRCDDGRCIALSWICDGDNDCGDMSDEDQ-RHNNRTCSSSEFTCANNQPPQRKCIPRDWVCDGDADCADALDE 2920          

HSP 3 Score: 75.0998 bits (183), Expect = 4.200e-13
Identity = 49/125 (39.20%), Postives = 61/125 (48.80%), Query Frame = 2
Query: 2246 RCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQ-CNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSM 2617
            RC  G C P    CDG ++C D SDE       CD    +C   G  +P  D+    W CD E DC +  DE Q C      C   +F CSNG  IP  Y+CD  +DCS+G DE  C  P+ T +
Sbjct:    9 RCGTGRCIPGDWHCDGTSDCVDDSDEQDCAQVTCDHSHFQCLSDGECIP--DV----WVCDDEEDCEDGSDERQNCGRT---CTGDQFTCSNGMCIPALYRCDHMADCSDGSDERHC-YPECTQL 123          

HSP 4 Score: 73.1738 bits (178), Expect = 1.555e-12
Identity = 39/120 (32.50%), Postives = 63/120 (52.50%), Query Frame = 2
Query: 2225 QCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDE 2584
             C     +C++G C      C+   +C D SDE+P +C       ++CE +  +   K      W+CDGE+DCG++ DE   + +   C   +F C NG+ IP+A++CD + DC +  DE
Sbjct: 3481 HCHLGQFQCSDGNCTSPYFLCNSNQDCPDGSDEDPVLCT------HQCESHQWQCANKRCIPESWQCDGEDDCGDHSDEDPAHCSARTCRPGQFKCRNGRCIPQAWKCDVDDDCGDNSDE 3594          

HSP 5 Score: 71.633 bits (174), Expect = 4.037e-12
Identity = 45/125 (36.00%), Postives = 61/125 (48.80%), Query Frame = 2
Query: 2231 PQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNK-CDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDE-VGCIL 2599
            P     CNNG C      C+G+ NC D    +   C + C P   KC+     +P        + CDG+NDCG+  DES  +     C   +F CS+G+ IP  + CD  SDCS+G DE + C L
Sbjct: 2722 PNTEFPCNNGRCIAKEYVCNGINNCYDNGTSDEQNCERTCQPEQTKCQSTNICIPRS------YLCDGDNDCGDMSDESPTHCATSTCSQSEFRCSSGRCIPAHWYCDGGSDCSDGSDEPLSCTL 2840          

HSP 6 Score: 66.6254 bits (161), Expect = 1.670e-10
Identity = 46/127 (36.22%), Postives = 61/127 (48.03%), Query Frame = 2
Query: 2216 LENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNK-CDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            L   C  +  RC++G C      CDG  +C D SDE+    N+ C      C    N+ P +      W CDG+ DC +  DE Q N     CG  +F CSNG  I  +Y CD+ +DC +  DE GC
Sbjct: 2840 LIRTCNTDQFRCDDGRCIALSWICDGDNDCGDMSDEDQRHNNRTCSSSEFTCA--NNQPPQRKCIPRDWVCDGDADCADALDEHQ-NCTHRSCGINEFTCSNGLCIRSSY-CDRRNDCGDSSDEQGC 2962          

HSP 7 Score: 63.5438 bits (153), Expect = 1.134e-9
Identity = 45/131 (34.35%), Postives = 64/131 (48.85%), Query Frame = 2
Query: 2228 CPQNYRRCNNG-ECQPSGKFCDGVANCADRSDEN-----PSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILP 2602
            C  N  +C NG +C  S   CDGV +C+DRSDE+     P +C+       +C+  G+ VP        W+CDG  DC +  DE         C +  F C NG  + R++ CD ++DC +  DE  C  P
Sbjct: 1138 CTANEFKCTNGHQCISSYYHCDGVFDCSDRSDEHNCTRPPGMCHHESEF--QCQSDGSCVPST------WECDGHPDCEDGSDEHHACP-PRTCSSSLFRCDNGNCVLRSWICDGDNDCRDMSDERDCPTP 1259          

HSP 8 Score: 62.003 bits (149), Expect = 3.697e-9
Identity = 46/124 (37.10%), Postives = 56/124 (45.16%), Query Frame = 2
Query: 2225 QCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIH--WKCDGENDCGNNFDESQCNENDYKCGNIKFNC-SNGKVIPRAYQCDKESDCSNGEDEV 2587
             C     +C NG C P    CD   +C DRSDE       C P        GN         IH  W CDGE+DC +N DE  C+    +C   ++ C S+GK IP    CD   DC +GEDE 
Sbjct:  154 HCNAGMFQCQNGLCIPQRYVCDHDDDCGDRSDEL-----NCYPTCK-----GNYFTCPSGRCIHQVWLCDGEDDCEDNADEKGCDNVPRECYPGEWPCPSSGKCIPMDKLCDGRVDCLDGEDET 267          

HSP 9 Score: 61.2326 bits (147), Expect = 6.673e-9
Identity = 40/116 (34.48%), Postives = 58/116 (50.00%), Query Frame = 2
Query: 2246 RCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            RC NG C    + CD V +C D SDE  + C  C+  + +C+  G  +P + +      CD ++DCG+  DE  C      C    F C +G+ I + + CD E DC +  DE GC
Sbjct:  124 RCTNGACYDRTQRCDHVLDCRDGSDE--ANCQHCNAGMFQCQ-NGLCIPQRYV------CDHDDDCGDRSDELNCYPT---CKGNYFTCPSGRCIHQVWLCDGEDDCEDNADEKGC 227          

HSP 10 Score: 60.4622 bits (145), Expect = 1.061e-8
Identity = 43/126 (34.13%), Postives = 56/126 (44.44%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNG-KVIPRAYQCDKESDCSNGEDEVGCILP 2602
            CP N   C N  C P    CD   +C D SDE   + + C+P   +C       P       ++ CDG+ DC +  DE  C    Y C   +F C+NG + I   Y CD   DCS+  DE  C  P
Sbjct: 1062 CPANQFTCANHRCIPHTWRCDTDNDCGDGSDEVDCLGSTCNPEQFQC-------PDHRCIDPNYICDGDRDCVDGADEQDC----YNCTANEFKCTNGHQCISSYYHCDGVFDCSDRSDEHNCTRP 1176          

HSP 11 Score: 55.4546 bits (132), Expect = 3.731e-7
Identity = 46/139 (33.09%), Postives = 59/139 (42.45%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDE--SQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRR 2638
            C  N   C+NG C  S  +CD   +C D SDE       C P    C+   N   +   F+    CDG+NDCG+  DE    C      C    F C NG  I  +  CD+  DCS+  DE G     +   TD  + R
Sbjct: 2929 CGINEFTCSNGLCIRS-SYCDRRNDCGDSSDEQGCTYQPCQPHQFTCQ---NGRCVAQDFV----CDGDNDCGDESDELEHMCRTPAPTCPPGNFRCENGHCIDLSRVCDRSDDCSDNSDEKG-----INECTDPSIHR 3054          

HSP 12 Score: 55.0694 bits (131), Expect = 4.607e-7
Identity = 27/70 (38.57%), Postives = 37/70 (52.86%), Query Frame = 2
Query: 2417 WKCDGENDCGNNFDE---------SQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCIL 2599
            WKCD +NDCG+  DE         S    + + C    F C NG+ +P  Y+CD  +DC +  DEVGC+ 
Sbjct: 2648 WKCDNDNDCGDGSDELERVCQLLSSFIALSFHTCEPTMFTCGNGRCVPYHYRCDHYNDCGDNSDEVGCLF 2717          

HSP 13 Score: 54.299 bits (129), Expect = 9.595e-7
Identity = 38/122 (31.15%), Postives = 53/122 (43.44%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            C  +   C+NG C P+   CD +A+C+D SDE       C P   +             +    +CD   DC +  DE+ C      C    F C NG  IP+ Y CD + DC +  DE+ C
Sbjct:   82 CTGDQFTCSNGMCIPALYRCDHMADCSDGSDER-----HCYPECTQLRCTNGAC-----YDRTQRCDHVLDCRDGSDEANCQH----CNAGMFQCQNGLCIPQRYVCDHDDDCGDRSDELNC 189          

HSP 14 Score: 51.6026 bits (122), Expect = 6.291e-6
Identity = 35/112 (31.25%), Postives = 53/112 (47.32%), Query Frame = 2
Query: 2252 NNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKV-IPRAYQCDKESDCSNGEDE 2584
            ++G C PS   CDG  +C D SDE+    + C P      ++  +    +  L  W CDG+NDC +  DE  C    ++C + ++ C    + I     CD   +C NG DE
Sbjct: 1190 SDGSCVPSTWECDGHPDCEDGSDEH----HACPPRTCSSSLF--RCDNGNCVLRSWICDGDNDCRDMSDERDCPTPPFRCPSWQWQCPGYSLCINITTVCDNTPNCPNGADE 1295          

HSP 15 Score: 50.8322 bits (120), Expect = 9.041e-6
Identity = 44/164 (26.83%), Postives = 67/164 (40.85%), Query Frame = 2
Query: 2228 CPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNK------CDPLINKCEIY-------------------GNKVPLKDI---------------FLIHWKCDGENDCGNNFDESQCNENDYK--CGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGC 2593
            C   Y +C +G C      CDG A+C D +DE  + C +      C P + +C+ +                     ++ L DI                  H  C+   DCG+  DE   N++     C + +F CS+G+ IP  Y CD+  DC +  DE+GC
Sbjct: 3722 CHPGYFQCGSGHCIAERFKCDGNADCLDYTDE--TSCTRFPNGAYCPPFLFECKNHVCVQPHWKCDGDDDCGDNSDEELHLCDITCEGPFRFRCDNNRCIYSHELCNSVEDCGDGSDERMENQSPTHGPCTDDEFKCSSGQCIPLQYACDEYDDCGDESDELGC 3883          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Planmine SMEST
Match: SMESG000012063.1 (SMESG000012063.1)

HSP 1 Score: 1855.49 bits (4805), Expect = 0.000e+0
Identity = 923/929 (99.35%), Postives = 926/929 (99.68%), Query Frame = 2
Query:  110 MNQLTXXXXXXXXXXXXXXSFQEISRKTMYIGQSAKLRCGPQQDKFYNIKVSYKWEKPLGNVISTDPEYKIQGATLNDGGIYTCRITQVINGQITEKTISTELGIQSKDSDSEETTPPIFVDPPIISFKNINEGSIDVQETDFLYTVCEVSNWQQSEYTSSWWFNQAPINGANKILFVSSLDADKNAGYYTCRINHKLYSQKTYEKQLLVNIKKPEISIISFPEENLKIGGRIYRKCEMLGIKISRNEALKFAWIKDNSFEIATGSILDLPIRDESVNGDYSCVIKSEKLNKKYFKELTIRIDSNIPRNPNQQRINIFSQPISPELNNEFKLKCEIFPPIPNANYIWKKDNNVVSYQQTLVIPSFQRQDIGSYSCEIVSPNGDTSSSGRQISENVNVKFQYSSNNKIELDKFGVQMISRVGEKKEMHCEISTSSPNRGSDVEWFFNKERLDETMKQQYKILRSDRNFVSIISLTNINPKNEGLYTCRVDNSDKKANLIVIQEESSLTINPERIIRNEGEPVEFHCRGNGIPDFINTKVKWSFKSRDGTVVISSLENENRWEISNSPETPETSFISISSSLYKDGGFYICTTTEGLRRTAELVIKRREDSTLLTITPEIVRVRNGQPVVVECFSVSEKTGEPYGEPKFTMEYGKSLSTDPRLVEQKVGQSRVRLSIKDGLQTSDNNLKVECHDGIRVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILRITNFQPGDDGIYNCETLSGPNRSFSDDYQLILD 2896
            MNQLTILHFGILFIIFHEFSFQEISRKTMYIGQSAKLRCGPQQDKFYNIKVSYKWEKPLGNVISTDPEYKIQGATLNDGGIYTCRITQVINGQITEKTISTELGIQSKDSDSEETTPPIFVDPPIISFKNINEGSIDVQETDFLYTVCEVSNWQQSEYTSSWWFNQAPINGANKILFVSSLDADKNAGYYTCRINHKLYSQKTYEKQLLVNIKKPEISIISFPEENLKIGGRIYRKCEM+GIKISRNEALKFAWIKDNSFEIATGSILDLPIRD SVNGDYSCVIKSEKLNKKYFKELTIRIDSN+PRNPNQQRINIFSQPISPELNNEFKLKCEIFPPIPNANYIWKKDNNVVSYQQTLVIPSFQRQDIGSYSCEIVSPNGDTSSSGRQISENVNVKFQYSSNNKIELDKFGVQMISRVGEKKEMHCEISTSSPNRGSDVEWFFNKERLDETMKQQYKILRSDRNFVSIISLTNI PKNEGLYTCRVDNSDKKANLIVIQEESSLTINPERIIRNEGEPVEFHCRGNGIPDFINTKVKWSFKSRDGTVVISSLENENRWEISNSPETPETSFISISSSLYKDGGFYICTTTEGLRRTAELVIKRREDSTLLTITPEIVRVRNGQPVVVECFSVSEKTGEPYGEPKFTMEYGKSLSTDPRLVEQKVGQSRVRLSIKDGL+TSDNNLKVECHDGIRVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRR GSTELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILRITNFQPGDDGIYNCETLSGPNRSFSDDYQLILD
Sbjct:    1 MNQLTILHFGILFIIFHEFSFQEISRKTMYIGQSAKLRCGPQQDKFYNIKVSYKWEKPLGNVISTDPEYKIQGATLNDGGIYTCRITQVINGQITEKTISTELGIQSKDSDSEETTPPIFVDPPIISFKNINEGSIDVQETDFLYTVCEVSNWQQSEYTSSWWFNQAPINGANKILFVSSLDADKNAGYYTCRINHKLYSQKTYEKQLLVNIKKPEISIISFPEENLKIGGRIYRKCEMVGIKISRNEALKFAWIKDNSFEIATGSILDLPIRDASVNGDYSCVIKSEKLNKKYFKELTIRIDSNVPRNPNQQRINIFSQPISPELNNEFKLKCEIFPPIPNANYIWKKDNNVVSYQQTLVIPSFQRQDIGSYSCEIVSPNGDTSSSGRQISENVNVKFQYSSNNKIELDKFGVQMISRVGEKKEMHCEISTSSPNRGSDVEWFFNKERLDETMKQQYKILRSDRNFVSIISLTNITPKNEGLYTCRVDNSDKKANLIVIQEESSLTINPERIIRNEGEPVEFHCRGNGIPDFINTKVKWSFKSRDGTVVISSLENENRWEISNSPETPETSFISISSSLYKDGGFYICTTTEGLRRTAELVIKRREDSTLLTITPEIVRVRNGQPVVVECFSVSEKTGEPYGEPKFTMEYGKSLSTDPRLVEQKVGQSRVRLSIKDGLETSDNNLKVECHDGIRVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRRGGSTELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILRITNFQPGDDGIYNCETLSGPNRSFSDDYQLILD 929          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Planmine SMEST
Match: SMESG000012063.1 (SMESG000012063.1)

HSP 1 Score: 1832.38 bits (4745), Expect = 0.000e+0
Identity = 895/901 (99.33%), Postives = 898/901 (99.67%), Query Frame = 2
Query:  194 MYIGQSAKLRCGPQQDKFYNIKVSYKWEKPLGNVISTDPEYKIQGATLNDGGIYTCRITQVINGQITEKTISTELGIQSKDSDSEETTPPIFVDPPIISFKNINEGSIDVQETDFLYTVCEVSNWQQSEYTSSWWFNQAPINGANKILFVSSLDADKNAGYYTCRINHKLYSQKTYEKQLLVNIKKPEISIISFPEENLKIGGRIYRKCEMLGIKISRNEALKFAWIKDNSFEIATGSILDLPIRDESVNGDYSCVIKSEKLNKKYFKELTIRIDSNIPRNPNQQRINIFSQPISPELNNEFKLKCEIFPPIPNANYIWKKDNNVVSYQQTLVIPSFQRQDIGSYSCEIVSPNGDTSSSGRQISENVNVKFQYSSNNKIELDKFGVQMISRVGEKKEMHCEISTSSPNRGSDVEWFFNKERLDETMKQQYKILRSDRNFVSIISLTNINPKNEGLYTCRVDNSDKKANLIVIQEESSLTINPERIIRNEGEPVEFHCRGNGIPDFINTKVKWSFKSRDGTVVISSLENENRWEISNSPETPETSFISISSSLYKDGGFYICTTTEGLRRTAELVIKRREDSTLLTITPEIVRVRNGQPVVVECFSVSEKTGEPYGEPKFTMEYGKSLSTDPRLVEQKVGQSRVRLSIKDGLQTSDNNLKVECHDGIRVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILRITNFQPGDDGIYNCETLSGPNRSFSDDYQLILD 2896
            MYIGQSAKLRCGPQQDKFYNIKVSYKWEKPLGNVISTDPEYKIQGATLNDGGIYTCRITQVINGQITEKTISTELGIQSKDSDSEETTPPIFVDPPIISFKNINEGSIDVQETDFLYTVCEVSNWQQSEYTSSWWFNQAPINGANKILFVSSLDADKNAGYYTCRINHKLYSQKTYEKQLLVNIKKPEISIISFPEENLKIGGRIYRKCEM+GIKISRNEALKFAWIKDNSFEIATGSILDLPIRD SVNGDYSCVIKSEKLNKKYFKELTIRIDSN+PRNPNQQRINIFSQPISPELNNEFKLKCEIFPPIPNANYIWKKDNNVVSYQQTLVIPSFQRQDIGSYSCEIVSPNGDTSSSGRQISENVNVKFQYSSNNKIELDKFGVQMISRVGEKKEMHCEISTSSPNRGSDVEWFFNKERLDETMKQQYKILRSDRNFVSIISLTNI PKNEGLYTCRVDNSDKKANLIVIQEESSLTINPERIIRNEGEPVEFHCRGNGIPDFINTKVKWSFKSRDGTVVISSLENENRWEISNSPETPETSFISISSSLYKDGGFYICTTTEGLRRTAELVIKRREDSTLLTITPEIVRVRNGQPVVVECFSVSEKTGEPYGEPKFTMEYGKSLSTDPRLVEQKVGQSRVRLSIKDGL+TSDNNLKVECHDGIRVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRR GSTELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILRITNFQPGDDGIYNCETLSGPNRSFSDDYQLILD
Sbjct:    1 MYIGQSAKLRCGPQQDKFYNIKVSYKWEKPLGNVISTDPEYKIQGATLNDGGIYTCRITQVINGQITEKTISTELGIQSKDSDSEETTPPIFVDPPIISFKNINEGSIDVQETDFLYTVCEVSNWQQSEYTSSWWFNQAPINGANKILFVSSLDADKNAGYYTCRINHKLYSQKTYEKQLLVNIKKPEISIISFPEENLKIGGRIYRKCEMVGIKISRNEALKFAWIKDNSFEIATGSILDLPIRDASVNGDYSCVIKSEKLNKKYFKELTIRIDSNVPRNPNQQRINIFSQPISPELNNEFKLKCEIFPPIPNANYIWKKDNNVVSYQQTLVIPSFQRQDIGSYSCEIVSPNGDTSSSGRQISENVNVKFQYSSNNKIELDKFGVQMISRVGEKKEMHCEISTSSPNRGSDVEWFFNKERLDETMKQQYKILRSDRNFVSIISLTNITPKNEGLYTCRVDNSDKKANLIVIQEESSLTINPERIIRNEGEPVEFHCRGNGIPDFINTKVKWSFKSRDGTVVISSLENENRWEISNSPETPETSFISISSSLYKDGGFYICTTTEGLRRTAELVIKRREDSTLLTITPEIVRVRNGQPVVVECFSVSEKTGEPYGEPKFTMEYGKSLSTDPRLVEQKVGQSRVRLSIKDGLETSDNNLKVECHDGIRVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRRGGSTELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILRITNFQPGDDGIYNCETLSGPNRSFSDDYQLILD 901          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Planmine SMEST
Match: SMESG000026265.1 (SMESG000026265.1)

HSP 1 Score: 561.222 bits (1445), Expect = 0.000e+0
Identity = 316/911 (34.69%), Postives = 473/911 (51.92%), Query Frame = 2
Query:  179 ISRKTMYIGQSAKLRCGPQQDKFYNIKVSYKWEKPLGNVISTDPEYKIQGATLNDGGIYTCRITQVINGQITEKTISTELGIQSKDSDSEETTPPIFVDPPIISFKNINEGSIDVQETDFLYTVCEVSNWQQSEYTSSWWF-NQAPINGANKILFVSSLDADKNAGYYTCRINHKLYSQKTYEKQLLVNIKKPEISIISFPEENLKIGGRIYRKCEMLGIKISRN---EALKFAWIKDNSFEIATGSILDLPIRDESVNGDYSCVIKSEKLNKKYFKELTI-RIDSNIPRNPNQQRINIFSQPISPELNNEFKLKCEIFPPIPNANYIWKKDNNVVSYQQTLVIPSFQRQDIGSYSCEIVSPNGDTSSSGRQISENV--NVKFQYSSNNKIEL-DKFGVQMISRVGEKKEMHCEISTSSPNRGSDVEWFFNKERLDETMKQQYKILRSDRNFVSIISLTNINPKNEGLYTCRVDNSDKKANLIVIQEESSLTINPERIIRNEGEPVEFHCRGNGIPDFINTKVKWSFKSRDGTVVISSLENENRWEISNSPETPETSFISISSSLYKDGGFYICTTTEGLRRTAELVIKRREDSTLLTITPEIVRVRNGQPVVVECFSVSEKTGEPYGEPKFTMEYGKSLSTDPRLVEQKVGQSRVRLSIKDGLQTSDNNLKVECHDGIRVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILRITNFQPGDDGIYNCETLSGPNRSFSDDYQL 2887
            I  K +++G   KL C   ++ F N K    WE+P+G +I+  P   ++   L D G YTCR  Q IN ++  + +  E+ I        ET+ P    P I+  +      + + ET +L   CEV NW + +Y   W   +       N ILF  S+   K+   Y C + H     K Y+ Q+ V IKKPE++ +  P E L + GRI+RKC  +   +S N   E   F WI +    ++  ++L +PI DESV G Y C   ++     Y  ++ I +I + I +   +  I+I   P    LN    L+C++ P + N  Y W ++       QTL+ P F +  +  Y C  +     T+ +  +I   V  + K  Y S NKIEL +  G  +  ++ EKKE+HCEI       G ++EWFFN + ++ ++ + Y++ R ++  VSI+ L N    NEG Y CR     K+A +++  +   +  NP +I   EG PVEFHCR + + +  N  + W F + +  +  S LEN ++W ++ S     TSFI++  +   D G+  C +  GL   ++L++   +    +T+TP  +RVR  Q    ECF  S++ G PYGEPKF    GK +  D R +   VG SR+R++   G+   D  LK+ C    +V +  I ++  CP N R+C N +C P GKFCDG+A+C D SDE+P+VCN C+P    C+      P +     +W CDGENDCGNN+DE  C +   KC  + F C N   IPR   CD  SDC   EDE  C+ P + S + + V+        +L+CE+   P P I+WR+NWGCL +  R+TI T  + C KVIS L I  FQ GDD IYNCE LS  NR+ S D+ +
Sbjct:   29 IETKLLHVGDDTKLECFVTEENFNNSKTFIHWERPVGKIIANGPVLILKNVQLRDSGNYTCRAFQTINSKLVSQEVIEEVII--------ETSHPDIPQPDIVITEVDKNNEVHLTETQYLMLKCEVKNWNKDKYRIQWMKESTGEYLFGNNILFYKSITKSKHEDRYRCEVQHIGDESKVYKAQVDVFIKKPEVTTLIMPTEYLHVNGRIHRKC--VAFNLSANTYVENYSFRWINELGETVSHSNMLQIPINDESVTGTYECQYLAKYAGTMYTSQIVIAKIFTEISQG-KKYDISIVQYPQKTRLNERLSLRCQVLPSLTNVRYEWFRNGQYYQTGQTLIFPKFSKLLVDRYECRAIG----TTENQVEIFLTVESDQKLTYLSYNKIELTENPGPNIALKLNEKKELHCEIEDIDGLSGENIEWFFNGKMIENSLIKSYRLDRVNKRLVSILVLMNSQLDNEGRYECRYGIVRKEATVMLDIDSGMIVTNPSKIKVIEGSPVEFHCRIDDVYNIDNRNLSWRFYNNNFQINYS-LEN-SKWRLTESKIADHTSFINLDRATMADSGYIECISGNGLTAQSQLIVVEDKHKFNITVTPNHLRVRKNQLFEFECFGQSDE-GIPYGEPKFEFPGGKPVENDKRFLVTTVGPSRIRITAPHGVNIKDE-LKLICSVNKQVSAVYIQVQETCPPNQRQCQNRQCLPVGKFCDGIADCVDGSDEDPTVCNSCEPAFTTCQDVYGFAPTRKTINKNWICDGENDCGNNYDEINCEDKSTKCNGLFFTCKNNMTIPRGQVCDGNSDCLLDEDEADCLKPVIISTSKSHVKA-NIGSKVKLQCEATAHPLPTIIWRFNWGCLPNENRVTISTVKKNCRKVISTLTIDEFQAGDDAIYNCEALSSSNRALSQDFHV 919          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Planmine SMEST
Match: SMESG000027815.1 (SMESG000027815.1)

HSP 1 Score: 552.362 bits (1422), Expect = 0.000e+0
Identity = 315/824 (38.23%), Postives = 454/824 (55.10%), Query Frame = 2
Query:  437 SDSEETTPPIFVDPPIISFKNINEGSIDVQETDFLYTVCEVSNWQQSEYTSSWWFNQAPINGANKILFVSSLDADKNAGYYTCRINHKLYSQKTYEKQLLVNIKKPEISIISFPEENLKIGGRIYRKCEMLGI-KISRNEALKFAWIKDNSFEIATGSILDLPIRDESVNGDYSCVIKSEKLNKKYFKELTIRIDSNIPRNPNQQRINIFSQPISPELNNEFKLKCEIFPPIPNANYIWKKDNNVVSYQQTLVIPSFQRQDIGSYSC--EIVSPNGDTSSSGRQISENVNVKFQYSSNNKIELD-KFGVQMISRVGEKKEMHCEISTSSPNRGSDVEWFFNKERLDETMKQQYKILRSDRNFVSIISLTNINPKNEGLYTCRVDNSDKKANLIVIQEESSLTINPERIIRNEGEPVEFHCRGNGIPDFINTKVKWSFKSRDGTVVISSLENENRWEISNSPETPETSFISISSSLYKDGGFYICTTTEGLRRTAELVIKRREDSTLLTITPEIVRVRNGQPVVVECFSVSEKTGEPYGEPKFTMEYGKSLSTDPRLVEQKVGQSRVRLSIKDGLQTSDNNLKVECHDGIRVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDY-KCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILRITNFQPGDDGIYNCETLSGPNRSFSDDYQLIL 2893
            S+ EET+PP       I+F  +   SI   E  F+   C V+N+  +E +  W      +  AN+ L++ SL   ++ G Y C +      Q  + + L + I  P ISI   PEE+LKIGG+I R+C  LG+ + +  +   + W+   +  I   +IL +P+ DESV G Y C  KS++ +K Y     + +  ++       +I I + P        F L+CE+ P   N  Y W K +  +   Q LVI SF++ ++G+Y C   +  P+G        I +     F +   +KIEL  K G Q+    GEKKE+HCEI TSS NRG + EW+ N ++          + R D  +VS++ +++I+  NEG Y CRV +S K+ NLIV+ +E  +  +P  +   EG+ VEFHCR   IP   N  +KW+F+S++G  ++ +   ++RW++ N     +TSFI +  +   D G+YICT   G    +EL++   +D   LTITP  +RVR GQ V +ECFS + + G   G P+F+    K +  D R     VG +  RL+   GL  SDNN+ V C    R  S+ I++ + CP  YR C NGEC  + KFCD + +CAD+SDE+P  C +CDP+  KCEI    +P K+ FLIHW CDGE DCGN +DE  C+      CG   F CS+ K IPR Y CD+  DCS GEDE GC  PQ+T  +  KV   + +  T L CE+ G P P +VWR+NWGC+ +S R +       CN V S L I +F+ GDDGIYNCE LS   RSFS+D+Q+IL
Sbjct:   26 SEEEETSPPN------ITFFPLKNDSIVKSEMQFINIACNVTNYALNETSIRWLDKDGKVAAANRYLYIKSL-LKQDEGIYNCSVEKVKDPQIRFNRTLHLKITIPSISIDILPEESLKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSV-----SYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQ-----FAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNG--DIPLVNRLDGQYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEG--LVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQ-GRASGNPEFSFTNNKPIGRDGRFKISNVGPAHKRLTAPGGLSLSDNNMDVFCSLEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSPQITKTSATKVVATKSQLVT-LTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNFVTSSLTIKDFKAGDDGIYNCEALSSRQRSFSNDFQVIL 826          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Planmine SMEST
Match: SMESG000027815.1 (SMESG000027815.1)

HSP 1 Score: 552.362 bits (1422), Expect = 0.000e+0
Identity = 315/824 (38.23%), Postives = 454/824 (55.10%), Query Frame = 2
Query:  437 SDSEETTPPIFVDPPIISFKNINEGSIDVQETDFLYTVCEVSNWQQSEYTSSWWFNQAPINGANKILFVSSLDADKNAGYYTCRINHKLYSQKTYEKQLLVNIKKPEISIISFPEENLKIGGRIYRKCEMLGI-KISRNEALKFAWIKDNSFEIATGSILDLPIRDESVNGDYSCVIKSEKLNKKYFKELTIRIDSNIPRNPNQQRINIFSQPISPELNNEFKLKCEIFPPIPNANYIWKKDNNVVSYQQTLVIPSFQRQDIGSYSC--EIVSPNGDTSSSGRQISENVNVKFQYSSNNKIELD-KFGVQMISRVGEKKEMHCEISTSSPNRGSDVEWFFNKERLDETMKQQYKILRSDRNFVSIISLTNINPKNEGLYTCRVDNSDKKANLIVIQEESSLTINPERIIRNEGEPVEFHCRGNGIPDFINTKVKWSFKSRDGTVVISSLENENRWEISNSPETPETSFISISSSLYKDGGFYICTTTEGLRRTAELVIKRREDSTLLTITPEIVRVRNGQPVVVECFSVSEKTGEPYGEPKFTMEYGKSLSTDPRLVEQKVGQSRVRLSIKDGLQTSDNNLKVECHDGIRVKSATIFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLINKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDY-KCGNIKFNCSNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGSTELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILRITNFQPGDDGIYNCETLSGPNRSFSDDYQLIL 2893
            S+ EET+PP       I+F  +   SI   E  F+   C V+N+  +E +  W      +  AN+ L++ SL   ++ G Y C +      Q  + + L + I  P ISI   PEE+LKIGG+I R+C  LG+ + +  +   + W+   +  I   +IL +P+ DESV G Y C  KS++ +K Y     + +  ++       +I I + P        F L+CE+ P   N  Y W K +  +   Q LVI SF++ ++G+Y C   +  P+G        I +     F +   +KIEL  K G Q+    GEKKE+HCEI TSS NRG + EW+ N ++          + R D  +VS++ +++I+  NEG Y CRV +S K+ NLIV+ +E  +  +P  +   EG+ VEFHCR   IP   N  +KW+F+S++G  ++ +   ++RW++ N     +TSFI +  +   D G+YICT   G    +EL++   +D   LTITP  +RVR GQ V +ECFS + + G   G P+F+    K +  D R     VG +  RL+   GL  SDNN+ V C    R  S+ I++ + CP  YR C NGEC  + KFCD + +CAD+SDE+P  C +CDP+  KCEI    +P K+ FLIHW CDGE DCGN +DE  C+      CG   F CS+ K IPR Y CD+  DCS GEDE GC  PQ+T  +  KV   + +  T L CE+ G P P +VWR+NWGC+ +S R +       CN V S L I +F+ GDDGIYNCE LS   RSFS+D+Q+IL
Sbjct:   22 SEEEETSPPN------ITFFPLKNDSIVKSEMQFINIACNVTNYALNETSIRWLDKDGKVAAANRYLYIKSL-LKQDEGIYNCSVEKVKDPQIRFNRTLHLKITIPSISIDILPEESLKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSV-----SYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQ-----FAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNG--DIPLVNRLDGQYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEG--LVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQ-GRASGNPEFSFTNNKPIGRDGRFKISNVGPAHKRLTAPGGLSLSDNNMDVFCSLEGRQVSSKIYVSDICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSDNKTIPRGYVCDENIDCSQGEDETGCTSPQITKTSATKVVATKSQLVT-LTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNFVTSSLTIKDFKAGDDGIYNCEALSSRQRSFSNDFQVIL 822          
The following BLAST results are available for this feature:
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HSPG25.104e-2534.70heparan sulfate proteoglycan 2 [Source:HGNC Symbol... [more]
SORL12.105e-1536.30sortilin related receptor 1 [Source:HGNC Symbol;Ac... [more]
VLDLR4.077e-1535.17very low density lipoprotein receptor [Source:HGNC... [more]
VLDLR6.329e-1535.17very low density lipoprotein receptor [Source:HGNC... [more]
SORL11.214e-1436.62sortilin related receptor 1 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-523.963e-2129.14Basement membrane proteoglycan [Source:UniProtKB/... [more]
unc-524.294e-2129.14Basement membrane proteoglycan [Source:UniProtKB/... [more]
unc-524.681e-2129.14Basement membrane proteoglycan [Source:UniProtKB/... [more]
unc-524.723e-2129.14Basement membrane proteoglycan [Source:UniProtKB/... [more]
unc-524.752e-2129.14Basement membrane proteoglycan [Source:UniProtKB/... [more]
back to top
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trol4.471e-2931.07gene:FBgn0284408 transcript:FBtr0342821[more]
trol6.059e-2930.77gene:FBgn0284408 transcript:FBtr0342811[more]
trol6.848e-2930.77gene:FBgn0284408 transcript:FBtr0342822[more]
trol7.074e-2931.07gene:FBgn0284408 transcript:FBtr0342812[more]
trol7.465e-2931.07gene:FBgn0284408 transcript:FBtr0342824[more]
back to top
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspg21.284e-2534.84heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZD... [more]
hspg21.512e-2534.84heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZD... [more]
hspg21.627e-2534.84heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZD... [more]
sorl11.530e-1734.97sortilin-related receptor, L(DLR class) A repeats ... [more]
lrp2a3.437e-1434.62low density lipoprotein receptor-related protein 2... [more]
back to top
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sel1l1.001e-2934.13SEL1L adaptor subunit of ERAD E3 ubiquitin ligase ... [more]
sel1l7.154e-2833.33SEL1L adaptor subunit of ERAD E3 ubiquitin ligase ... [more]
sel1l1.711e-2734.13SEL1L adaptor subunit of ERAD E3 ubiquitin ligase ... [more]
rabggtb9.039e-1533.11Rab geranylgeranyltransferase subunit beta [Source... [more]
rabggtb1.488e-1433.33Rab geranylgeranyltransferase subunit beta [Source... [more]
back to top
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hspg27.141e-2533.49perlecan (heparan sulfate proteoglycan 2) [Source:... [more]
Hspg27.143e-2533.49perlecan (heparan sulfate proteoglycan 2) [Source:... [more]
Sorl11.742e-1536.99sortilin-related receptor, LDLR class A repeats-co... [more]
Vldlr2.667e-1433.57very low density lipoprotein receptor [Source:MGI ... [more]
Vldlr3.436e-1433.57very low density lipoprotein receptor [Source:MGI ... [more]
back to top
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P98160|PGBM_HUMAN2.451e-2434.70Basement membrane-specific heparan sulfate proteog... [more]
sp|Q05793|PGBM_MOUSE8.331e-2433.49Basement membrane-specific heparan sulfate proteog... [more]
sp|Q06561|UNC52_CAEEL5.972e-2029.14Basement membrane proteoglycan OS=Caenorhabditis e... [more]
sp|Q92673|SORL_HUMAN1.011e-1436.30Sortilin-related receptor OS=Homo sapiens OX=9606 ... [more]
sp|O88307|SORL_MOUSE1.218e-1436.99Sortilin-related receptor OS=Mus musculus OX=10090... [more]
back to top
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1DBM00.000e+037.35LDL-1 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
A0A1Z1R2753.123e-18038.23Low density lipoprotein receptor-related 1 (Fragme... [more]
A0A3Q0KD552.584e-13431.86Low-density lipoprotein receptor (Ldl) OS=Schistos... [more]
A0A183A6H71.986e-12830.94Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A504YLF08.434e-12831.44Basement membrane-specific heparan sulfate proteog... [more]
back to top
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspg26.975e-2735.59heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZD... [more]
hspg27.393e-2735.59heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZD... [more]
hspg28.704e-2735.59heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZD... [more]
hspg29.321e-2735.59heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZD... [more]
lrp1aa1.735e-1638.03low density lipoprotein receptor-related protein 1... [more]
back to top
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001137.18.787e-1437.12pep scaffold:Pmarinus_7.0:GL476464:95621:179961:-1... [more]
lrp1ab1.818e-1334.33low density lipoprotein receptor-related protein 1... [more]
lrp2a8.129e-1234.38low density lipoprotein receptor-related protein 2... [more]
sorl17.201e-1133.58sortilin-related receptor, L(DLR class) A repeats ... [more]
sorl17.614e-1030.37sortilin-related receptor, L(DLR class) A repeats ... [more]
back to top
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO452183.562e-1733.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494987.150e-1635.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO437261.590e-1335.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO439379.050e-1336.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494991.076e-1238.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspg24.152e-2735.00heparan sulfate proteoglycan 2 [Source:NCBI gene;A... [more]
lrp84.982e-1639.17low-density lipoprotein receptor-related protein 8... [more]
lrp85.403e-1639.17low-density lipoprotein receptor-related protein 8... [more]
sorl18.767e-1634.42sortilin related receptor 1 [Source:NCBI gene;Acc:... [more]
lrp2a7.188e-1438.28LDL receptor related protein 2 [Source:NCBI gene;A... [more]
back to top
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000012063.10.000e+099.35SMESG000012063.1[more]
SMESG000012063.10.000e+099.33SMESG000012063.1[more]
SMESG000026265.10.000e+034.69SMESG000026265.1[more]
SMESG000027815.10.000e+038.23SMESG000027815.1[more]
SMESG000027815.10.000e+038.23SMESG000027815.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016420 ID=SMED30016420|Name=Basement membrane-specific heparan sulfate proteoglycan core protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2989bp
AAAACCTTTATCTACTTTAAGATATAACCTCAAATATCGTTTCCGGTCGT
CGAAATAAACAATCTCACATAAATATCAGATATTTGATGAGTGACATTAA
TGCAAATTTATGAACCAGTTAACAATTCTCCATTTCGGTATACTTTTCAT
CATCTTCCATGAGTTTTCGTTTCAAGAAATTTCGCGGAAAACGATGTACA
TTGGTCAGAGTGCTAAACTCAGATGCGGTCCCCAACAAGACAAATTCTAT
AACATTAAAGTTTCGTACAAGTGGGAAAAGCCCTTGGGAAATGTGATCAG
CACAGATCCAGAATATAAAATTCAGGGTGCTACTTTAAATGATGGAGGAA
TCTATACATGTCGAATTACCCAAGTCATAAATGGCCAAATCACTGAGAAA
ACAATATCAACTGAGTTAGGTATTCAGTCAAAGGATTCTGACTCAGAAGA
AACTACGCCACCCATTTTCGTTGATCCCCCAATCATTAGTTTCAAAAATA
TCAACGAAGGATCTATAGATGTTCAAGAAACAGATTTTCTTTACACGGTT
TGTGAGGTGTCAAATTGGCAGCAGTCAGAATATACCTCTAGTTGGTGGTT
CAACCAAGCTCCGATTAATGGTGCAAACAAAATTCTTTTTGTTTCTTCAC
TAGATGCTGACAAAAATGCTGGATACTACACATGTCGAATAAATCACAAG
TTGTATTCACAAAAAACATATGAAAAGCAATTACTTGTTAATATCAAAAA
GCCGGAAATTTCTATCATTTCCTTTCCCGAAGAGAACTTAAAAATCGGAG
GGAGAATCTACCGAAAATGTGAAATGTTGGGTATTAAAATTTCCAGGAAT
GAAGCTCTCAAGTTTGCATGGATAAAAGATAATTCATTTGAAATTGCAAC
CGGAAGTATCCTCGACCTACCAATCCGTGATGAGTCGGTAAATGGTGATT
ATTCGTGCGTTATCAAATCGGAAAAACTTAATAAAAAATATTTTAAAGAA
CTTACAATTCGAATAGACTCCAATATCCCCCGAAATCCTAATCAACAAAG
AATTAATATTTTTAGTCAACCAATAAGTCCGGAACTGAACAACGAATTCA
AATTGAAATGTGAAATATTCCCCCCGATACCCAACGCAAATTATATATGG
AAAAAGGATAACAATGTCGTTAGTTATCAACAAACATTAGTTATTCCATC
CTTTCAAAGACAAGATATTGGATCTTATTCATGTGAAATAGTGTCACCAA
ATGGAGATACTTCCTCTTCCGGTCGCCAAATATCTGAAAATGTCAATGTA
AAGTTCCAATACTCGTCTAATAATAAAATTGAACTTGATAAATTTGGAGT
TCAAATGATTAGCCGAGTTGGGGAGAAAAAGGAGATGCATTGCGAAATTT
CAACATCATCTCCGAATCGTGGAAGCGATGTAGAATGGTTTTTCAATAAA
GAGAGACTTGATGAGACCATGAAACAACAGTATAAAATTTTAAGAAGTGA
CAGAAATTTTGTTAGTATCATATCCTTAACAAACATCAACCCGAAGAATG
AAGGATTATACACGTGCAGAGTTGATAATTCGGACAAAAAAGCCAATTTA
ATTGTTATTCAAGAAGAATCATCACTGACCATAAACCCGGAAAGAATTAT
ACGAAACGAAGGAGAACCTGTTGAATTCCATTGTCGCGGAAATGGAATTC
CAGATTTCATTAATACAAAGGTAAAATGGTCATTTAAAAGCAGAGATGGA
ACTGTTGTCATTTCATCTCTTGAAAACGAAAATAGATGGGAAATATCAAA
TAGTCCCGAAACCCCGGAAACGTCCTTTATTTCAATTTCTAGTAGCCTAT
ATAAAGATGGCGGATTTTACATATGTACTACAACAGAGGGTCTTCGAAGG
ACTGCTGAATTAGTAATTAAAAGAAGAGAAGATTCGACGCTTCTAACAAT
TACCCCAGAAATAGTAAGAGTAAGAAATGGCCAACCCGTTGTTGTAGAAT
GCTTTAGTGTATCAGAAAAAACTGGTGAGCCATATGGAGAACCGAAATTC
ACTATGGAATATGGAAAAAGTTTATCAACAGATCCACGGTTAGTTGAACA
GAAGGTCGGTCAATCAAGGGTTAGGTTATCCATCAAAGATGGTCTACAAA
CTAGCGATAACAACCTAAAAGTTGAATGTCATGATGGAATTCGAGTTAAA
AGTGCGACAATATTTTTAGAAAATCAGTGTCCCCAAAACTATCGACGATG
CAACAATGGTGAATGTCAACCATCGGGCAAATTCTGTGATGGAGTGGCCA
ATTGCGCAGATAGATCAGACGAAAATCCTTCAGTATGCAACAAATGCGAC
CCTTTGATTAATAAATGCGAGATTTACGGAAACAAAGTCCCGTTAAAAGA
TATATTTTTAATTCATTGGAAATGTGACGGAGAAAATGATTGCGGCAATA
ATTTTGACGAGTCACAATGTAATGAAAATGACTACAAATGTGGAAATATC
AAATTCAACTGCAGCAATGGAAAAGTCATCCCCAGAGCTTACCAATGTGA
TAAGGAATCAGACTGCTCAAATGGAGAGGACGAAGTCGGTTGTATTTTAC
CACAGGTAACAAGCATGACGGATGCAAAAGTAAGAAGAATTCGAAGAGAA
GGTAGCACTGAATTGAGGTGTGAAAGCTATGGAGTTCCAAGGCCTCACAT
TGTGTGGAGATATAATTGGGGCTGCTTGAGCGATAGTTTACGAATGACAA
TTAGAACGACAATTGAAGGCTGTAACAAAGTTATCAGTATATTAAGAATT
ACAAATTTTCAACCTGGGGATGATGGGATTTACAACTGTGAAACTCTCAG
CGGACCAAATAGAAGTTTCTCTGATGACTATCAGTTAATATTGGATAGCA
ATTAGAATAGCTCGAGTTCTTATGTTAAAAAGACAAGAAATTCATGTGTT
AGTAATTTGTTTTATAATAAATTTTAAACGATTCAAAAA
back to top

protein sequence of SMED30016420-orf-1

>SMED30016420-orf-1 ID=SMED30016420-orf-1|Name=SMED30016420-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=932bp
MNQLTILHFGILFIIFHEFSFQEISRKTMYIGQSAKLRCGPQQDKFYNIK
VSYKWEKPLGNVISTDPEYKIQGATLNDGGIYTCRITQVINGQITEKTIS
TELGIQSKDSDSEETTPPIFVDPPIISFKNINEGSIDVQETDFLYTVCEV
SNWQQSEYTSSWWFNQAPINGANKILFVSSLDADKNAGYYTCRINHKLYS
QKTYEKQLLVNIKKPEISIISFPEENLKIGGRIYRKCEMLGIKISRNEAL
KFAWIKDNSFEIATGSILDLPIRDESVNGDYSCVIKSEKLNKKYFKELTI
RIDSNIPRNPNQQRINIFSQPISPELNNEFKLKCEIFPPIPNANYIWKKD
NNVVSYQQTLVIPSFQRQDIGSYSCEIVSPNGDTSSSGRQISENVNVKFQ
YSSNNKIELDKFGVQMISRVGEKKEMHCEISTSSPNRGSDVEWFFNKERL
DETMKQQYKILRSDRNFVSIISLTNINPKNEGLYTCRVDNSDKKANLIVI
QEESSLTINPERIIRNEGEPVEFHCRGNGIPDFINTKVKWSFKSRDGTVV
ISSLENENRWEISNSPETPETSFISISSSLYKDGGFYICTTTEGLRRTAE
LVIKRREDSTLLTITPEIVRVRNGQPVVVECFSVSEKTGEPYGEPKFTME
YGKSLSTDPRLVEQKVGQSRVRLSIKDGLQTSDNNLKVECHDGIRVKSAT
IFLENQCPQNYRRCNNGECQPSGKFCDGVANCADRSDENPSVCNKCDPLI
NKCEIYGNKVPLKDIFLIHWKCDGENDCGNNFDESQCNENDYKCGNIKFN
CSNGKVIPRAYQCDKESDCSNGEDEVGCILPQVTSMTDAKVRRIRREGST
ELRCESYGVPRPHIVWRYNWGCLSDSLRMTIRTTIEGCNKVISILRITNF
QPGDDGIYNCETLSGPNRSFSDDYQLILDSN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036055LDL_receptor-like_sf
IPR036179Ig-like_dom_sf
IPR003598Ig_sub2
IPR013783Ig-like_fold
IPR013098Ig_I-set
IPR013151Immunoglobulin
IPR007110Ig-like_dom
IPR002172LDrepeatLR_classA_rpt
IPR003599Ig_sub
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005509calcium ion binding
GO:0008022protein C-terminus binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0001523retinoid metabolic process
GO:0001525angiogenesis
GO:0006024glycosaminoglycan biosynthetic process
GO:0006027glycosaminoglycan catabolic process
GO:0022617extracellular matrix disassembly
GO:0030198extracellular matrix organization
GO:0030203glycosaminoglycan metabolic process
GO:0044267cellular protein metabolic process
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005578proteinaceous extracellular matrix
GO:0005604basement membrane
GO:0005615extracellular space
GO:0005796Golgi lumen
GO:0005886plasma membrane
GO:0005925focal adhesion
GO:0031012extracellular matrix
GO:0043202lysosomal lumen
GO:0070062extracellular exosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPRINTSPR00261LDLRECEPTORcoord: 302..323
score: 46.01
coord: 348..369
score: 39.36
coord: 389..410
score: 44.57
IPR002172Low-density lipoprotein (LDL) receptor class A repeatSMARTSM00192LDLa_2coord: 337..374
e-value: 0.62
score: 6.0
coord: 291..330
e-value: 2.1E-8
score: 44.0
coord: 378..415
e-value: 3.8E-6
score: 36.4
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPFAMPF00057Ldl_recept_acoord: 378..413
e-value: 4.1E-9
score: 36.5
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPROSITEPS50068LDLRA_2coord: 330..373
score: 8.85
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPROSITEPS50068LDLRA_2coord: 291..329
score: 11.0
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPROSITEPS50068LDLRA_2coord: 378..414
score: 11.05
IPR002172Low-density lipoprotein (LDL) receptor class A repeatCDDcd00112LDLacoord: 353..372
e-value: 0.00133106
score: 34.4898
IPR002172Low-density lipoprotein (LDL) receptor class A repeatCDDcd00112LDLacoord: 292..324
e-value: 3.33294E-7
score: 44.505
IPR002172Low-density lipoprotein (LDL) receptor class A repeatCDDcd00112LDLacoord: 379..413
e-value: 2.99223E-7
score: 44.505
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 424..514
e-value: 0.023
score: 23.8
coord: 95..200
e-value: 2.3E-4
score: 30.5
coord: 1..85
e-value: 0.74
score: 18.9
IPR003598Immunoglobulin subtype 2SMARTSM00408igc2_5coord: 101..181
e-value: 1.0
score: 7.1
coord: 4..78
e-value: 0.66
score: 8.9
coord: 430..502
e-value: 3.5E-5
score: 33.2
IPR036055LDL receptor-like superfamilyGENE3DG3DSA:4.10.400.10coord: 337..375
e-value: 4.7E-5
score: 25.0
IPR036055LDL receptor-like superfamilyGENE3DG3DSA:4.10.400.10coord: 378..416
e-value: 3.8E-10
score: 41.3
IPR036055LDL receptor-like superfamilyGENE3DG3DSA:4.10.400.10coord: 286..332
e-value: 6.9E-9
score: 37.2
IPR036055LDL receptor-like superfamilySUPERFAMILYSSF57424LDL receptor-like modulecoord: 288..327
IPR036055LDL receptor-like superfamilySUPERFAMILYSSF57424LDL receptor-like modulecoord: 378..418
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 1..86
e-value: 1.9E-11
score: 45.7
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 417..508
e-value: 1.5E-10
score: 42.7
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 87..193
e-value: 3.0E-7
score: 32.3
IPR013151ImmunoglobulinPFAMPF00047igcoord: 5..82
e-value: 3.2E-7
score: 30.4
NoneNo IPR availablePFAMPF13927Ig_3coord: 416..496
e-value: 1.4E-7
score: 32.0
NoneNo IPR availablePANTHERPTHR11640NEPHRINcoord: 291..498
NoneNo IPR availablePANTHERPTHR11640NEPHRINcoord: 54..237
NoneNo IPR availablePANTHERPTHR11640:SF79HEPARAN SULFATE PROTEOGLYCAN 2coord: 54..237
NoneNo IPR availablePANTHERPTHR11640:SF79HEPARAN SULFATE PROTEOGLYCAN 2coord: 291..498
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 416..506
score: 10.517
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 102..187
score: 8.448
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 1..92
score: 10.099
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 92..179
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 4..80
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 427..498