Venom allergen 5

Overview
NameVenom allergen 5
Smed IDSMED30016401
Length (bp)1445
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Venom allergen 5 (SMED30016401) t-SNE clustered cells

Violin plots show distribution of expression levels for Venom allergen 5 (SMED30016401) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Venom allergen 5 (SMED30016401) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Venom allergen 5 (SMED30016401) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016401

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30016401SMESG000005602.1 dd_Smed_v4_1988_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30016401SMESG000005602.1 dd_Smed_v4_1988_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30016401SMESG000005602.1 dd_Smed_v6_1988_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30016401SMESG000005602.1 dd_Smed_v6_1988_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30016401SMESG000005602.1 dd_Smed_v4_1988_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30016401SMESG000005602.1 dd_Smed_v4_1988_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30016401SMESG000005602.1 dd_Smed_v4_1988_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Venom allergen 5 vs. Ensembl Human
Match: GLIPR2 (GLI pathogenesis related 2 [Source:HGNC Symbol;Acc:HGNC:18007])

HSP 1 Score: 111.694 bits (278), Expect = 1.959e-28
Identity = 62/160 (38.75%), Postives = 93/160 (58.13%), Query Frame = 3
Query:   81 LKMSELEDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFV--GKYLENVPP 554
            +  S  + F+ E L +HN  R++H  PPL+  K L+ +AQ+Y+E +A+   ++HS +  R   GENLA     +  Y  +G   +  WYSEIK+Y+F    QP     TGHFT ++WK +K+ G G+A + +    ++V RY PAGN V  G + ENV P
Sbjct:    1 MGKSASKQFHNEVLKAHNEYRQKHGVPPLKLCKNLNREAQQYSEALASTRILKHSPESSRGQCGENLA-----WASYDQTGKEVADRWYSEIKNYNFQ---QPGFTSGTGHFTAMVWKNTKKMGVGKA-SASDGSSFVVARYFPAGNVVNEGFFEENVLP 151          

HSP 2 Score: 72.7886 bits (177), Expect = 1.281e-14
Identity = 57/154 (37.01%), Postives = 81/154 (52.60%), Query Frame = 3
Query:  903 KSFIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVP------LGENITTKKGNVTEESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXESFIVCFYSPAGNTKNE--FSQNV 1340
            K F   V+  HN YR+ H V  L L   LN  AQ +++ LA       S  + ++ P       GEN+        +++ K + D WY+E +NYN++ +P      GHFT ++WK +KK+GVG    S G SF+V  Y PAGN  NE  F +NV
Sbjct:    7 KQFHNEVLKAHNEYRQKHGVPPLKLCKNLNREAQQYSEALA-------STRILKHSPESSRGQCGENLAWAS---YDQTGKEVADRWYSEIKNYNFQ-QPGFTSGTGHFTAMVWKNTKKMGVGKASASDGSSFVVARYFPAGNVVNEGFFEENV 149          
BLAST of Venom allergen 5 vs. Ensembl Human
Match: GLIPR2 (GLI pathogenesis related 2 [Source:HGNC Symbol;Acc:HGNC:18007])

HSP 1 Score: 83.5741 bits (205), Expect = 1.072e-18
Identity = 54/157 (34.39%), Postives = 79/157 (50.32%), Query Frame = 3
Query:   90 SELEDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFV--GKYLENVPP 554
            S  + F+ E L +HN  R++H  PPL+  K L+ +AQ+Y+E +A+   ++HS +  R   GENLA                   W S    YD            TGHFT ++WK +K+ G G+A + +    ++V RY PAGN V  G + ENV P
Sbjct:    4 SASKQFHNEVLKAHNEYRQKHGVPPLKLCKNLNREAQQYSEALASTRILKHSPESSRGQCGENLA-------------------WAS----YD-----------QTGHFTAMVWKNTKKMGVGKA-SASDGSSFVVARYFPAGNVVNEGFFEENVLP 125          

HSP 2 Score: 50.0618 bits (118), Expect = 5.730e-7
Identity = 50/148 (33.78%), Postives = 66/148 (44.59%), Query Frame = 3
Query:  903 KSFIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGNVTEESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXESFIVCFYSPAGNTKNE--FSQNV 1340
            K F   V+  HN YR+ H V  L L   LN  AQ +++ LA       S  + ++ P      + +G   E  A A  D                     GHFT ++WK +KK+GVG    S G SF+V  Y PAGN  NE  F +NV
Sbjct:    7 KQFHNEVLKAHNEYRQKHGVPPLKLCKNLNREAQQYSEALA-------STRILKHSP-----ESSRGQCGENLAWASYD-------------------QTGHFTAMVWKNTKKMGVGKASASDGSSFVVARYFPAGNVVNEGFFEENV 123          
BLAST of Venom allergen 5 vs. Ensembl Human
Match: CRISP2 (cysteine rich secretory protein 2 [Source:HGNC Symbol;Acc:HGNC:12024])

HSP 1 Score: 74.3294 bits (181), Expect = 1.948e-14
Identity = 52/146 (35.62%), Postives = 75/146 (51.37%), Query Frame = 3
Query:  114 ECLHSHNGLRKEHNAPP-----LRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRND---AGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNC--WYIVGRYQPAGN 521
            E ++ HN LRK  + P      + +S++++ +AQR+A     K  ++HS  EDR      GENL MS  P      S   A  SWY EI D+ +    + PN    GH+TQL+W  + + G G A  P  +   +Y V +Y PAGN
Sbjct:   39 EIVNKHNELRKAVSPPASNMLKMEWSREVTTNAQRWAN----KCTLQHSDPEDRKTSTRCGENLYMSSDPT-----SWSSAIQSWYDEILDFVYGVGPKSPN-AVVGHYTQLVWYSTYQVGCGIAYCPNQDSLKYYYVCQYCPAGN 174          
BLAST of Venom allergen 5 vs. Ensembl Human
Match: CRISP2 (cysteine rich secretory protein 2 [Source:HGNC Symbol;Acc:HGNC:12024])

HSP 1 Score: 74.3294 bits (181), Expect = 1.948e-14
Identity = 52/146 (35.62%), Postives = 75/146 (51.37%), Query Frame = 3
Query:  114 ECLHSHNGLRKEHNAPP-----LRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRND---AGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNC--WYIVGRYQPAGN 521
            E ++ HN LRK  + P      + +S++++ +AQR+A     K  ++HS  EDR      GENL MS  P      S   A  SWY EI D+ +    + PN    GH+TQL+W  + + G G A  P  +   +Y V +Y PAGN
Sbjct:   39 EIVNKHNELRKAVSPPASNMLKMEWSREVTTNAQRWAN----KCTLQHSDPEDRKTSTRCGENLYMSSDPT-----SWSSAIQSWYDEILDFVYGVGPKSPN-AVVGHYTQLVWYSTYQVGCGIAYCPNQDSLKYYYVCQYCPAGN 174          
BLAST of Venom allergen 5 vs. Ensembl Human
Match: CRISP2 (cysteine rich secretory protein 2 [Source:HGNC Symbol;Acc:HGNC:12024])

HSP 1 Score: 70.4774 bits (171), Expect = 7.584e-13
Identity = 50/144 (34.72%), Postives = 73/144 (50.69%), Query Frame = 3
Query:  114 ECLHSHNGLRKEHNAPP-----LRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRND---AGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNC--WYIVGRYQPA 515
            E ++ HN LRK  + P      + +S++++ +AQR+A     K  ++HS  EDR      GENL MS  P      S   A  SWY EI D+ +    + PN    GH+TQL+W  + + G G A  P  +   +Y V +Y PA
Sbjct:   39 EIVNKHNELRKAVSPPASNMLKMEWSREVTTNAQRWAN----KCTLQHSDPEDRKTSTRCGENLYMSSDPT-----SWSSAIQSWYDEILDFVYGVGPKSPN-AVVGHYTQLVWYSTYQVGCGIAYCPNQDSLKYYYVCQYCPA 172          
BLAST of Venom allergen 5 vs. Ensembl Celegans
Match: C07A4.3 (pep chromosome:WBcel235:X:10174985:10175896:1 gene:WBGene00007398.1 transcript:C07A4.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C07A4.3)

HSP 1 Score: 70.4774 bits (171), Expect = 1.032e-13
Identity = 43/116 (37.07%), Postives = 60/116 (51.72%), Query Frame = 3
Query:  897 EIKSFIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVP--LGENIT---TKKGNVTEESAKALVDSWYNEGRNYNY-RKEPDNFKSVGHFTQLLW 1226
             IK   + +V  HN YR +H+   + +D+ L   AQ W+DE+A   K      L    P   GEN+T   + K    +  A AL+  +Y EG  +NY R  P ++  VGHFTQLLW
Sbjct:   40 SIKDLKKWIVHFHNKYRAHHSSPAVTVDSNLTNLAQKWSDEMAFHKKC-----LVHEQPSKYGENLTSFASSKFPSPKTCAAALIHGFYTEGYGFNYTRFNPGSWSKVGHFTQLLW 150          

HSP 2 Score: 57.3806 bits (137), Expect = 2.762e-9
Identity = 50/162 (30.86%), Postives = 73/162 (45.06%), Query Frame = 3
Query:   93 ELEDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKK----EDRNDAGENL-AMSMRPFVDYKYSGLGASASWYSEIKDYDFN-KEAQPPNNPATGHFTQLIWKGSKEAGFG--RAKNPTSNCWYIVGRYQPAGNFVGK--YLENV 548
             ++D     +H HN  R  H++P +     L+  AQ+++      DEM   KK    E  +  GENL + +   F   K         +Y+E   Y FN     P +    GHFTQL+WK S++ G G   AK  T    Y+  +Y P GN      Y++NV
Sbjct:   40 SIKDLKKWIVHFHNKYRAHHSSPAVTVDSNLTNLAQKWS------DEMAFHKKCLVHEQPSKYGENLTSFASSKFPSPKTCAAALIHGFYTE--GYGFNYTRFNPGSWSKVGHFTQLLWKNSRKIGVGVSVAKRGTMYHVYVCIKYDPPGNMQTSEAYMDNV 193          
BLAST of Venom allergen 5 vs. Ensembl Celegans
Match: F57B7.2 (pep chromosome:WBcel235:V:11441925:11443484:-1 gene:WBGene00010192.1 transcript:F57B7.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F57B7.2)

HSP 1 Score: 65.0846 bits (157), Expect = 1.988e-11
Identity = 47/157 (29.94%), Postives = 77/157 (49.04%), Query Frame = 3
Query:   87 MSELEDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAG--NFVGKYLENVP 551
            +SE+ +F   CL +HN  R+ +    L +S +L+  A  +A  +A +  + +    +    GENL +       +  +G      W  E + +DF+K   P  NP    F+Q++WK + E G  R  N  +NC  +V  Y+PAG  N  G++  NVP
Sbjct:  108 LSEV-NFQRSCLDAHNECRQRYGNENLCWSTELAEMAHAWAVKLADRGRVLYP---ELPGIGENLILKEANEQSHLPTGQEVIQEWEKEAQFFDFDK---PRWNPKCQRFSQVVWKDTTELGAARYWNTANNCVAVVCFYRPAGNSNAPGEFASNVP 257          
BLAST of Venom allergen 5 vs. Ensembl Celegans
Match: F57B7.2 (pep chromosome:WBcel235:V:11441925:11443603:-1 gene:WBGene00010192.1 transcript:F57B7.2b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F57B7.2)

HSP 1 Score: 64.6994 bits (156), Expect = 3.324e-11
Identity = 47/160 (29.38%), Postives = 78/160 (48.75%), Query Frame = 3
Query:   84 KMSELEDFNYE--CLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAG--NFVGKYLENVP 551
            K + L + N++  CL +HN  R+ +    L +S +L+  A  +A  +A +  + +    +    GENL +       +  +G      W  E + +DF+K   P  NP    F+Q++WK + E G  R  N  +NC  +V  Y+PAG  N  G++  NVP
Sbjct:  145 KYTALSEVNFQRSCLDAHNECRQRYGNENLCWSTELAEMAHAWAVKLADRGRVLYP---ELPGIGENLILKEANEQSHLPTGQEVIQEWEKEAQFFDFDK---PRWNPKCQRFSQVVWKDTTELGAARYWNTANNCVAVVCFYRPAGNSNAPGEFASNVP 298          
BLAST of Venom allergen 5 vs. Ensembl Celegans
Match: F09B9.5 (pep chromosome:WBcel235:X:10154821:10156856:1 gene:WBGene00008604.1 transcript:F09B9.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F09B9.5)

HSP 1 Score: 61.6178 bits (148), Expect = 6.335e-11
Identity = 38/111 (34.23%), Postives = 59/111 (53.15%), Query Frame = 3
Query:  894 EEIKSFIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGNVTEESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLW 1226
            E+ K F++ ++ +HN  R+ H+   L    +L+  AQ WAD+LA +  +SFS    E   +GENIT    ++  ES   +V+ WY E   Y Y   P       +FTQ++W
Sbjct:    5 EDEKEFVDQMLLEHNTRRKMHSAPNLECSEELSEMAQQWADKLAKQAHISFS----ELSGIGENITFFPPDIDAES---VVEHWYQEHEKYEYET-PGWQTGTNYFTQVIW 107          

HSP 2 Score: 55.8398 bits (133), Expect = 6.561e-9
Identity = 39/122 (31.97%), Postives = 63/122 (51.64%), Query Frame = 3
Query:   99 EDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRA 464
            ++F  + L  HN  RK H+AP L  S++LS  AQ++A+ +A +  +  S   + +  GEN+     P +D +         WY E + Y++     P     T +FTQ+IW+ +KE G G A
Sbjct:    8 KEFVDQMLLEHNTRRKMHSAPNLECSEELSEMAQQWADKLAKQAHISFS---ELSGIGENITF-FPPDIDAE----SVVEHWYQEHEKYEYET---PGWQTGTNYFTQVIWRSTKEIGVGCA 118          
BLAST of Venom allergen 5 vs. Ensembl Celegans
Match: D2062.1 (pep chromosome:WBcel235:II:2631473:2633054:1 gene:WBGene00017055.1 transcript:D2062.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:D2062.1)

HSP 1 Score: 59.3066 bits (142), Expect = 6.547e-10
Identity = 42/128 (32.81%), Postives = 63/128 (49.22%), Query Frame = 3
Query:  864 SDKDSDKGENEEIKSFIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVP--LGENIT--TKKGN--VTEESAKALVDSWYNEGRNYNYRK-EPDNFKSVGHFTQLLW 1226
            +DK    G N  I    E +V+ HN YR  H    L  D  ++  A+ WADE+A       S ++    P   GEN+    + G   + +  A+A+V  +Y EG  Y+Y   +P+  K  GHFTQ++W
Sbjct:   34 ADKQDLAGYN--IPKLKELIVAYHNLYRSKHGAPPLVADPVMDVAAKRWADEMAK------SGWISHEKPRKYGENVAMFCQSGCWPLPQTLAQAMVHLFYIEGIGYDYSSFKPELLKENGHFTQIVW 153          

HSP 2 Score: 55.4546 bits (132), Expect = 1.215e-8
Identity = 45/149 (30.20%), Postives = 70/149 (46.98%), Query Frame = 3
Query:  129 HNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASAS--WYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYI-----VGRYQPAGNFVGK--YLENV 548
            HN  R +H APPL     + + A+R+A+ +A    + H K       GEN+AM  +         L  +    +Y E   YD++   +P      GHFTQ++WK S++ G G +   +S   YI       ++ P GN + +  YL NV
Sbjct:   55 HNLYRSKHGAPPLVADPVMDVAAKRWADEMAKSGWISHEKPRKY---GENVAMFCQSGCWPLPQTLAQAMVHLFYIEGIGYDYS-SFKPELLKENGHFTQIVWKSSRKIGVGISIGKSSQPPYIPTMFHCVKFDPPGNVLAQQYYLSNV 199          
BLAST of Venom allergen 5 vs. Ensembl Fly
Match: CG31482 (gene:FBgn0051482 transcript:FBtr0081679)

HSP 1 Score: 102.449 bits (254), Expect = 5.428e-25
Identity = 63/176 (35.80%), Postives = 93/176 (52.84%), Query Frame = 3
Query:  102 DFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFVGKYLENVPPLPRGQ------------KWDKVPII 593
            D   + L+ HN LR++H +PPL    +L+   + YA+++A  +++EHS    +N  GENL M  +       + L     WY EI DYDF K   P    +TGHFT L+WK +K+ G G+AK+     W +V RY P  N  G++ ENV P  +G+            + D +PII
Sbjct:   21 DLQEDHLNEHNRLREKHGSPPLTLDDELTKGCEEYAKVLANNEKLEHSSSAGQN-YGENLCMRSQ-------TPLQCVQDWYDEIADYDFEK---PQFAMSTGHFTALVWKNAKKMGIGQAKDKKGYYW-VVARYYPPVNVNGQFEENVLPPIKGEGDENGQGNLNRFQVDNIPII 184          

HSP 2 Score: 55.4546 bits (132), Expect = 1.174e-8
Identity = 46/139 (33.09%), Postives = 74/139 (53.24%), Query Frame = 3
Query:  924 VSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGNVTEESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXESFIVCFYSPAGNTKNEFSQNV 1340
            +++HN  R  H    L LD++L    +++A  LA   K+  S+   +N   GEN+  +      ++    V  WY+E  +Y++ K P    S GHFT L+WK +KK+G+G  K+ KG  ++V  Y P  N   +F +NV
Sbjct:   27 LNEHNRLREKHGSPPLTLDDELTKGCEEYAKVLANNEKLEHSSSAGQN--YGENLCMRS-----QTPLQCVQDWYDEIADYDFEK-PQFAMSTGHFTALVWKNAKKMGIGQAKDKKGYYWVVARYYPPVNVNGQFEENV 157          
BLAST of Venom allergen 5 vs. Ensembl Fly
Match: CG16995 (gene:FBgn0031412 transcript:FBtr0077758)

HSP 1 Score: 76.6406 bits (187), Expect = 1.953e-16
Identity = 55/152 (36.18%), Postives = 80/152 (52.63%), Query Frame = 3
Query:   99 EDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFVGKYLENVPP 554
            + F  E L +HN  R +H A PL  S +L+  A  +A  + +++ MEH +    +  GEN+ M+          G  A  SWY EI+ Y++N    P     TGHFTQ++WK S E G G AK+ ++   Y+V  Y P GN+   + ENV P
Sbjct:    4 QQFEQEVLQAHNLYRAKHGAQPLTLSPKLNRLATEWANYLLSRNRMEHRQN---SGYGENIYMA----SGGNLKGADAVRSWYEEIRQYNWNS---PSFQGNTGHFTQVVWKSSTELGVGFAKSGSTI--YVVCNYNPPGNYNNLFRENVAP 143          

HSP 2 Score: 60.4622 bits (145), Expect = 1.043e-10
Identity = 40/109 (36.70%), Postives = 53/109 (48.62%), Query Frame = 3
Query:  903 KSFIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENI-TTKKGNVTEESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLW 1226
            + F + V+  HN YR  H    L L  +LN  A +WA+ L   N+M       +N   GENI     GN+    A   V SWY E R YN+   P    + GHFTQ++W
Sbjct:    4 QQFEQEVLQAHNLYRAKHGAQPLTLSPKLNRLATEWANYLLSRNRMEHR----QNSGYGENIYMASGGNLKGADA---VRSWYEEIRQYNW-NSPSFQGNTGHFTQVVW 104          
BLAST of Venom allergen 5 vs. Ensembl Fly
Match: CG4270 (gene:FBgn0031407 transcript:FBtr0077754)

HSP 1 Score: 76.6406 bits (187), Expect = 3.914e-16
Identity = 53/152 (34.87%), Postives = 72/152 (47.37%), Query Frame = 3
Query:   99 EDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFVGKYLENVPP 554
            E F  E  ++ N  R  H  P +  +  L+  AQ +A  +  ++ M H         GEN+ +S         +G      WY EI  YDFNK       P  GHFTQLIWK S E G G A+   ++  ++V  Y P GN VG + +NVPP
Sbjct:   29 ELFLKEVFNTTNKYRAMHGCPAVTINAALNKLAQEWANHLRDQNTMAHRPNPKY---GENIFLSG----GMDVTGDLPVEMWYREINSYDFNKAQF---VPTAGHFTQLIWKSSVEMGSGVARK--ADRTWVVCNYNPPGNVVGLFKDNVPP 168          

HSP 2 Score: 67.3958 bits (163), Expect = 6.254e-13
Identity = 52/153 (33.99%), Postives = 78/153 (50.98%), Query Frame = 3
Query:  882 KGENEEIKSFIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGNVTEESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXESFIVCFYSPAGNTKNEFSQNV 1340
            KG NE    F++ V +  N YR  H    + ++  LN  AQ+WA+ L  +N M+       N   GENI    G   + +    V+ WY E  +Y++ K      + GHFTQL+WK S ++G GV + +   +++VC Y+P GN    F  NV
Sbjct:   25 KGNNE---LFLKEVFNTTNKYRAMHGCPAVTINAALNKLAQEWANHLRDQNTMAHR----PNPKYGENIFLSGG--MDVTGDLPVEMWYREINSYDFNKA-QFVPTAGHFTQLIWKSSVEMGSGVARKAD-RTWVVCNYNPPGNVVGLFKDNV 166          
BLAST of Venom allergen 5 vs. Ensembl Fly
Match: CG34049 (gene:FBgn0054049 transcript:FBtr0302372)

HSP 1 Score: 78.5666 bits (192), Expect = 1.034e-15
Identity = 54/147 (36.73%), Postives = 76/147 (51.70%), Query Frame = 3
Query:  903 KSFIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKM-SFSNYLFENVPLGENITTKKGNVTEESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXESFIVCFYSPAGNTKNEFSQNV 1340
            K   +AV+ + N YRR HN   L +D +L +YAQ+WAD LA  NK+ +  N L+     GENI   +   ++ S   ++  WY E  NY+Y K   N  + GHFTQL+W +  +             +IVC Y P GN    F +NV
Sbjct:  143 KPIKQAVLRETNKYRRLHNANPLKMDEKLCSYAQEWADHLADLNKLETRPNPLY-----GENIMRVRR--SKFSVDQILKLWYQEKYNYDYLKPGFNLYT-GHFTQLVW-RESEFLGVGVACDVSSIWIVCNYHPPGNVSEHFRENV 280          

HSP 2 Score: 67.3958 bits (163), Expect = 5.016e-12
Identity = 51/145 (35.17%), Postives = 72/145 (49.66%), Query Frame = 3
Query:  120 LHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFVGKYLENVPP 554
            L   N  R+ HNA PL+  ++L   AQ +A+ +A  +++E          GEN+    R     K+S       WY E  +YD+ K   P  N  TGHFTQL+W+ S+  G G A + +S   +IV  Y P GN    + ENV P
Sbjct:  150 LRETNKYRRLHNANPLKMDEKLCSYAQEWADHLADLNKLE---TRPNPLYGENIMRVRRS----KFSVDQILKLWYQEKYNYDYLK---PGFNLYTGHFTQLVWRESEFLGVGVACDVSS--IWIVCNYHPPGNVSEHFRENVLP 282          
BLAST of Venom allergen 5 vs. Ensembl Fly
Match: CG4270 (gene:FBgn0031407 transcript:FBtr0077755)

HSP 1 Score: 58.151 bits (139), Expect = 6.090e-10
Identity = 42/123 (34.15%), Postives = 55/123 (44.72%), Query Frame = 3
Query:   99 EDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAK 467
            E F  E  ++ N  R  H  P +  +  L+  AQ +A  +  ++ M H         GEN+ +S         +G      WY EI  YDFNK    P     GHFTQLIWK S E G G A+
Sbjct:   29 ELFLKEVFNTTNKYRAMHGCPAVTINAALNKLAQEWANHLRDQNTMAHRPNPKY---GENIFLSG----GMDVTGDLPVEMWYREINSYDFNKAQFVP---TAGHFTQLIWKSSVEMGSGVAR 141          

HSP 2 Score: 56.225 bits (134), Expect = 2.348e-9
Identity = 38/115 (33.04%), Postives = 56/115 (48.70%), Query Frame = 3
Query:  882 KGENEEIKSFIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGNVTEESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLW 1226
            KG NE    F++ V +  N YR  H    + ++  LN  AQ+WA+ L  +N M+       N   GENI    G   + +    V+ WY E  +Y++ K      + GHFTQL+W
Sbjct:   25 KGNNE---LFLKEVFNTTNKYRAMHGCPAVTINAALNKLAQEWANHLRDQNTMAHR----PNPKYGENIFLSGG--MDVTGDLPVEMWYREINSYDFNKA-QFVPTAGHFTQLIW 129          
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Match: glipr2l (GLI pathogenesis-related 2, like [Source:ZFIN;Acc:ZDB-GENE-041010-53])

HSP 1 Score: 113.235 bits (282), Expect = 3.417e-29
Identity = 64/162 (39.51%), Postives = 93/162 (57.41%), Query Frame = 3
Query:   75 IGLKMSELEDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFV--GKYLENVPP 554
            +G   S L  F+ E L +HN  R++H APPL+ S +L  +A RYAE +A+   ++HS +  R + GENLA     +  Y  +G   +  WY+E+  Y+FN   QP  +  TGHFT ++WKGSK+ G G+A   +    ++V RY PAGN    G +  NV P
Sbjct:    1 MGKSASRL--FSEEALKTHNEYRRKHQAPPLKLSSKLCSEASRYAESLASTRILKHSVESSRGNCGENLA-----WASYDQTGKDVTDRWYNEVNQYNFN---QPGFSSGTGHFTAVVWKGSKKLGVGKAV-ASDGSTFVVARYFPAGNITNQGHFQANVLP 151          

HSP 2 Score: 65.4698 bits (158), Expect = 2.493e-12
Identity = 53/154 (34.42%), Postives = 74/154 (48.05%), Query Frame = 3
Query:  909 FIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGNVTE--------ESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXESFIVCFYSPAGNTKNE--FSQNV 1340
            F E  +  HN YRR H    L L ++L + A  +A+ LA    +  S            + + +GN  E        ++ K + D WYNE   YN+  +P      GHFT ++WK SKK+GVG    S G +F+V  Y PAGN  N+  F  NV
Sbjct:    9 FSEEALKTHNEYRRKHQAPPLKLSSKLCSEASRYAESLASTRILKHS------------VESSRGNCGENLAWASYDQTGKDVTDRWYNEVNQYNF-NQPGFSSGTGHFTAVVWKGSKKLGVGKAVASDGSTFVVARYFPAGNITNQGHFQANV 149          
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Match: im:7150988 (im:7150988 [Source:ZFIN;Acc:ZDB-GENE-050309-169])

HSP 1 Score: 112.079 bits (279), Expect = 7.895e-29
Identity = 67/153 (43.79%), Postives = 89/153 (58.17%), Query Frame = 3
Query:  102 DFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFV--GKYLENVPP 554
             F  E L +HN  R +H APPL Y + L   AQ++AE + +K  + HS+ E+    GEN+  S    V    +G  A  SWYSEIKDY+F K     + P TGHFTQ++WK SKE G G A +   N  ++VG+Y+PAGN    G Y +NV P
Sbjct:    5 SFKQEFLQTHNQYRHQHQAPPLVYREDLCRAAQKWAEHMLSKKSLGHSETEN----GENVYYSFSS-VKKTPTGKEAVDSWYSEIKDYNFAKSG---HQPKTGHFTQVVWKSSKELGVGLATD--GNTVFVVGQYKPAGNITNAGYYEQNVLP 147          

HSP 2 Score: 62.7734 bits (151), Expect = 2.615e-11
Identity = 55/148 (37.16%), Postives = 78/148 (52.70%), Query Frame = 3
Query:  906 SFIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGNVTEE-SAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXESFIVCFYSPAGNTKNE--FSQNV 1340
            SF +  +  HN YR  H    L     L   AQ WA+ +   +K S  +   EN   GEN+     +V +  + K  VDSWY+E ++YN+ K     K+ GHFTQ++WK SK++GVG+  +     F+V  Y PAGN  N   + QNV
Sbjct:    5 SFKQEFLQTHNQYRHQHQAPPLVYREDLCRAAQKWAEHML--SKKSLGHSETEN---GENVYYSFSSVKKTPTGKEAVDSWYSEIKDYNFAKSGHQPKT-GHFTQVVWKSSKELGVGLATDGNT-VFVVGQYKPAGNITNAGYYEQNV 145          
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Match: im:7150988 (im:7150988 [Source:ZFIN;Acc:ZDB-GENE-050309-169])

HSP 1 Score: 112.079 bits (279), Expect = 7.895e-29
Identity = 67/153 (43.79%), Postives = 89/153 (58.17%), Query Frame = 3
Query:  102 DFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFV--GKYLENVPP 554
             F  E L +HN  R +H APPL Y + L   AQ++AE + +K  + HS+ E+    GEN+  S    V    +G  A  SWYSEIKDY+F K     + P TGHFTQ++WK SKE G G A +   N  ++VG+Y+PAGN    G Y +NV P
Sbjct:    5 SFKQEFLQTHNQYRHQHQAPPLVYREDLCRAAQKWAEHMLSKKSLGHSETEN----GENVYYSFSS-VKKTPTGKEAVDSWYSEIKDYNFAKSG---HQPKTGHFTQVVWKSSKELGVGLATD--GNTVFVVGQYKPAGNITNAGYYEQNVLP 147          

HSP 2 Score: 62.7734 bits (151), Expect = 2.615e-11
Identity = 55/148 (37.16%), Postives = 78/148 (52.70%), Query Frame = 3
Query:  906 SFIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGNVTEE-SAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXESFIVCFYSPAGNTKNE--FSQNV 1340
            SF +  +  HN YR  H    L     L   AQ WA+ +   +K S  +   EN   GEN+     +V +  + K  VDSWY+E ++YN+ K     K+ GHFTQ++WK SK++GVG+  +     F+V  Y PAGN  N   + QNV
Sbjct:    5 SFKQEFLQTHNQYRHQHQAPPLVYREDLCRAAQKWAEHML--SKKSLGHSETEN---GENVYYSFSSVKKTPTGKEAVDSWYSEIKDYNFAKSGHQPKT-GHFTQVVWKSSKELGVGLATDGNT-VFVVGQYKPAGNITNAGYYEQNV 145          
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Match: AL929549.2 (pep chromosome:GRCz11:CHR_ALT_CTG5_1_26:33034715:33037880:-1 gene:ENSDARG00000113959.1 transcript:ENSDART00000189171.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL929549.2)

HSP 1 Score: 108.227 bits (269), Expect = 2.904e-27
Identity = 67/160 (41.88%), Postives = 92/160 (57.50%), Query Frame = 3
Query:  114 ECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNF--VGKYLENVPPLPRGQKWDKVP 587
            E L  HN  RK+H APPL ++K L   AQ++AE + +   + HS K      GENL  +     + K +G  A  SWY EIKDY+F++   P  +  TGHFTQ++WK +KE G G A +   N  ++VG+Y PAGN    G + +NV  LP G K D+ P
Sbjct:    5 EFLQVHNAYRKQHGAPPLTFNKNLCRSAQQWAEHLLSTKTLAHSNK----GYGENLYYAWSS-ANKKLTGNEAVDSWYGEIKDYNFSR---PGFSSKTGHFTQVVWKDTKELGVGLATD--GNTIFVVGQYLPAGNIANAGYFEKNV--LPTGSKLDQKP 152          

HSP 2 Score: 58.5362 bits (140), Expect = 7.682e-10
Identity = 48/139 (34.53%), Postives = 72/139 (51.80%), Query Frame = 3
Query:  933 HNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGNVTEE-SAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXESFIVCFYSPAGNTKNE--FSQNV 1340
            HN YR+ H    L  +  L   AQ WA+ L     ++ SN  +     GEN+     +  ++ +    VDSWY E ++YN+ + P      GHFTQ++WK +K++GVG+  +     F+V  Y PAGN  N   F +NV
Sbjct:   10 HNAYRKQHGAPPLTFNKNLCRSAQQWAEHLLSTKTLAHSNKGY-----GENLYYAWSSANKKLTGNEAVDSWYGEIKDYNFSR-PGFSSKTGHFTQVVWKDTKELGVGLATDGNT-IFVVGQYLPAGNIANAGYFEKNV 141          
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Match: CR855258.3 (pep chromosome:GRCz11:CHR_ALT_CTG5_2_7:33042518:33044681:-1 gene:ENSDARG00000113775.1 transcript:ENSDART00000180085.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR855258.3)

HSP 1 Score: 107.842 bits (268), Expect = 3.417e-27
Identity = 67/162 (41.36%), Postives = 92/162 (56.79%), Query Frame = 3
Query:  102 DFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNF--VGKYLENVPPLPRGQKWDK 581
             F  E L  HN  RK+H APPL ++K L   AQ++AE + +   + HS K      GENL  +     + K +G  A  SWY EIKDY+F++   P  +  TGHFTQ++WK +KE G G A +   N  ++VG+Y PAGN    G + +NV  LP G K D+
Sbjct:    4 SFEAEFLQVHNAYRKQHGAPPLTFNKNLCRSAQQWAEHLLSTKTLAHSNK----GYGENLYYAWSS-ANKKLTGHEAVDSWYGEIKDYNFSR---PGFSSKTGHFTQVVWKDTKELGVGLATD--GNTIFVVGQYLPAGNIANAGYFEKNV--LPTGSKLDQ 153          

HSP 2 Score: 60.077 bits (144), Expect = 2.733e-10
Identity = 50/148 (33.78%), Postives = 75/148 (50.68%), Query Frame = 3
Query:  906 SFIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGNVTEE-SAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXESFIVCFYSPAGNTKNE--FSQNV 1340
            SF    +  HN YR+ H    L  +  L   AQ WA+ L     ++ SN  +     GEN+     +  ++ +    VDSWY E ++YN+ + P      GHFTQ++WK +K++GVG+  +     F+V  Y PAGN  N   F +NV
Sbjct:    4 SFEAEFLQVHNAYRKQHGAPPLTFNKNLCRSAQQWAEHLLSTKTLAHSNKGY-----GENLYYAWSSANKKLTGHEAVDSWYGEIKDYNFSR-PGFSSKTGHFTQVVWKDTKELGVGLATDGNT-IFVVGQYLPAGNIANAGYFEKNV 144          
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Match: echdc1 (ethylmalonyl-CoA decarboxylase 1 [Source:Xenbase;Acc:XB-GENE-958554])

HSP 1 Score: 114.005 bits (284), Expect = 1.998e-29
Identity = 63/145 (43.45%), Postives = 87/145 (60.00%), Query Frame = 3
Query:  114 ECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFVGKYLENV 548
            E L +HN  RK+HN PP+R + +LS  AQ +A  + + ++M+HS        GENL      +  Y   G  A  +WY+E+KDYD+NK   P    ATGHFTQ++WK SKE G G A +     +Y+VGRY P GN +G++ ENV
Sbjct:   10 EFLEAHNKYRKKHNVPPMRLNAELSKSAQTWANHLLSINKMQHS-----GAGGENL------YYSYSSRGNVAVDAWYNEVKDYDYNK---PGFKAATGHFTQVVWKDSKELGVGVATD-GKGTFYVVGRYSPPGNVIGQFQENV 139          

HSP 2 Score: 79.7221 bits (195), Expect = 3.017e-17
Identity = 60/146 (41.10%), Postives = 85/146 (58.22%), Query Frame = 3
Query:  903 KSFIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGNVTEESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXESFIVCFYSPAGNTKNEFSQNV 1340
            + F+EA    HN YR+ HNV  + L+ +L+  AQ WA+ L   NKM  S    EN+       + +GNV        VD+WYNE ++Y+Y K P    + GHFTQ++WK SK++GVGV  + KG  ++V  YSP GN   +F +NV
Sbjct:    9 QEFLEA----HNKYRKKHNVPPMRLNAELSKSAQTWANHLLSINKMQHSGAGGENLYYS---YSSRGNVA-------VDAWYNEVKDYDYNK-PGFKAATGHFTQVVWKDSKELGVGVATDGKGTFYVVGRYSPPGNVIGQFQENV 139          
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Match: trappc3 (trafficking protein particle complex 3 [Source:Xenbase;Acc:XB-GENE-1003911])

HSP 1 Score: 122.479 bits (306), Expect = 4.521e-29
Identity = 125/412 (30.34%), Postives = 182/412 (44.17%), Query Frame = 3
Query:  141 RKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASA-------SWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFV--GKYLENVPPLPRGQKWDKVPIIEEYLDELRTMEYTPARKHILDDWRANWMSGTKAGVSYCDVVEXXXXXXXXXXXGENHFSEDPRKLPRPIFQSQLDDSVYDLGDDQLNGYASDKDSDKGENEEIKSFIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTK-KGNVTEESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXESFIVCFYSPAGNTKNE--FSQNV 1340
            R++H APPL+ S+ L   AQ++A+ + +   +EHS      + GENL         YKYS +           +WY EIK+YDF +   P     TGHFTQ++WK SKE G G A +  +  +++VG+Y PAGN    G + +NV P       D          E  + ++ P                  AG  Y +                  F E PR    P   S     V  L           K +  G  E+     EA+ + + Y RR H    L L  +L   +Q WAD L   N +  S     N   GEN+  K   ++ + S   +V++WYNE ++Y++ + P    + GHFTQ++WK S+++GV    + KG    V  YSPAGN  N   F +NV
Sbjct:    2 RRKHGAPPLQLSRDLCRSAQQWADHLLSIRTLEHSG----GNTGENLY--------YKYSSVARELPGQEPVDAWYDEIKNYDFGR---PGFRSNTGHFTQVVWKDSKEVGVGVATD-GNGLYFVVGQYNPAGNITNPGYFEKNVLPAGSSPGPDSA--------ESGSSQWKP------------------AGGGYREPA--------------GGFVEPPRSFREPEKTSSNFKPVSGL----------TKQAGAGSFEQ-----EALDAHNKY-RRQHGAPQLQLSRELCDSSQKWADHLLSINALQHS-----NTANGENLWYKWNSSMRDASGAEVVETWYNEIKDYSFGR-PGFQSNTGHFTQVVWKDSREVGVAKAVDGKGMVIAVAQYSPAGNITNPGYFQKNV 335          

HSP 2 Score: 87.0409 bits (214), Expect = 1.549e-17
Identity = 60/165 (36.36%), Postives = 88/165 (53.33%), Query Frame = 3
Query:   87 MSELEDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENL-AMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFV--GKYLENVPPLPRGQK 572
             ++  +F  E L ++N  R  H A PL+ + ++S +AQR+AE +     ++HS        GEN+ A S  P +    +G   + SWY E K+Y+F+K   P     TGHFTQ++WK SKE G G A +       +V +Y P+GN    G Y  N+  LPRG K
Sbjct:  369 TADSREFALEFLKANNVYRSRHGAKPLQLNSKISQEAQRWAEHLLNLKTLKHSDTSH----GENIWAKSGGPSI--TVTGQEVADSWYKEEKNYNFSK---PGYQADTGHFTQMVWKASKEVGVGLASS-GKGMLIVVAQYNPSGNITNPGFYGRNI--LPRGSK 521          

HSP 3 Score: 86.6557 bits (213), Expect = 1.850e-17
Identity = 59/167 (35.33%), Postives = 88/167 (52.69%), Query Frame = 3
Query:   84 KMSELEDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENL----AMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFV--GKYLENVPPLPRG 566
            K +    F  E L +HN  R++H AP L+ S++L   +Q++A+ + + + ++HS   +    GENL      SMR       SG     +WY+EIKDY F +   P     TGHFTQ++WK S+E G  +A +        V +Y PAGN    G + +NV  LP+G
Sbjct:  188 KQAGAGSFEQEALDAHNKYRRQHGAPQLQLSRELCDSSQKWADHLLSINALQHSNTAN----GENLWYKWNSSMR-----DASGAEVVETWYNEIKDYSFGR---PGFQSNTGHFTQVVWKDSREVGVAKAVDGKGMV-IAVAQYSPAGNITNPGYFQKNV--LPKG 339          

HSP 4 Score: 77.0258 bits (188), Expect = 2.543e-14
Identity = 57/159 (35.85%), Postives = 79/159 (49.69%), Query Frame = 3
Query:   93 ELEDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFV--GKYLENVPPLPR 563
            EL+ F  + L  HN  RK H A  L+ S  LS DAQ++A+ +  K  +++S        GENL            +G   + SWY+E   Y F   A P     +G+FTQ+IWK S + GFG + +     +  VG Y PAGN    G + +NV  LPR
Sbjct:  548 ELKSFRKDLLSEHNQYRKLHGAGALQLSVALSQDAQKWADHLVGKRALQNSDTHH----GENLWYRWGTNTSLP-TGKEVAESWYNENAKYSF---ATPGFQSGSGNFTQMIWKSSSQVGFGLSTD-NKGMYIAVGFYDPAGNIANKGYFEDNV--LPR 695          

HSP 5 Score: 73.1738 bits (178), Expect = 3.950e-13
Identity = 55/152 (36.18%), Postives = 83/152 (54.61%), Query Frame = 3
Query:  894 EEIKSFIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKG-NVTEESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXESFIVCFYSPAGNTKNE--FSQNV 1340
            +E+KSF + ++S+HN YR+ H    L L   L+  AQ WAD L  +  +  S     +   GEN+  + G N +  + K + +SWYNE   Y++   P      G+FTQ++WK S ++G G+  ++KG    V FY PAGN  N+  F  NV
Sbjct:  547 KELKSFRKDLLSEHNQYRKLHGAGALQLSVALSQDAQKWADHLVGKRALQNS-----DTHHGENLWYRWGTNTSLPTGKEVAESWYNENAKYSF-ATPGFQSGSGNFTQMIWKSSSQVGFGLSTDNKGMYIAVGFYDPAGNIANKGYFEDNV 692          

HSP 6 Score: 68.1662 bits (165), Expect = 1.499e-11
Identity = 50/151 (33.11%), Postives = 78/151 (51.66%), Query Frame = 3
Query:  873 DSDKGENEEIKSFIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGNVT-EESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXESFIVCFYSPAGNTKN 1322
            DS      + + F    +  +N YR  H    L L+++++  AQ WA+ L     ++       +   GENI  K G  +   + + + DSWY E +NYN+ K P      GHFTQ++WK SK++GVG+  + KG   +V  Y+P+GN  N
Sbjct:  363 DSASSPTADSREFALEFLKANNVYRSRHGAKPLQLNSKISQEAQRWAEHL-----LNLKTLKHSDTSHGENIWAKSGGPSITVTGQEVADSWYKEEKNYNFSK-PGYQADTGHFTQMVWKASKEVGVGLASSGKGMLIVVAQYNPSGNITN 507          

HSP 7 Score: 65.0846 bits (157), Expect = 1.557e-10
Identity = 53/136 (38.97%), Postives = 72/136 (52.94%), Query Frame = 3
Query:  942 YRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGNVTEE-SAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXESFIVCFYSPAGNTKNE--FSQNV 1340
            YRR H    L L   L   AQ WAD L     +S           GEN+  K  +V  E   +  VD+WY+E +NY++ + P    + GHFTQ++WK SK++GVGV  +  G  F+V  Y+PAGN  N   F +NV
Sbjct:    1 YRRKHGAPPLQLSRDLCRSAQQWADHL-----LSIRTLEHSGGNTGENLYYKYSSVARELPGQEPVDAWYDEIKNYDFGR-PGFRSNTGHFTQVVWKDSKEVGVGVATDGNGLYFVVGQYNPAGNITNPGYFEKNV 130          
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Match: trappc3 (trafficking protein particle complex 3 [Source:Xenbase;Acc:XB-GENE-1003911])

HSP 1 Score: 96.6709 bits (239), Expect = 1.385e-20
Identity = 62/167 (37.13%), Postives = 90/167 (53.89%), Query Frame = 3
Query:   81 LKMSELEDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASA-------SWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFV--GKYLENVPP 554
            L  +E   F  + L +HN  R++H APPL+ S+ L   AQ++A+ + +   +EHS      + GENL         YKYS +           +WY EIK+YDF +   P     TGHFTQ++WK SKE G G A +  +  +++VG+Y PAGN    G + +NV P
Sbjct:   10 LLCAEKSPFEQDFLAAHNTYRRKHGAPPLQLSRDLCRSAQQWADHLLSIRTLEHSG----GNTGENLY--------YKYSSVARELPGQEPVDAWYDEIKNYDFGR---PGFRSNTGHFTQVVWKDSKEVGVGVATD-GNGLYFVVGQYNPAGNITNPGYFEKNVLP 160          

HSP 2 Score: 87.0409 bits (214), Expect = 1.611e-17
Identity = 60/165 (36.36%), Postives = 88/165 (53.33%), Query Frame = 3
Query:   87 MSELEDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENL-AMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFV--GKYLENVPPLPRGQK 572
             ++  +F  E L ++N  R  H A PL+ + ++S +AQR+AE +     ++HS        GEN+ A S  P +    +G   + SWY E K+Y+F+K   P     TGHFTQ++WK SKE G G A +       +V +Y P+GN    G Y  N+  LPRG K
Sbjct:  380 TADSREFALEFLKANNVYRSRHGAKPLQLNSKISQEAQRWAEHLLNLKTLKHSDTSH----GENIWAKSGGPSI--TVTGQEVADSWYKEEKNYNFSK---PGYQADTGHFTQMVWKASKEVGVGLASS-GKGMLIVVAQYNPSGNITNPGFYGRNI--LPRGSK 532          

HSP 3 Score: 86.6557 bits (213), Expect = 2.066e-17
Identity = 59/167 (35.33%), Postives = 88/167 (52.69%), Query Frame = 3
Query:   84 KMSELEDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENL----AMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFV--GKYLENVPPLPRG 566
            K +    F  E L +HN  R++H AP L+ S++L   +Q++A+ + + + ++HS   +    GENL      SMR       SG     +WY+EIKDY F +   P     TGHFTQ++WK S+E G  +A +        V +Y PAGN    G + +NV  LP+G
Sbjct:  199 KQAGAGSFEQEALDAHNKYRRQHGAPQLQLSRELCDSSQKWADHLLSINALQHSNTAN----GENLWYKWNSSMR-----DASGAEVVETWYNEIKDYSFGR---PGFQSNTGHFTQVVWKDSREVGVAKAVDGKGMV-IAVAQYSPAGNITNPGYFQKNV--LPKG 350          

HSP 4 Score: 76.6406 bits (187), Expect = 2.933e-14
Identity = 57/159 (35.85%), Postives = 79/159 (49.69%), Query Frame = 3
Query:   93 ELEDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFV--GKYLENVPPLPR 563
            EL+ F  + L  HN  RK H A  L+ S  LS DAQ++A+ +  K  +++S        GENL            +G   + SWY+E   Y F   A P     +G+FTQ+IWK S + GFG + +     +  VG Y PAGN    G + +NV  LPR
Sbjct:  559 ELKSFRKDLLSEHNQYRKLHGAGALQLSVALSQDAQKWADHLVGKRALQNSDTHH----GENLWYRWGTNTSLP-TGKEVAESWYNENAKYSF---ATPGFQSGSGNFTQMIWKSSSQVGFGLSTD-NKGMYIAVGFYDPAGNIANKGYFEDNV--LPR 706          

HSP 5 Score: 72.7886 bits (177), Expect = 5.012e-13
Identity = 55/152 (36.18%), Postives = 83/152 (54.61%), Query Frame = 3
Query:  894 EEIKSFIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKG-NVTEESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXESFIVCFYSPAGNTKNE--FSQNV 1340
            +E+KSF + ++S+HN YR+ H    L L   L+  AQ WAD L  +  +  S     +   GEN+  + G N +  + K + +SWYNE   Y++   P      G+FTQ++WK S ++G G+  ++KG    V FY PAGN  N+  F  NV
Sbjct:  558 KELKSFRKDLLSEHNQYRKLHGAGALQLSVALSQDAQKWADHLVGKRALQNS-----DTHHGENLWYRWGTNTSLPTGKEVAESWYNENAKYSF-ATPGFQSGSGNFTQMIWKSSSQVGFGLSTDNKGMYIAVGFYDPAGNIANKGYFEDNV 703          

HSP 6 Score: 72.0182 bits (175), Expect = 9.761e-13
Identity = 54/148 (36.49%), Postives = 79/148 (53.38%), Query Frame = 3
Query:  906 SFIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTK-KGNVTEESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXESFIVCFYSPAGNTKNE--FSQNV 1340
            SF +  +  HN YRR H    L L  +L   +Q WAD L   N +  S     N   GEN+  K   ++ + S   +V++WYNE ++Y++ + P    + GHFTQ++WK S+++GV    + KG    V  YSPAGN  N   F +NV
Sbjct:  205 SFEQEALDAHNKYRRQHGAPQLQLSRELCDSSQKWADHLLSINALQHS-----NTANGENLWYKWNSSMRDASGAEVVETWYNEIKDYSFGR-PGFQSNTGHFTQVVWKDSREVGVAKAVDGKGMVIAVAQYSPAGNITNPGYFQKNV 346          

HSP 7 Score: 71.2478 bits (173), Expect = 1.917e-12
Identity = 57/151 (37.75%), Postives = 79/151 (52.32%), Query Frame = 3
Query:  897 EIKSFIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGNVTEE-SAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXESFIVCFYSPAGNTKNE--FSQNV 1340
            E   F +  ++ HN YRR H    L L   L   AQ WAD L     +S           GEN+  K  +V  E   +  VD+WY+E +NY++ + P    + GHFTQ++WK SK++GVGV  +  G  F+V  Y+PAGN  N   F +NV
Sbjct:   14 EKSPFEQDFLAAHNTYRRKHGAPPLQLSRDLCRSAQQWADHL-----LSIRTLEHSGGNTGENLYYKYSSVARELPGQEPVDAWYDEIKNYDFGR-PGFRSNTGHFTQVVWKDSKEVGVGVATDGNGLYFVVGQYNPAGNITNPGYFEKNV 158          

HSP 8 Score: 68.1662 bits (165), Expect = 1.724e-11
Identity = 50/151 (33.11%), Postives = 78/151 (51.66%), Query Frame = 3
Query:  873 DSDKGENEEIKSFIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGNVT-EESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXESFIVCFYSPAGNTKN 1322
            DS      + + F    +  +N YR  H    L L+++++  AQ WA+ L     ++       +   GENI  K G  +   + + + DSWY E +NYN+ K P      GHFTQ++WK SK++GVG+  + KG   +V  Y+P+GN  N
Sbjct:  374 DSASSPTADSREFALEFLKANNVYRSRHGAKPLQLNSKISQEAQRWAEHL-----LNLKTLKHSDTSHGENIWAKSGGPSITVTGQEVADSWYKEEKNYNFSK-PGYQADTGHFTQMVWKASKEVGVGLASSGKGMLIVVAQYNPSGNITN 518          
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Match: ENSXETT00000021732.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:5:144837652:144848955:1 gene:ENSXETG00000011357.1 transcript:ENSXETT00000021732.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.2174 bits (121), Expect = 8.612e-7
Identity = 36/115 (31.30%), Postives = 52/115 (45.22%), Query Frame = 3
Query:  192 DAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNC-WYIVGRYQPAGNFVGK 533
            +A + AE+ A      H+        G+NL M+      Y  +   A  +W+ EIKD+DF K  +       GH+TQ  W  S+  G    + P +   +Y V  Y PAGN  GK
Sbjct:   49 EAAKKAEIWARTCNQFHNPASQHFSCGQNLFMA-----SYSTTWEAAVTAWFDEIKDFDFGKGPK-TFGALIGHYTQGAWYNSRMVGCYEFECPNAEYRYYYVCHYCPAGNIEGK 157          
BLAST of Venom allergen 5 vs. Ensembl Mouse
Match: Glipr2 (GLI pathogenesis-related 2 [Source:MGI Symbol;Acc:MGI:1917770])

HSP 1 Score: 117.857 bits (294), Expect = 6.181e-31
Identity = 64/160 (40.00%), Postives = 93/160 (58.13%), Query Frame = 3
Query:   81 LKMSELEDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFV--GKYLENVPP 554
            +  S  + FN E L +HN  R +H  PPL+  K+L+ +AQ+Y+E +A+   ++HS +  R   GENLA     +  Y  +G   +  WYSEIK Y+F    QP     TGHFT ++WK +K+ G G+A + +    ++V RY PAGN V  G + ENVPP
Sbjct:    1 MGKSASKQFNNEVLKAHNEYRAQHGVPPLKLCKKLNREAQQYSEALASTRILKHSPESSRGQCGENLA-----WASYDQTGKDVADRWYSEIKSYNFQ---QPGFTSGTGHFTAMVWKNTKKIGVGKA-SASDGSSFVVARYFPAGNIVNQGFFEENVPP 151          

HSP 2 Score: 69.3218 bits (168), Expect = 1.491e-13
Identity = 56/154 (36.36%), Postives = 81/154 (52.60%), Query Frame = 3
Query:  903 KSFIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVP------LGENITTKKGNVTEESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXESFIVCFYSPAGNTKNE--FSQNV 1340
            K F   V+  HN YR  H V  L L  +LN  AQ +++ LA       S  + ++ P       GEN+        +++ K + D WY+E ++YN++ +P      GHFT ++WK +KKIGVG    S G SF+V  Y PAGN  N+  F +NV
Sbjct:    7 KQFNNEVLKAHNEYRAQHGVPPLKLCKKLNREAQQYSEALA-------STRILKHSPESSRGQCGENLAWAS---YDQTGKDVADRWYSEIKSYNFQ-QPGFTSGTGHFTAMVWKNTKKIGVGKASASDGSSFVVARYFPAGNIVNQGFFEENV 149          
BLAST of Venom allergen 5 vs. Ensembl Mouse
Match: Glipr2 (GLI pathogenesis-related 2 [Source:MGI Symbol;Acc:MGI:1917770])

HSP 1 Score: 67.3958 bits (163), Expect = 1.265e-13
Identity = 37/81 (45.68%), Postives = 49/81 (60.49%), Query Frame = 3
Query:  318 SGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFV--GKYLENVPP 554
            SG   +  WYSEIK Y+F    QP     TGHFT ++WK +K+ G G+A + +    ++V RY PAGN V  G + ENVPP
Sbjct:    4 SGKDVADRWYSEIKSYNFQ---QPGFTSGTGHFTAMVWKNTKKIGVGKA-SASDGSSFVVARYFPAGNIVNQGFFEENVPP 80          

HSP 2 Score: 49.6766 bits (117), Expect = 1.868e-7
Identity = 35/77 (45.45%), Postives = 49/77 (63.64%), Query Frame = 3
Query: 1116 ESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXESFIVCFYSPAGNTKNE--FSQNV 1340
            +S K + D WY+E ++YN++ +P      GHFT ++WK +KKIGVG    S G SF+V  Y PAGN  N+  F +NV
Sbjct:    3 KSGKDVADRWYSEIKSYNFQ-QPGFTSGTGHFTAMVWKNTKKIGVGKASASDGSSFVVARYFPAGNIVNQGFFEENV 78          
BLAST of Venom allergen 5 vs. Ensembl Mouse
Match: Crisp2 (cysteine-rich secretory protein 2 [Source:MGI Symbol;Acc:MGI:98815])

HSP 1 Score: 67.3958 bits (163), Expect = 3.650e-12
Identity = 53/150 (35.33%), Postives = 78/150 (52.00%), Query Frame = 3
Query:  114 ECLHSHNGLRKEHNAP-----PLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRN---DAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNC--WYIVGRYQPAGNFVGK 533
            E ++ HN LR+  N        + +S Q + +AQ++A     K  +EHS K+DR      GENL MS  P +   +S +    SWY+E +D+ +   A+P  N A GH+TQL+W  S + G G A  P  +   ++ V  Y P GN V K
Sbjct:   40 EIVNKHNELRRSVNPTGSDILKMEWSIQATTNAQKWAN----KCILEHSSKDDRKINIRCGENLYMSTDPTL---WSTV--IQSWYNENEDFVYGVGAKP--NSAVGHYTQLVWYSSFKIGCGIAYCPNQDNLKYFYVCHYCPMGNNVMK 178          

HSP 2 Score: 50.447 bits (119), Expect = 1.389e-6
Identity = 43/139 (30.94%), Postives = 66/139 (47.48%), Query Frame = 3
Query:  921 VVSQHNYYRRNHN-----VATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGNVTEESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXES---FIVCFYSPAGN 1313
            +V++HN  RR+ N     +  +    Q  T AQ WA++  LE+       +  N+  GEN+          +   ++ SWYNE  ++ Y        +VGH+TQL+W  S KIG G+      ++   F VC Y P GN
Sbjct:   41 IVNKHNELRRSVNPTGSDILKMEWSIQATTNAQKWANKCILEHSSKDDRKI--NIRCGENLYMSTDPTLWST---VIQSWYNENEDFVYGVGAKPNSAVGHYTQLVWYSSFKIGCGIAYCPNQDNLKYFYVCHYCPMGN 174          
BLAST of Venom allergen 5 vs. Ensembl Mouse
Match: Crisp2 (cysteine-rich secretory protein 2 [Source:MGI Symbol;Acc:MGI:98815])

HSP 1 Score: 67.3958 bits (163), Expect = 3.650e-12
Identity = 53/150 (35.33%), Postives = 78/150 (52.00%), Query Frame = 3
Query:  114 ECLHSHNGLRKEHNAP-----PLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRN---DAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNC--WYIVGRYQPAGNFVGK 533
            E ++ HN LR+  N        + +S Q + +AQ++A     K  +EHS K+DR      GENL MS  P +   +S +    SWY+E +D+ +   A+P  N A GH+TQL+W  S + G G A  P  +   ++ V  Y P GN V K
Sbjct:   40 EIVNKHNELRRSVNPTGSDILKMEWSIQATTNAQKWAN----KCILEHSSKDDRKINIRCGENLYMSTDPTL---WSTV--IQSWYNENEDFVYGVGAKP--NSAVGHYTQLVWYSSFKIGCGIAYCPNQDNLKYFYVCHYCPMGNNVMK 178          

HSP 2 Score: 50.447 bits (119), Expect = 1.389e-6
Identity = 43/139 (30.94%), Postives = 66/139 (47.48%), Query Frame = 3
Query:  921 VVSQHNYYRRNHN-----VATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGNVTEESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXES---FIVCFYSPAGN 1313
            +V++HN  RR+ N     +  +    Q  T AQ WA++  LE+       +  N+  GEN+          +   ++ SWYNE  ++ Y        +VGH+TQL+W  S KIG G+      ++   F VC Y P GN
Sbjct:   41 IVNKHNELRRSVNPTGSDILKMEWSIQATTNAQKWANKCILEHSSKDDRKI--NIRCGENLYMSTDPTLWST---VIQSWYNENEDFVYGVGAKPNSAVGHYTQLVWYSSFKIGCGIAYCPNQDNLKYFYVCHYCPMGN 174          
BLAST of Venom allergen 5 vs. Ensembl Mouse
Match: Crisp2 (cysteine-rich secretory protein 2 [Source:MGI Symbol;Acc:MGI:98815])

HSP 1 Score: 67.3958 bits (163), Expect = 3.650e-12
Identity = 53/150 (35.33%), Postives = 78/150 (52.00%), Query Frame = 3
Query:  114 ECLHSHNGLRKEHNAP-----PLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRN---DAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNC--WYIVGRYQPAGNFVGK 533
            E ++ HN LR+  N        + +S Q + +AQ++A     K  +EHS K+DR      GENL MS  P +   +S +    SWY+E +D+ +   A+P  N A GH+TQL+W  S + G G A  P  +   ++ V  Y P GN V K
Sbjct:   40 EIVNKHNELRRSVNPTGSDILKMEWSIQATTNAQKWAN----KCILEHSSKDDRKINIRCGENLYMSTDPTL---WSTV--IQSWYNENEDFVYGVGAKP--NSAVGHYTQLVWYSSFKIGCGIAYCPNQDNLKYFYVCHYCPMGNNVMK 178          

HSP 2 Score: 50.447 bits (119), Expect = 1.389e-6
Identity = 43/139 (30.94%), Postives = 66/139 (47.48%), Query Frame = 3
Query:  921 VVSQHNYYRRNHN-----VATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGNVTEESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXES---FIVCFYSPAGN 1313
            +V++HN  RR+ N     +  +    Q  T AQ WA++  LE+       +  N+  GEN+          +   ++ SWYNE  ++ Y        +VGH+TQL+W  S KIG G+      ++   F VC Y P GN
Sbjct:   41 IVNKHNELRRSVNPTGSDILKMEWSIQATTNAQKWANKCILEHSSKDDRKI--NIRCGENLYMSTDPTLWST---VIQSWYNENEDFVYGVGAKPNSAVGHYTQLVWYSSFKIGCGIAYCPNQDNLKYFYVCHYCPMGN 174          
BLAST of Venom allergen 5 vs. UniProt/SwissProt
Match: sp|Q9CYL5|GAPR1_MOUSE (Golgi-associated plant pathogenesis-related protein 1 OS=Mus musculus OX=10090 GN=Glipr2 PE=1 SV=3)

HSP 1 Score: 117.857 bits (294), Expect = 4.323e-30
Identity = 64/160 (40.00%), Postives = 93/160 (58.13%), Query Frame = 3
Query:   81 LKMSELEDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFV--GKYLENVPP 554
            +  S  + FN E L +HN  R +H  PPL+  K+L+ +AQ+Y+E +A+   ++HS +  R   GENLA     +  Y  +G   +  WYSEIK Y+F    QP     TGHFT ++WK +K+ G G+A + +    ++V RY PAGN V  G + ENVPP
Sbjct:    1 MGKSASKQFNNEVLKAHNEYRAQHGVPPLKLCKKLNREAQQYSEALASTRILKHSPESSRGQCGENLA-----WASYDQTGKDVADRWYSEIKSYNFQ---QPGFTSGTGHFTAMVWKNTKKIGVGKA-SASDGSSFVVARYFPAGNIVNQGFFEENVPP 151          

HSP 2 Score: 69.3218 bits (168), Expect = 1.043e-12
Identity = 56/154 (36.36%), Postives = 81/154 (52.60%), Query Frame = 3
Query:  903 KSFIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVP------LGENITTKKGNVTEESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXESFIVCFYSPAGNTKNE--FSQNV 1340
            K F   V+  HN YR  H V  L L  +LN  AQ +++ LA       S  + ++ P       GEN+        +++ K + D WY+E ++YN++ +P      GHFT ++WK +KKIGVG    S G SF+V  Y PAGN  N+  F +NV
Sbjct:    7 KQFNNEVLKAHNEYRAQHGVPPLKLCKKLNREAQQYSEALA-------STRILKHSPESSRGQCGENLAWAS---YDQTGKDVADRWYSEIKSYNFQ-QPGFTSGTGHFTAMVWKNTKKIGVGKASASDGSSFVVARYFPAGNIVNQGFFEENV 149          
BLAST of Venom allergen 5 vs. UniProt/SwissProt
Match: sp|Q9H4G4|GAPR1_HUMAN (Golgi-associated plant pathogenesis-related protein 1 OS=Homo sapiens OX=9606 GN=GLIPR2 PE=1 SV=3)

HSP 1 Score: 111.694 bits (278), Expect = 9.407e-28
Identity = 62/160 (38.75%), Postives = 93/160 (58.13%), Query Frame = 3
Query:   81 LKMSELEDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFV--GKYLENVPP 554
            +  S  + F+ E L +HN  R++H  PPL+  K L+ +AQ+Y+E +A+   ++HS +  R   GENLA     +  Y  +G   +  WYSEIK+Y+F    QP     TGHFT ++WK +K+ G G+A + +    ++V RY PAGN V  G + ENV P
Sbjct:    1 MGKSASKQFHNEVLKAHNEYRQKHGVPPLKLCKNLNREAQQYSEALASTRILKHSPESSRGQCGENLA-----WASYDQTGKEVADRWYSEIKNYNFQ---QPGFTSGTGHFTAMVWKNTKKMGVGKA-SASDGSSFVVARYFPAGNVVNEGFFEENVLP 151          

HSP 2 Score: 72.7886 bits (177), Expect = 6.153e-14
Identity = 57/154 (37.01%), Postives = 81/154 (52.60%), Query Frame = 3
Query:  903 KSFIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVP------LGENITTKKGNVTEESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXESFIVCFYSPAGNTKNE--FSQNV 1340
            K F   V+  HN YR+ H V  L L   LN  AQ +++ LA       S  + ++ P       GEN+        +++ K + D WY+E +NYN++ +P      GHFT ++WK +KK+GVG    S G SF+V  Y PAGN  NE  F +NV
Sbjct:    7 KQFHNEVLKAHNEYRQKHGVPPLKLCKNLNREAQQYSEALA-------STRILKHSPESSRGQCGENLAWAS---YDQTGKEVADRWYSEIKNYNFQ-QPGFTSGTGHFTAMVWKNTKKMGVGKASASDGSSFVVARYFPAGNVVNEGFFEENV 149          
BLAST of Venom allergen 5 vs. UniProt/SwissProt
Match: sp|P47033|PRY3_YEAST (Cell wall protein PRY3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRY3 PE=1 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 3.751e-16
Identity = 58/170 (34.12%), Postives = 85/170 (50.00%), Query Frame = 3
Query:   60 FLEFLIGLKM-SELEDFNYECLHSHNGLRKEH-NAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCW--YIVGRYQPAGNFVGKYLENVPPL 557
             L  L+ +K  +   +F  + L+ HN  R  H +  PL +S  L+  AQ YA+       + HS        GENLA+         Y+  GA  +WY EI  Y++   + P  + +TGHFTQ++WK + E G G     T+  W  YIV  Y P GN++G++ E V PL
Sbjct:    9 LLGCLVAVKAQTTFPNFESDVLNEHNKFRALHVDTAPLTWSDTLATYAQNYADQYDCSGVLTHSD----GPYGENLAL--------GYTDTGAVDAWYGEISKYNY---SNPGFSESTGHFTQVVWKSTAEIGCGYKYCGTT--WNNYIVCSYNPPGNYLGEFAEEVEPL 161          

HSP 2 Score: 61.6178 bits (148), Expect = 1.139e-8
Identity = 51/145 (35.17%), Postives = 75/145 (51.72%), Query Frame = 3
Query:  921 VVSQHNYYRRNH-NVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENIT---TKKGNVTEESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXX-ESFIVCFYSPAGNTKNEFSQNV 1340
            V+++HN +R  H + A L   + L TYAQ++AD+      ++ S+      P GEN+    T  G          VD+WY E   YNY   P   +S GHFTQ++WK + +IG G         ++IVC Y+P GN   EF++ V
Sbjct:   29 VLNEHNKFRALHVDTAPLTWSDTLATYAQNYADQYDCSGVLTHSDG-----PYGENLALGYTDTG---------AVDAWYGEISKYNYSN-PGFSESTGHFTQVVWKSTAEIGCGYKYCGTTWNNYIVCSYNPPGNYLGEFAEEV 158          
BLAST of Venom allergen 5 vs. UniProt/SwissProt
Match: sp|P36110|PRY2_YEAST (Protein PRY2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRY2 PE=1 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 2.566e-15
Identity = 53/159 (33.33%), Postives = 79/159 (49.69%), Query Frame = 3
Query:  102 DFNYECLHSHNGLRKEH-NAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNC---W--YIVGRYQPAGNFVGKYLENVPPLP 560
            DF+   ++ HN  R  H +   L +S  L+  AQ YA+       + HS        GENLA+         Y   G+  +WY+EI  YD++    P  + + GHFTQ++WKG+ E G G       +C   W  YI+  Y+ AGN +G++ +NV PL 
Sbjct:  191 DFSTSMVNEHNTKRALHKDTGSLTWSDTLATYAQNYADSYDCSGNLVHSG----GPYGENLALG--------YGTTGSVDAWYNEITSYDYSN---PGFSESAGHFTQVVWKGTSEVGCGL-----KSCGGEWGDYIICSYKAAGNVIGEFADNVMPLA 329          

HSP 2 Score: 66.6254 bits (161), Expect = 9.134e-11
Identity = 49/146 (33.56%), Postives = 73/146 (50.00%), Query Frame = 3
Query:  909 FIEAVVSQHNYYRRNH-NVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGNVTEESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXX-ESFIVCFYSPAGNTKNEFSQNV 1340
            F  ++V++HN  R  H +  +L   + L TYAQ++AD           N +    P GEN+    G          VD+WYNE  +Y+Y   P   +S GHFTQ++WK + ++G G+         +I+C Y  AGN   EF+ NV
Sbjct:  192 FSTSMVNEHNTKRALHKDTGSLTWSDTLATYAQNYADSYDCSG-----NLVHSGGPYGENLALGYGT------TGSVDAWYNEITSYDYSN-PGFSESAGHFTQVVWKGTSEVGCGLKSCGGEWGDYIICSYKAAGNVIGEFADNV 325          
BLAST of Venom allergen 5 vs. UniProt/SwissProt
Match: sp|P47032|PRY1_YEAST (Protein PRY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRY1 PE=1 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 3.228e-15
Identity = 54/149 (36.24%), Postives = 73/149 (48.99%), Query Frame = 3
Query:  120 LHSHNGLRKEH-NAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCW--YIVGRYQPAGNFVGKYLENVPPL 557
            L  HN  R  H + P L +S  L+  AQ YA+       + HS        GENLA+         Y G  A  +WY+EI +YDF+      N   TGHFTQ++WK + + G G         W  Y++  Y PAGN+ G+Y +NV PL
Sbjct:  167 LAEHNKKRALHKDTPALSWSDTLASYAQDYADNYDCSGTLTHSG----GPYGENLALG--------YDGPAAVDAWYNEISNYDFSNPGFSSN---TGHFTQVVWKSTTQVGCGI--KTCGGAWGDYVICSYDPAGNYEGEYADNVEPL 298          

HSP 2 Score: 64.6994 bits (156), Expect = 3.267e-10
Identity = 46/142 (32.39%), Postives = 73/142 (51.41%), Query Frame = 3
Query:  921 VVSQHNYYRRNH-NVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGNVTEESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXX-ESFIVCFYSPAGNTKNEFSQNV 1340
            V+++HN  R  H +   L+  + L +YAQD+AD       ++ S       P GEN+             A VD+WYNE  NY++   P    + GHFTQ++WK + ++G G+         +++C Y PAGN + E++ NV
Sbjct:  166 VLAEHNKKRALHKDTPALSWSDTLASYAQDYADNYDCSGTLTHSG-----GPYGENLALGY------DGPAAVDAWYNEISNYDFSN-PGFSSNTGHFTQVVWKSTTQVGCGIKTCGGAWGDYVICSYDPAGNYEGEYADNV 295          
BLAST of Venom allergen 5 vs. TrEMBL
Match: A0A1S8X1T7 (SCP-like protein OS=Opisthorchis viverrini OX=6198 GN=X801_03479 PE=4 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 1.261e-52
Identity = 134/428 (31.31%), Postives = 206/428 (48.13%), Query Frame = 3
Query:   87 MSELEDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFVGKYLENVPPLPRGQKWDKVPIIEEYLDELRTMEYTPARKHILDDWRANWMSGTKAGVSYCDVVEXXXXXXXXXXXGENHFSEDPRKLPRPIFQSQLDDSVYDLGDDQLNGYASDKDSDKGENEEIKSFIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGNVTEE-SAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXX---------XXXESFIVCFYSPAGNTKNEFSQNV 1340
            M  ++DF  ECL  HN  R+ H AP L++S+ L   AQ +AE + ++  +++S    R + GE+++M           G      WY++IK+Y+F +   P      G+FTQL+WK ++E GFG+A+  +S    +V  Y+P GN  G Y ENV   P G +   V    +      T +  P  K  +         G +  V + +V+ET           + H     R+     FQ   D +            A DK     E    ++F +AV   HN YR+ H  A L LD +++  AQDWA++L     +S S + ++ V LGEN+  +  N T   SA+ +VD WY E   YN+  EP + + +G FTQ++W  S++IGVG+            S+ +  +VCFY P GN   +F  NV
Sbjct:    1 MPNMDDFIEECLREHNAKRELHGAPALKHSRALDKTAQDWAEALISEPAIKNSPLSSRGEVGESISMRTSSASHVDIQGNEVVNQWYADIKNYNFTEGKGP-----AGNFTQLVWKATREVGFGKAR--SSGKCIVVAHYRPPGNVRGHYAENVG-APTGGEAASVASATD------TAKLDPDAKRTVVTEEVTSPEGKRYTV-HREVIETTEP--------DGHV----RRCVNETFQDSPDQAT-----------AGDKHGAGSEAAHEENFADAVTRAHNVYRKRHGAADLQLDPEISHMAQDWAEQLVNRAHLSNSGFTYQGVRLGENVLCRWSNTTATVSAQDVVDHWYQESSKYNFNSEPKSIQGIGGFTQMVWSGSQRIGVGIASQPKKDFYNQPSQSKVIVVCFYYPPGNVTGQFRANV 390          

HSP 2 Score: 62.7734 bits (151), Expect = 8.067e-7
Identity = 49/175 (28.00%), Postives = 76/175 (43.43%), Query Frame = 3
Query:   78 GLKMSELEDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRN-DAGENL---------AMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCW--------YIVGRYQPAGNFVGKYLENV 548
            G + +  E+F      +HN  RK H A  L+   ++S  AQ +AE +  +  + +S    +    GEN+          +S +  VD+          WY E   Y+FN E  P +    G FTQ++W GS+  G G A  P  + +         +V  Y P GN  G++  NV
Sbjct:  228 GSEAAHEENFADAVTRAHNVYRKRHGAADLQLDPEISHMAQDWAEQLVNRAHLSNSGFTYQGVRLGENVLCRWSNTTATVSAQDVVDH----------WYQESSKYNFNSE--PKSIQGIGGFTQMVWSGSQRIGVGIASQPKKDFYNQPSQSKVIVVCFYYPPGNVTGQFRANV 390          
BLAST of Venom allergen 5 vs. TrEMBL
Match: A0A2H1C4H4 (Golgi-associated plant pathogenesis protein 1 OS=Fasciola hepatica OX=6192 GN=D915_007597 PE=4 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 1.452e-51
Identity = 132/434 (30.41%), Postives = 200/434 (46.08%), Query Frame = 3
Query:   87 MSELEDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFVGKYLENVPP----LPRGQKWDKVPIIEEYLDELRTMEYTPARKHILDDWRANWMSGTKAGVSYCDVVEXXXXXXXXXXXGENHFSEDPRKLPRPIFQSQLDDSVYDLGDDQLNGYASDKDSDKGENEEIKSFIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTK-KGNVTEESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXX-----------ESFIVCFYSPAGNTKNEFSQNV 1340
            M+ ++DF  ECL  HN  R  HNAP LR+S+ L   AQ +AE + +++++++S    R + GE+++M           G      WY+++K+Y+F  E  P      G+FTQL+W  ++E GFG+A+ P   C  +V  Y+P GN  G Y ENV P    LP G                 ++++ P  K  +         G+K  V   +VVE                S  P    + +      ++   +  +   G  +         ++++SF EAV   HN +R  H    L  D QL+  AQ WA+EL    ++S S Y FE V LGEN+ ++         A+ LVD WY E   Y +  EP + + +G FTQ++W  S++IGVG     K            +   VCFY P GN   +F  NV
Sbjct:    1 MAGMDDFIEECLREHNAKRSLHNAPALRHSRALDKTAQDWAEQLISEEQIKNSSLSGRGEVGESISMRTSTASHVDIQGTEVVNQWYADMKNYNFESEKGP-----AGNFTQLVWSATREVGFGKARAP-GKC-IVVAHYRPPGNVRGHYAENVHPPTGGLPSGGGHSPT----------GSVQHAPGTKKTVVTENVTDPDGSKYTVRR-EVVE----------------SVGPDGRVKRVTSESFAEASDTITTESSTGPEAGGLVTGNSKKDLESFGEAVTQVHNTHRARHGAPALKYDPQLSELAQKWAEELVQMPRLSNSGYTFEGVRLGENVLSRWSTAAVHFGAQDLVDHWYQECSKYKFDTEPSSIQGIGGFTQVVWSGSQRIGVGRAMQPKSGPGGSTSGPGYKMVAVCFYYPPGNVTGQFKTNV 400          

HSP 2 Score: 73.1738 bits (178), Expect = 3.925e-10
Identity = 54/176 (30.68%), Postives = 73/176 (41.48%), Query Frame = 3
Query:   69 FLIGLKMSELEDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKE-DRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNC----------WYIVGRYQPAGNFVGKYLENVPPLPR 563
             + G    +LE F       HN  R  H AP L+Y  QLS  AQ++AE +     + +S    +    GEN+ +S        +        WY E   Y F+ E  P +    G FTQ++W GS+  G GRA  P S               V  Y P GN  G++  NV P  R
Sbjct:  233 LVTGNSKKDLESFGEAVTQVHNTHRARHGAPALKYDPQLSELAQKWAEELVQMPRLSNSGYTFEGVRLGENV-LSRWSTAAVHFGAQDLVDHWYQECSKYKFDTE--PSSIQGIGGFTQVVWSGSQRIGVGRAMQPKSGPGGSTSGPGYKMVAVCFYYPPGNVTGQFKTNVKPSSR 405          
BLAST of Venom allergen 5 vs. TrEMBL
Match: A0A504Z204 (Golgi-associated plant pathogenesis protein 1 OS=Fasciola gigantica OX=46835 GN=FGIG_10604 PE=4 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 3.760e-51
Identity = 131/434 (30.18%), Postives = 203/434 (46.77%), Query Frame = 3
Query:   87 MSELEDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFVGKYLENVPP----LPRGQKWDKVPIIEEYLDELRTMEYTPARKHILDDWRANWMSGTKAGVSYCDVVEXXXXXXXXXXXGENHFSEDPRKLPRPIFQSQLDDSVYDLGDDQLNGYASDKDSDKGENEEIKSFIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTK-KGNVTEESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXX-----------ESFIVCFYSPAGNTKNEFSQNV 1340
            M+ ++DF  ECL  HN  R  HNAP LR+S+ L   AQ +AE + +++++++S    R + GE+++M           G      WY+++K+Y+F  E  P      G+FTQL+W  ++E GFG+A+ P   C  +V  Y+P GN  G Y ENV P    LP G        +++     +T+      +++ D        G+K  V   +VVE                S  P    + +      ++   +  +   G  +         ++++SF EAV   HN +R  H    L  D QL+  AQ WA+EL    ++S S Y FE + LGEN+ ++         A+ LVD WY E   Y +  EP + + +G FTQ++W  S++IGVG     K            +   VCFY P GN   +F  NV
Sbjct:    1 MAGMDDFIEECLREHNAKRSLHNAPALRHSRALDKTAQDWAEQLISEEQIKNSSLSGRGEVGESISMRTSTASHVDIQGTEVVNQWYADMKNYNFESEKGP-----AGNFTQLVWSATREVGFGKARAP-GKC-IVVAHYRPPGNVRGHYAENVHPPTGGLPSGGGHSPTGSVQQAPGTRKTV----VTENVTDP------DGSKYTVRR-EVVE----------------SVGPDGRVKRVTSESFAEASDTITTESSTGPEAGGLVTGNSKKDLESFGEAVTQVHNTHRARHGAPALKYDPQLSELAQKWAEELVQMPRLSNSGYTFEGIRLGENVLSRWSTAAVHFGAQDLVDHWYQECSKYKFDTEPSSIQGIGGFTQVVWSGSQRIGVGRAMQPKSGPGGSTSGPGYKMVAVCFYYPPGNVTGQFKTNV 400          

HSP 2 Score: 72.7886 bits (177), Expect = 4.142e-10
Identity = 54/176 (30.68%), Postives = 73/176 (41.48%), Query Frame = 3
Query:   69 FLIGLKMSELEDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKE-DRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNC----------WYIVGRYQPAGNFVGKYLENVPPLPR 563
             + G    +LE F       HN  R  H AP L+Y  QLS  AQ++AE +     + +S    +    GEN+ +S        +        WY E   Y F+ E  P +    G FTQ++W GS+  G GRA  P S               V  Y P GN  G++  NV P  R
Sbjct:  233 LVTGNSKKDLESFGEAVTQVHNTHRARHGAPALKYDPQLSELAQKWAEELVQMPRLSNSGYTFEGIRLGENV-LSRWSTAAVHFGAQDLVDHWYQECSKYKFDTE--PSSIQGIGGFTQVVWSGSQRIGVGRAMQPKSGPGGSTSGPGYKMVAVCFYYPPGNVTGQFKTNVKPSSR 405          
BLAST of Venom allergen 5 vs. TrEMBL
Match: A0A4S2LPW3 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005688 PE=4 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 4.303e-51
Identity = 133/428 (31.07%), Postives = 203/428 (47.43%), Query Frame = 3
Query:   87 MSELEDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFVGKYLENVPPLPRGQKWDKVPIIEEYLDELRTMEYTPARKHILDDWRANWMSGTKAGVSYCDVVEXXXXXXXXXXXGENHFSEDPRKLPRPIFQSQLDDSVYDLGDDQLNGYASDKDSDKGENEEIKSFIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGNVTEE-SAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXX---------XXXESFIVCFYSPAGNTKNEFSQNV 1340
            MS ++DF  ECL  HN  R+ H AP L++S+ L   AQ +AE + ++  +++S    R + GE+++M           G      WY++IK+Y+F +   P      G+FTQL+WK ++E GFG+A+  +S    +V  Y+P GN  G Y ENV  L  GQ        +       T    P  K  +         G +  V + +V+ET           + H     R+     FQ   D             + +  ++  GEN     F +AV   HN YR+ H  A L LD ++   AQDWA++L     +S S + ++ V LGEN+  +  N T   SA+ +VD WY E   Y +  EP + + +G FTQ++W  S++IGVG+            S+ +  +VCFY P GN   +F  NV
Sbjct:    1 MSNMDDFVEECLREHNVKRELHGAPALKHSRALDKTAQDWAEALISEPVIKNSPLSSRGEVGESISMRTSSASHVDIQGNEVVNQWYADIKNYNFAEGKGP-----AGNFTQLVWKATREVGFGKAR--SSGKCIVVAHYRPPGNVRGHYAENVGTLTGGQAASVASATD-------TGILDPNAKRTVVTEEVTSPEGKRYTV-HREVIETTEP--------DGHV----RRCVNETFQDSPDQPTAG------GKHGAGSEAAHGEN-----FADAVTRAHNVYRKRHGAADLQLDPEITHMAQDWAEQLVNRAHLSNSGFTYQGVRLGENVLCRWSNTTATVSAQDVVDHWYQESSKYMFNSEPKSIQGIGGFTQMVWNGSQRIGVGIASQPKKDFYNQPSQSKVIVVCFYYPPGNVTGQFKANV 390          

HSP 2 Score: 60.4622 bits (145), Expect = 4.730e-6
Identity = 48/175 (27.43%), Postives = 75/175 (42.86%), Query Frame = 3
Query:   78 GLKMSELEDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRN-DAGENL---------AMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCW--------YIVGRYQPAGNFVGKYLENV 548
            G + +  E+F      +HN  RK H A  L+   +++  AQ +AE +  +  + +S    +    GEN+          +S +  VD+          WY E   Y FN E  P +    G FTQ++W GS+  G G A  P  + +         +V  Y P GN  G++  NV
Sbjct:  228 GSEAAHGENFADAVTRAHNVYRKRHGAADLQLDPEITHMAQDWAEQLVNRAHLSNSGFTYQGVRLGENVLCRWSNTTATVSAQDVVDH----------WYQESSKYMFNSE--PKSIQGIGGFTQMVWNGSQRIGVGIASQPKKDFYNQPSQSKVIVVCFYYPPGNVTGQFKANV 390          
BLAST of Venom allergen 5 vs. TrEMBL
Match: G7Y5C0 (Golgi-associated plant pathogenesis-related protein 1 (Fragment) OS=Clonorchis sinensis OX=79923 GN=CLF_101246 PE=4 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 2.130e-50
Identity = 134/430 (31.16%), Postives = 205/430 (47.67%), Query Frame = 3
Query:   81 LKMSELEDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFVGKYLENVPPLPRGQKWDKVPIIEEYLDELRTMEYTPARKHILDDWRANWMSGTKAGVSYCDVVEXXXXXXXXXXXGENHFSEDPRKLPRPIFQSQLDDSVYDLGDDQLNGYASDKDSDKGENEEIKSFIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGNVTEE-SAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXESF---------IVCFYSPAGNTKNEFSQNV 1340
            L M  ++DF  ECL  HN  R+ H AP L++S+ L   AQ +AE + ++  +++S    R + GE+++M           G      WY++IK+Y+F +   P      G+FTQL+WK ++E GFG+A+  +S    +V  Y+P GN  G Y ENV   P G++   V    +      T    P  K  +         G +  V + +V+E                + +P    R        DS         +G AS      GEN     F +AV   HN YR+ H VA L LD +++  AQDWA++L     +S S + ++ V LGEN+  +  N     SA+ +VD WY E   Y +  EP + + +G FTQ++W  S++IGVG+   +K + +         +VCFY P GN   +F  NV
Sbjct:    1 LSMPNMDDFIEECLREHNAKRELHGAPALKHSRALDKTAQDWAEALISEPSIKNSPLSSRGEVGESISMRTSSASHVDIQGNEVVNQWYADIKNYNFAEGKGP-----AGNFTQLVWKATREVGFGKAR--SSGKCIVVAHYRPPGNVRGHYAENV-GTPTGEQAASVASATD------TGNLDPNAKRTVVTEEVTSPEGKRYTV-HREVIE----------------TTEPDGHVRRCVNETFQDSPDQATAGGKHG-ASVSFPAHGEN-----FADAVTRAHNVYRKRHGVADLQLDPEISHMAQDWAEQLVNRAHLSNSGFTYQGVRLGENVLCRWSNTAATVSAQDVVDHWYQESSKYKFTSEPKSIQGIGGFTQVVWNGSQRIGVGIASQAKKDFYNQPSQSKVIVVCFYYPPGNVTGQFRANV 393          
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Match: glipr2l (GLI pathogenesis related 2 [Source:NCBI gene;Acc:103023178])

HSP 1 Score: 114.005 bits (284), Expect = 1.594e-29
Identity = 67/162 (41.36%), Postives = 91/162 (56.17%), Query Frame = 3
Query:   75 IGLKMSELEDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFV--GKYLENVPP 554
            +G   S L  F  E L SHN  R++H APPL+ SK+L  +A RYAE +A+   ++HS +  R   GENLA     +  Y   G   S  WY+E+  Y+FN   QP  + ATGHFT ++WK SK+ G G+A   +    ++V RY PAGN    G +  NV P
Sbjct:    1 MGKSASRL--FCEEVLKSHNDYRRKHQAPPLKLSKKLCTEAARYAESLASTRILKHSVESSRGSCGENLA-----WASYDQPGKDVSDRWYNEVNQYNFN---QPGFSSATGHFTAMVWKSSKKLGVGKAV-ASDGSTFVVARYFPAGNITNQGHFQANVLP 151          

HSP 2 Score: 67.3958 bits (163), Expect = 4.476e-13
Identity = 55/146 (37.67%), Postives = 73/146 (50.00%), Query Frame = 3
Query:  909 FIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGNVTEESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXESFIVCFYSPAGNTKNE--FSQNV 1340
            F E V+  HN YRR H    L L  +L T A  +A+ LA    +  S         GEN+        ++  K + D WYNE   YN+  +P    + GHFT ++WK SKK+GVG    S G +F+V  Y PAGN  N+  F  NV
Sbjct:    9 FCEEVLKSHNDYRRKHQAPPLKLSKKLCTEAARYAESLASTRILKHS-VESSRGSCGENLAWAS---YDQPGKDVSDRWYNEVNQYNF-NQPGFSSATGHFTAMVWKSSKKLGVGKAVASDGSTFVVARYFPAGNITNQGHFQANV 149          
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Match: glipr2l (GLI pathogenesis related 2 [Source:NCBI gene;Acc:103023178])

HSP 1 Score: 114.005 bits (284), Expect = 1.594e-29
Identity = 67/162 (41.36%), Postives = 91/162 (56.17%), Query Frame = 3
Query:   75 IGLKMSELEDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFV--GKYLENVPP 554
            +G   S L  F  E L SHN  R++H APPL+ SK+L  +A RYAE +A+   ++HS +  R   GENLA     +  Y   G   S  WY+E+  Y+FN   QP  + ATGHFT ++WK SK+ G G+A   +    ++V RY PAGN    G +  NV P
Sbjct:    1 MGKSASRL--FCEEVLKSHNDYRRKHQAPPLKLSKKLCTEAARYAESLASTRILKHSVESSRGSCGENLA-----WASYDQPGKDVSDRWYNEVNQYNFN---QPGFSSATGHFTAMVWKSSKKLGVGKAV-ASDGSTFVVARYFPAGNITNQGHFQANVLP 151          

HSP 2 Score: 67.3958 bits (163), Expect = 4.476e-13
Identity = 55/146 (37.67%), Postives = 73/146 (50.00%), Query Frame = 3
Query:  909 FIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGNVTEESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXESFIVCFYSPAGNTKNE--FSQNV 1340
            F E V+  HN YRR H    L L  +L T A  +A+ LA    +  S         GEN+        ++  K + D WYNE   YN+  +P    + GHFT ++WK SKK+GVG    S G +F+V  Y PAGN  N+  F  NV
Sbjct:    9 FCEEVLKSHNDYRRKHQAPPLKLSKKLCTEAARYAESLASTRILKHS-VESSRGSCGENLAWAS---YDQPGKDVSDRWYNEVNQYNF-NQPGFSSATGHFTAMVWKSSKKLGVGKAVASDGSTFVVARYFPAGNITNQGHFQANV 149          
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Match: ENSAMXT00000046499.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002310.1:22169:29035:1 gene:ENSAMXG00000037785.1 transcript:ENSAMXT00000046499.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.531 bits (262), Expect = 2.480e-26
Identity = 66/170 (38.82%), Postives = 95/170 (55.88%), Query Frame = 3
Query:   75 IGLKMSELEDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFV--GKYLENVPPLPRGQKWD 578
            +GL       F  E L +HN  RK+H APPL  S+ LS  A+++AE + +   ++HS +E     GENL  +         +G  A  SWY+EIKDY+F++   P  +  TGHFTQ++WK +KE G+G A +      ++VG+Y P GNF   G + +NV  LP G   D
Sbjct:    6 LGLTSLTGGSFEEEFLQTHNTYRKKHGAPPLTISQDLSRSAKKWAEHLLSNKTLQHSNRE----YGENLYYAFSS-GGKSLTGREAVDSWYNEIKDYNFSR---PGFSSGTGHFTQVVWKDTKEVGYGVATD--GKTVFVVGQYLPPGNFTNPGAFEKNV--LPAGTPVD 163          

HSP 2 Score: 62.3882 bits (150), Expect = 3.993e-11
Identity = 51/148 (34.46%), Postives = 76/148 (51.35%), Query Frame = 3
Query:  906 SFIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGNVTEE-SAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXESFIVCFYSPAGNTKN--EFSQNV 1340
            SF E  +  HN YR+ H    L +   L+  A+ WA+ L     +  SN  +     GEN+     +  +  + +  VDSWYNE ++YN+ + P      GHFTQ++WK +K++G GV  + K   F+V  Y P GN  N   F +NV
Sbjct:   15 SFEEEFLQTHNTYRKKHGAPPLTISQDLSRSAKKWAEHLLSNKTLQHSNREY-----GENLYYAFSSGGKSLTGREAVDSWYNEIKDYNFSR-PGFSSGTGHFTQVVWKDTKEVGYGVATDGKT-VFVVGQYLPPGNFTNPGAFEKNV 155          
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Match: ENSAMXT00000037136.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002310.1:26526:29035:1 gene:ENSAMXG00000037785.1 transcript:ENSAMXT00000037136.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 104.76 bits (260), Expect = 6.209e-26
Identity = 64/166 (38.55%), Postives = 96/166 (57.83%), Query Frame = 3
Query:   87 MSELEDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFV--GKYLENVPPLPRGQKWD 578
            +++  +F  E L +HN  RK+H APPL  S+ LS  A+++AE + +   ++HS +E     GENL  +         +G  A  SWY+EIKDY+F++   P  +  TGHFTQ++WK +KE G+G A +      ++VG+Y P GNF   G + +NV  LP G   D
Sbjct:   16 VTDHSNFEEEFLQTHNTYRKKHGAPPLTISQDLSRSAKKWAEHLLSNKTLQHSNRE----YGENLYYAFSS-GGKSLTGREAVDSWYNEIKDYNFSR---PGFSSGTGHFTQVVWKDTKEVGYGVATD--GKTVFVVGQYLPPGNFTNPGAFEKNV--LPAGTPVD 169          

HSP 2 Score: 60.8474 bits (146), Expect = 1.806e-10
Identity = 50/147 (34.01%), Postives = 75/147 (51.02%), Query Frame = 3
Query:  909 FIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGNVTEE-SAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXESFIVCFYSPAGNTKN--EFSQNV 1340
            F E  +  HN YR+ H    L +   L+  A+ WA+ L     +  SN  +     GEN+     +  +  + +  VDSWYNE ++YN+ + P      GHFTQ++WK +K++G GV  + K   F+V  Y P GN  N   F +NV
Sbjct:   22 FEEEFLQTHNTYRKKHGAPPLTISQDLSRSAKKWAEHLLSNKTLQHSNREY-----GENLYYAFSSGGKSLTGREAVDSWYNEIKDYNFSR-PGFSSGTGHFTQVVWKDTKEVGYGVATDGKT-VFVVGQYLPPGNFTNPGAFEKNV 161          
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Match: ENSAMXT00000051775.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002310.1:28035:32028:1 gene:ENSAMXG00000030558.1 transcript:ENSAMXT00000051775.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 101.679 bits (252), Expect = 4.497e-25
Identity = 59/150 (39.33%), Postives = 88/150 (58.67%), Query Frame = 3
Query:  105 FNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFV--GKYLENV 548
            F  E L +HN  RK+H APPL  S+ LS  A+++AE + +   ++HS +E     GENL  +         +G  A  SWY+E+KDY+F++   P  +  TGHFTQ++WK +KE G+G A +      ++VG+Y P GNF   G + +NV
Sbjct:    5 FEEEFLQTHNTYRKKHGAPPLTISQDLSRSAKKWAEHLLSNKTLQHSNRE----YGENLYYAFSS-GGKSLTGREAVDSWYNEVKDYNFSR---PGFSSGTGHFTQVVWKDTKEVGYGVATD--GKTVFVVGQYLPPGNFTNPGAFEKNV 144          

HSP 2 Score: 60.077 bits (144), Expect = 2.008e-10
Identity = 50/147 (34.01%), Postives = 75/147 (51.02%), Query Frame = 3
Query:  909 FIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGNVTEE-SAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXESFIVCFYSPAGNTKN--EFSQNV 1340
            F E  +  HN YR+ H    L +   L+  A+ WA+ L     +  SN  +     GEN+     +  +  + +  VDSWYNE ++YN+ + P      GHFTQ++WK +K++G GV  + K   F+V  Y P GN  N   F +NV
Sbjct:    5 FEEEFLQTHNTYRKKHGAPPLTISQDLSRSAKKWAEHLLSNKTLQHSNREY-----GENLYYAFSSGGKSLTGREAVDSWYNEVKDYNFSR-PGFSSGTGHFTQVVWKDTKEVGYGVATDGKT-VFVVGQYLPPGNFTNPGAFEKNV 144          
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002228.1 (pep scaffold:Pmarinus_7.0:GL477414:68597:85540:-1 gene:ENSPMAG00000002025.1 transcript:ENSPMAT00000002228.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.485 bits (184), Expect = 3.377e-15
Identity = 47/138 (34.06%), Postives = 67/138 (48.55%), Query Frame = 3
Query:  102 DFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPF-VDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQP 512
            DF  + L +HN  R  H A PLR    L  +A+ +AE +  +  ++HS        GENL    RP     +  G   +  WYSE+K YDF+    P   P  G+  +L+W+ S+  G GRA +P   C  +V  Y P
Sbjct:   28 DFAGDLLRAHNAARARHGAAPLRACAALEREARAWAEHLLERRALKHSDTSH----GENL--YYRPLGAREQAPGKEVTEHWYSEVKHYDFSS---PGYKPKVGYLDKLVWRASQSLGVGRAVSP-QGCVVVVAVYDP 155          

HSP 2 Score: 62.003 bits (149), Expect = 8.646e-11
Identity = 48/155 (30.97%), Postives = 74/155 (47.74%), Query Frame = 3
Query:   99 EDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGEN-LAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGN--FVGKYLENVPP 554
            E+F  + L  HN LR+ H A PLR S  L  DA+ +A  +A    +   +       G+N +A +   +     +G   +  WY++   YD+N    P     TG+F+QL+W+ S + G G A +     +  V  Y PAGN  +   Y +NV P
Sbjct:  219 EEFCIDVLAEHNRLREIHGARPLRRSVALGRDARAWARELARSRAL---RSHPTVPHGQNTVAFAWVRYRMLITAGRKVTNCWYADRLAYDYN---NPGFQQGTGNFSQLVWRSSLDLGVGLACD-GRGMFVAVAFYSPAGNLPYAMSYRDNVLP 366          

HSP 3 Score: 52.7582 bits (125), Expect = 7.738e-8
Identity = 44/157 (28.03%), Postives = 71/157 (45.22%), Query Frame = 3
Query:  870 KDSDKGENEEIKSFIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITT---KKGNVTEESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXESFIVCFYSPAGNTKNEFS 1331
            + S   + E+ + F   V+++HN  R  H    L     L   A+ WA ELA    +         VP G+N       +  +   + + + + WY +   Y+Y   P   +  G+F+QL+W+ S  +GVG+  + +G    V FYSPAGN     S
Sbjct:  208 RGSTSQQKEDQEEFCIDVLAEHNRLREIHGARPLRRSVALGRDARAWARELARSRALRS----HPTVPHGQNTVAFAWVRYRMLITAGRKVTNCWYADRLAYDY-NNPGFQQGTGNFSQLVWRSSLDLGVGLACDGRGMFVAVAFYSPAGNLPYAMS 359          
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002231.1 (pep scaffold:Pmarinus_7.0:GL477414:68597:85459:-1 gene:ENSPMAG00000002025.1 transcript:ENSPMAT00000002231.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.8626 bits (172), Expect = 1.001e-13
Identity = 48/149 (32.21%), Postives = 68/149 (45.64%), Query Frame = 3
Query:  102 DFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKY----SGLG--------ASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQP 512
            DF  + L +HN  R  H A PLR    L  +A+ +AE +  +  ++HS        GENL    RP    +      G G         +  WYSE+K YDF+    P   P  G+  +L+W+ S+  G GRA +P   C  +V  Y P
Sbjct:    1 DFAGDLLRAHNAARARHGAAPLRACAALEREARAWAEHLLERRALKHSDTSH----GENL--YYRPLGAREQGAEPGGTGLRLRGRKEVTEHWYSEVKHYDFS---SPGYKPKVGYLDKLVWRASQSLGVGRAVSP-QGCVVVVAVYDP 139          

HSP 2 Score: 60.8474 bits (146), Expect = 1.969e-10
Identity = 49/156 (31.41%), Postives = 74/156 (47.44%), Query Frame = 3
Query:   99 EDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYA-ELIAAKDEMEH-SKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGN--FVGKYLENVPP 554
            E+F  + L  HN LR+ H A PLR S  L  DA+ +A EL  ++    H +    +N   +++     P       G   +  WY++   YD+N    P     TG+F+QL+W+ S + G G A +     +  V  Y PAGN  +   Y +NV P
Sbjct:  188 EEFCIDVLAEHNRLREIHGARPLRRSVALGRDARAWARELARSRALRSHPTVPHGQNVWAKHIGTGELP------KGRKVTNCWYADRLAYDYN---NPGFQQGTGNFSQLVWRSSLDLGVGLACD-GRGMFVAVAFYSPAGNLPYAMSYRDNVLP 333          

HSP 3 Score: 55.0694 bits (131), Expect = 1.596e-8
Identity = 44/141 (31.21%), Postives = 67/141 (47.52%), Query Frame = 3
Query:  894 EEIKSFIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGNVTE-ESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXESFIVCFYSPAGN 1313
            E+ + F   V+++HN  R  H    L     L   A+ WA ELA    +         VP G+N+  K     E    + + + WY +   Y+Y   P   +  G+F+QL+W+ S  +GVG+  + +G    V FYSPAGN
Sbjct:  185 EDQEEFCIDVLAEHNRLREIHGARPLRRSVALGRDARAWARELARSRALRS----HPTVPHGQNVWAKHIGTGELPKGRKVTNCWYADRLAYDY-NNPGFQQGTGNFSQLVWRSSLDLGVGLACDGRGMFVAVAFYSPAGN 320          
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Match: glipr2l (GLI pathogenesis-related 2, like [Source:ZFIN;Acc:ZDB-GENE-041010-53])

HSP 1 Score: 56.9954 bits (136), Expect = 1.424e-10
Identity = 31/92 (33.70%), Postives = 49/92 (53.26%), Query Frame = 3
Query:   99 EDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFN 374
            ++F  E L++HN  RK H    L  S ++  +AQ YAE +A    ++HS   +R   GENLA     +  Y       +  WY+EI++Y+F+
Sbjct:    7 KEFARELLNAHNDYRKTHGVATLSLSSKMCREAQSYAESLARTRVLKHSSDTERGQCGENLA-----WASYDEPAKEVAERWYAEIQNYNFS 93          

HSP 2 Score: 50.447 bits (119), Expect = 3.062e-8
Identity = 31/90 (34.44%), Postives = 49/90 (54.44%), Query Frame = 3
Query:  903 KSFIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGNVTEESAKALVDSWYNEGRNYNY 1172
            K F   +++ HN YR+ H VATL+L +++   AQ +A+ LA    +  S+   E    GEN+        +E AK + + WY E +NYN+
Sbjct:    7 KEFARELLNAHNDYRKTHGVATLSLSSKMCREAQSYAESLARTRVLKHSSDT-ERGQCGENLAWAS---YDEPAKEVAERWYAEIQNYNF 92          
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002224.1 (pep scaffold:Pmarinus_7.0:GL477414:68570:72489:-1 gene:ENSPMAG00000002025.1 transcript:ENSPMAT00000002224.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 3.009e-10
Identity = 47/154 (30.52%), Postives = 71/154 (46.10%), Query Frame = 3
Query:  114 ECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGN--FVGKYLENV-PPLPRG 566
            + L  HN LR+ H A PLR S  L  DA+ +A  +A    +   +       G+N  + +      K +       WY++   YD+N    P     TG+F+QL+W+ S + G G A +     +  V  Y PAGN  +   Y +NV PP  +G
Sbjct:    1 DVLAEHNRLREIHGARPLRRSVALGRDARAWARELARSRAL---RSHPTVPHGQNRCVRVGSIPRRKVTN-----CWYADRLAYDYN---NPGFQQGTGNFSQLVWRSSLDLGVGLACD-GRGMFVAVAFYSPAGNLPYAMSYRDNVLPPHTQG 142          

HSP 2 Score: 48.521 bits (114), Expect = 2.858e-7
Identity = 41/131 (31.30%), Postives = 64/131 (48.85%), Query Frame = 3
Query:  921 VVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGNVTEESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXESFIVCFYSPAGN 1313
            V+++HN  R  H    L     L   A+ WA ELA    +         VP G+N   + G++     + + + WY +   Y+Y   P   +  G+F+QL+W+ S  +GVG+  + +G    V FYSPAGN
Sbjct:    2 VLAEHNRLREIHGARPLRRSVALGRDARAWARELARSRALRSH----PTVPHGQNRCVRVGSIPR---RKVTNCWYADRLAYDY-NNPGFQQGTGNFSQLVWRSSLDLGVGLACDGRGMFVAVAFYSPAGN 124          
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Match: CRISP3 (cysteine rich secretory protein 3 [Source:HGNC Symbol;Acc:HGNC:16904])

HSP 1 Score: 51.2174 bits (121), Expect = 1.482e-7
Identity = 40/140 (28.57%), Postives = 58/140 (41.43%), Query Frame = 3
Query:  129 HNGLRK-----EHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFG---RAKNPTSNCWYIVGRYQPAGNF 524
            HN LR+       N   + + K+  L+A  +A         +  +K  +   GEN+ MS  PF  + Y    A   WY+E+    F  +       A GH+TQL+W  S + G       KNP    +  V  Y P GN 
Sbjct:   51 HNDLRRNVTPSAGNMLQMMWKKEAYLNALSWANNCTFGHSPDARRKTTQWTCGENIFMSSAPFT-WNY----AIRDWYNEVISPGFQYDVGSTTTGAVGHYTQLVWYNSFQLGCAVNYCPKNPGVAKYLYVCHYCPMGNL 185          
BLAST of Venom allergen 5 vs. Ensembl Yeast
Match: PRY3 (Cell wall-associated protein involved in export of acetylated sterols; member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); role in mating efficiency; expression of full-length transcript is daughter cell-specific; in response to alpha factor, a short transcript starting at +452 is expressed and the long form is repressed by Ste12p [Source:SGD;Acc:S000003614])

HSP 1 Score: 85.1149 bits (209), Expect = 5.402e-18
Identity = 58/170 (34.12%), Postives = 85/170 (50.00%), Query Frame = 3
Query:   60 FLEFLIGLKM-SELEDFNYECLHSHNGLRKEH-NAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCW--YIVGRYQPAGNFVGKYLENVPPL 557
             L  L+ +K  +   +F  + L+ HN  R  H +  PL +S  L+  AQ YA+       + HS        GENLA+         Y+  GA  +WY EI  Y++   + P  + +TGHFTQ++WK + E G G     T+  W  YIV  Y P GN++G++ E V PL
Sbjct:    9 LLGCLVAVKAQTTFPNFESDVLNEHNKFRALHVDTAPLTWSDTLATYAQNYADQYDCSGVLTHSD----GPYGENLAL--------GYTDTGAVDAWYGEISKYNY---SNPGFSESTGHFTQVVWKSTAEIGCGYKYCGTT--WNNYIVCSYNPPGNYLGEFAEEVEPL 161          

HSP 2 Score: 61.6178 bits (148), Expect = 1.641e-10
Identity = 51/145 (35.17%), Postives = 75/145 (51.72%), Query Frame = 3
Query:  921 VVSQHNYYRRNH-NVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENIT---TKKGNVTEESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXX-ESFIVCFYSPAGNTKNEFSQNV 1340
            V+++HN +R  H + A L   + L TYAQ++AD+      ++ S+      P GEN+    T  G          VD+WY E   YNY   P   +S GHFTQ++WK + +IG G         ++IVC Y+P GN   EF++ V
Sbjct:   29 VLNEHNKFRALHVDTAPLTWSDTLATYAQNYADQYDCSGVLTHSDG-----PYGENLALGYTDTG---------AVDAWYGEISKYNYSN-PGFSESTGHFTQVVWKSTAEIGCGYKYCGTTWNNYIVCSYNPPGNYLGEFAEEV 158          
BLAST of Venom allergen 5 vs. Ensembl Yeast
Match: PRY2 (Sterol binding protein involved in the export of acetylated sterols; secreted glycoprotein and member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); sterol export function is redundant with that of PRY1; may be involved in detoxification of hydrophobic compounds; PRY2 has a paralog, PRY1, that arose from the whole genome duplication [Source:SGD;Acc:S000001721])

HSP 1 Score: 80.4925 bits (197), Expect = 3.695e-17
Identity = 53/159 (33.33%), Postives = 79/159 (49.69%), Query Frame = 3
Query:  102 DFNYECLHSHNGLRKEH-NAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNC---W--YIVGRYQPAGNFVGKYLENVPPLP 560
            DF+   ++ HN  R  H +   L +S  L+  AQ YA+       + HS        GENLA+         Y   G+  +WY+EI  YD++    P  + + GHFTQ++WKG+ E G G       +C   W  YI+  Y+ AGN +G++ +NV PL 
Sbjct:  191 DFSTSMVNEHNTKRALHKDTGSLTWSDTLATYAQNYADSYDCSGNLVHSG----GPYGENLALG--------YGTTGSVDAWYNEITSYDYSN---PGFSESAGHFTQVVWKGTSEVGCGL-----KSCGGEWGDYIICSYKAAGNVIGEFADNVMPLA 329          

HSP 2 Score: 66.6254 bits (161), Expect = 1.315e-12
Identity = 49/146 (33.56%), Postives = 73/146 (50.00%), Query Frame = 3
Query:  909 FIEAVVSQHNYYRRNH-NVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGNVTEESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXX-ESFIVCFYSPAGNTKNEFSQNV 1340
            F  ++V++HN  R  H +  +L   + L TYAQ++AD           N +    P GEN+    G          VD+WYNE  +Y+Y   P   +S GHFTQ++WK + ++G G+         +I+C Y  AGN   EF+ NV
Sbjct:  192 FSTSMVNEHNTKRALHKDTGSLTWSDTLATYAQNYADSYDCSG-----NLVHSGGPYGENLALGYGT------TGSVDAWYNEITSYDYSN-PGFSESAGHFTQVVWKGTSEVGCGLKSCGGEWGDYIICSYKAAGNVIGEFADNV 325          
BLAST of Venom allergen 5 vs. Ensembl Yeast
Match: PRY1 (Sterol binding protein involved in the export of acetylated sterols; secreted glycoprotein and member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); sterol export function is redundant with that of PRY2; may be involved in detoxification of hydrophobic compounds; PRY1 has a paralog, PRY2, that arose from the whole genome duplication [Source:SGD;Acc:S000003615])

HSP 1 Score: 79.7221 bits (195), Expect = 4.648e-17
Identity = 54/149 (36.24%), Postives = 73/149 (48.99%), Query Frame = 3
Query:  120 LHSHNGLRKEH-NAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCW--YIVGRYQPAGNFVGKYLENVPPL 557
            L  HN  R  H + P L +S  L+  AQ YA+       + HS        GENLA+         Y G  A  +WY+EI +YDF+      N   TGHFTQ++WK + + G G         W  Y++  Y PAGN+ G+Y +NV PL
Sbjct:  167 LAEHNKKRALHKDTPALSWSDTLASYAQDYADNYDCSGTLTHSG----GPYGENLALG--------YDGPAAVDAWYNEISNYDFSNPGFSSN---TGHFTQVVWKSTTQVGCGI--KTCGGAWGDYVICSYDPAGNYEGEYADNVEPL 298          

HSP 2 Score: 64.6994 bits (156), Expect = 4.706e-12
Identity = 46/142 (32.39%), Postives = 73/142 (51.41%), Query Frame = 3
Query:  921 VVSQHNYYRRNH-NVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGNVTEESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXX-ESFIVCFYSPAGNTKNEFSQNV 1340
            V+++HN  R  H +   L+  + L +YAQD+AD       ++ S       P GEN+             A VD+WYNE  NY++   P    + GHFTQ++WK + ++G G+         +++C Y PAGN + E++ NV
Sbjct:  166 VLAEHNKKRALHKDTPALSWSDTLASYAQDYADNYDCSGTLTHSG-----GPYGENLALGY------DGPAAVDAWYNEISNYDFSN-PGFSSNTGHFTQVVWKSTTQVGCGIKTCGGAWGDYVICSYDPAGNYEGEYADNV 295          
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Match: EDO48663 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI98])

HSP 1 Score: 140.584 bits (353), Expect = 6.653e-40
Identity = 75/151 (49.67%), Postives = 93/151 (61.59%), Query Frame = 3
Query:  105 FNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAM-SMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFVGKYLENVPP 554
            F  +C+ +HN  R  H+APPL++S +L+ +AQ YAE +A +  M+HS K  RNDAGENLAM S R    Y  +G  A   WY E K Y F    +  +   TGHFTQ++WKGSKE G GRAK     C Y+V RYQPAGN V    ENV P
Sbjct:    3 FKNQCVDNHNKYRAMHSAPPLKWSDELAREAQYYAEKLAQQRSMQHSSKCSRNDAGENLAMFSGR----YDTAGDMACEMWYEESKKYSF---VRGGSQMGTGHFTQMVWKGSKELGMGRAKTSDGRCTYVVARYQPAGNIVNYMSENVAP 146          

HSP 2 Score: 63.929 bits (154), Expect = 3.048e-12
Identity = 50/147 (34.01%), Postives = 76/147 (51.70%), Query Frame = 3
Query:  903 KSFIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGNVTEESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXE-SFIVCFYSPAGNTKNEFSQNV 1340
            +SF    V  HN YR  H+   L   ++L   AQ +A++LA +  M  S+    N   GEN+    G   + +     + WY E + Y++ +        GHFTQ++WK SK++G+G  K S G  +++V  Y PAGN  N  S+NV
Sbjct:    1 RSFKNQCVDNHNKYRAMHSAPPLKWSDELAREAQYYAEKLAQQRSMQHSSKCSRN-DAGENLAMFSGRY-DTAGDMACEMWYEESKKYSFVRGGSQM-GTGHFTQMVWKGSKELGMGRAKTSDGRCTYVVARYQPAGNIVNYMSENV 144          
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Match: EDO35383 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLP0])

HSP 1 Score: 117.472 bits (293), Expect = 1.949e-31
Identity = 62/150 (41.33%), Postives = 85/150 (56.67%), Query Frame = 3
Query:  105 FNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFVGKYLENVPP 554
            F  +C+  HN LR +H AP + +S QL+ DAQ +A  IA    +EHS  + R D GENL MS    ++           WYSE+  Y F K   P     TGHFTQ++WKG+KE     A+ P  +  Y+VGRY+PAGN + ++ +NV P
Sbjct:    3 FQKDCIEVHNELRAQHQAPKVTWSDQLAKDAQAWANHIAKNGRLEHSSPDSRPDQGENLFMSSPGEINAG----DVVDEWYSEVSKYKFGK---PGWQSGTGHFTQVVWKGTKEVAMASAEGPDGSV-YVVGRYKPAGNVLTQFADNVLP 144          

HSP 2 Score: 63.1586 bits (152), Expect = 4.895e-12
Identity = 46/146 (31.51%), Postives = 74/146 (50.68%), Query Frame = 3
Query:  906 SFIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVP-LGENITTKKGNVTEESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXESFIVCFYSPAGNTKNEFSQNV 1340
            SF +  +  HN  R  H    +   +QL   AQ WA+ +A   ++  S+   ++ P  GEN+     +  E +A  +VD WY+E   Y + K P      GHFTQ++WK +K++ +   +   G  ++V  Y PAGN   +F+ NV
Sbjct:    2 SFQKDCIEVHNELRAQHQAPKVTWSDQLAKDAQAWANHIAKNGRLEHSSP--DSRPDQGENLFMS--SPGEINAGDVVDEWYSEVSKYKFGK-PGWQSGTGHFTQVVWKGTKEVAMASAEGPDGSVYVVGRYKPAGNVLTQFADNV 142          
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Match: EDO34720 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNJ3])

HSP 1 Score: 116.701 bits (291), Expect = 4.786e-31
Identity = 66/149 (44.30%), Postives = 88/149 (59.06%), Query Frame = 3
Query:  120 LHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAK----DEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRA--KNPTSNCWYIVGRYQPAGNFVGKYLENV 548
            +++HN  R  HNAP +     L+  AQ YA  +AAK     E+ HS  ++R + GENLA      V   YS + A+  WY+E+KDYDFN    P  + ATGHFTQ++WKGS E G GRA  K   + C+ +VGRY+P GN  G +  NV
Sbjct:    1 MNTHNAKRAIHNAPKMTLKDDLNKGAQDYAVKLAAKMQAGSELVHSANDERPNQGENLAWGCYSGV---YSCVKATTEWYNEVKDYDFN---NPGFSGATGHFTQVVWKGSSELGVGRAKYKEGANTCYVVVGRYRPPGNMAGAFPANV 143          

HSP 2 Score: 49.6766 bits (117), Expect = 2.728e-7
Identity = 50/147 (34.01%), Postives = 72/147 (48.98%), Query Frame = 3
Query:  924 VSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLF-----ENVPLGENITTKKGNVTEESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXES---FIVCFYSPAGNTKNEFSQNV 1340
            ++ HN  R  HN   + L + LN  AQD+A +LA   KM   + L      E    GEN+     +      KA  + WYNE ++Y++   P    + GHFTQ++WK S ++GVG  K  +G +    +V  Y P GN    F  NV
Sbjct:    1 MNTHNAKRAIHNAPKMTLKDDLNKGAQDYAVKLAA--KMQAGSELVHSANDERPNQGENLAWGCYSGVYSCVKATTE-WYNEVKDYDFN-NPGFSGATGHFTQVVWKGSSELGVGRAKYKEGANTCYVVVGRYRPPGNMAGAFPANV 143          
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Match: EDO40545 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6Z3])

HSP 1 Score: 115.161 bits (287), Expect = 2.766e-30
Identity = 63/152 (41.45%), Postives = 89/152 (58.55%), Query Frame = 3
Query:  102 DFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRN-DAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSN--CWYIVGRYQPAGNFVGKYLENV 548
            +F  E L +HN  R+ HNAPP+  +++LSL A+ YAE IA    ++HS   +R  D GENLA+  + F     +G  A  +WY+E+  YDFN  A       TGHFTQ++W  S E G G+A    +   C ++VGRY+P GNF  ++ E V
Sbjct:    5 EFEEEALLTHNNFRQVHNAPPMTLNRELSLQAKGYAEKIANLGALQHSSSGERGEDVGENLAVGCKSF-GVPLTGKEAVTNWYNEVCKYDFNNGAFAME---TGHFTQVVWTDSIELGMGKATGKLNGIPCVFVVGRYRPPGNFNNQFKEKV 152          

HSP 2 Score: 53.1434 bits (126), Expect = 2.274e-8
Identity = 42/148 (28.38%), Postives = 72/148 (48.65%), Query Frame = 3
Query:  909 FIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTK-KGNVTEESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXE---SFIVCFYSPAGNTKNEFSQNV 1340
            F E  +  HN +R+ HN   + L+ +L+  A+ +A+++A    +  S+       +GEN+    K      + K  V +WYNE   Y++       ++ GHFTQ++W  S ++G+G            F+V  Y P GN  N+F + V
Sbjct:    6 FEEEALLTHNNFRQVHNAPPMTLNRELSLQAKGYAEKIANLGALQHSSSGERGEDVGENLAVGCKSFGVPLTGKEAVTNWYNEVCKYDFNNGAFAMET-GHFTQVVWTDSIELGMGKATGKLNGIPCVFVVGRYRPPGNFNNQFKEKV 152          
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Match: EDO48880 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHM7])

HSP 1 Score: 114.39 bits (285), Expect = 2.834e-30
Identity = 63/150 (42.00%), Postives = 90/150 (60.00%), Query Frame = 3
Query:  105 FNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFVGKYLENVPP 554
            +  ECL SHN  R +H APPL++S +L+ D  ++A+ +A ++ M+HSK E     GENLA +      Y+ SG   +  WY EI+ Y FN    P  +  TGHFTQ++W GS+E G  +A +  +   Y V RY PAGN +G++ ENV P
Sbjct:    5 YQKECLDSHNAYRAQHGAPPLKWSAKLASDCDKWAKDLARRNTMQHSKGE----YGENLAFA----SGYELSGGRTTEMWYDEIQKYRFN---NPGFSSGTGHFTQVVWVGSQEMGVAKAVS-KNGAHYAVARYYPAGNVIGQFPENVKP 142          

HSP 2 Score: 60.077 bits (144), Expect = 4.868e-11
Identity = 44/140 (31.43%), Postives = 63/140 (45.00%), Query Frame = 3
Query:  921 VVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGNVTEESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXESFIVCFYSPAGNTKNEFSQNV 1340
             +  HN YR  H    L    +L +    WA +LA  N M  S   +     GEN+    G   E S     + WY+E + Y +   P      GHFTQ++W  S+++GV    +  G  + V  Y PAGN   +F +NV
Sbjct:    9 CLDSHNAYRAQHGAPPLKWSAKLASDCDKWAKDLARRNTMQHSKGEY-----GENLAFASG--YELSGGRTTEMWYDEIQKYRF-NNPGFSSGTGHFTQVVWVGSQEMGVAKAVSKNGAHYAVARYYPAGNVIGQFPENV 140          
BLAST of Venom allergen 5 vs. Ensembl Medaka
Match: ENSORLT00000020413.2 (Golgi-associated plant pathogenesis-related protein 1-like [Source:NCBI gene;Acc:101166141])

HSP 1 Score: 106.686 bits (265), Expect = 4.973e-27
Identity = 66/155 (42.58%), Postives = 91/155 (58.71%), Query Frame = 3
Query:   99 EDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAM-SMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFV--GKYLENVPP 554
            E+F  E L++HN  R  H APPL Y+K+L  +AQ++A+       + HS  E+    GEN+   S  P V  K +G  A  +WYSEIKDY+F K   P +   TGHFTQ++WK SKE G G A +      ++VG+Y+P GNF   G++  NV P
Sbjct:    4 EEFQQEFLNAHNAYRALHGAPPLTYNKELCDEAQKWADTCLRTHTLGHSDTEE----GENVFYKSGSPPV--KVTGKDAVDAWYSEIKDYNFKK---PGSQSGTGHFTQVVWKESKELGLGMATD--GRMAFVVGQYRPPGNFTNPGQFEANVLP 147          

HSP 2 Score: 65.855 bits (159), Expect = 1.673e-12
Identity = 50/147 (34.01%), Postives = 81/147 (55.10%), Query Frame = 3
Query:  909 FIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGN-VTEESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXESFIVCFYSPAGNTKN--EFSQNV 1340
            F +  ++ HN YR  H    L  + +L   AQ WAD     + +  S     +   GEN+  K G+   + + K  VD+WY+E ++YN++K P +    GHFTQ++WK+SK++G+G+  + +  +F+V  Y P GN  N  +F  NV
Sbjct:    6 FQQEFLNAHNAYRALHGAPPLTYNKELCDEAQKWADTCLRTHTLGHS-----DTEEGENVFYKSGSPPVKVTGKDAVDAWYSEIKDYNFKK-PGSQSGTGHFTQVVWKESKELGLGMATDGRM-AFVVGQYRPPGNFTNPGQFEANV 145          
BLAST of Venom allergen 5 vs. Ensembl Medaka
Match: ENSORLT00000028427.1 (Golgi-associated plant pathogenesis-related protein 1-like [Source:NCBI gene;Acc:101166141])

HSP 1 Score: 106.686 bits (265), Expect = 4.973e-27
Identity = 66/155 (42.58%), Postives = 91/155 (58.71%), Query Frame = 3
Query:   99 EDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAM-SMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFV--GKYLENVPP 554
            E+F  E L++HN  R  H APPL Y+K+L  +AQ++A+       + HS  E+    GEN+   S  P V  K +G  A  +WYSEIKDY+F K   P +   TGHFTQ++WK SKE G G A +      ++VG+Y+P GNF   G++  NV P
Sbjct:    4 EEFQQEFLNAHNAYRALHGAPPLTYNKELCDEAQKWADTCLRTHTLGHSDTEE----GENVFYKSGSPPV--KVTGKDAVDAWYSEIKDYNFKK---PGSQSGTGHFTQVVWKESKELGLGMATD--GRMAFVVGQYRPPGNFTNPGQFEANVLP 147          

HSP 2 Score: 65.855 bits (159), Expect = 1.673e-12
Identity = 50/147 (34.01%), Postives = 81/147 (55.10%), Query Frame = 3
Query:  909 FIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGN-VTEESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXESFIVCFYSPAGNTKN--EFSQNV 1340
            F +  ++ HN YR  H    L  + +L   AQ WAD     + +  S     +   GEN+  K G+   + + K  VD+WY+E ++YN++K P +    GHFTQ++WK+SK++G+G+  + +  +F+V  Y P GN  N  +F  NV
Sbjct:    6 FQQEFLNAHNAYRALHGAPPLTYNKELCDEAQKWADTCLRTHTLGHS-----DTEEGENVFYKSGSPPVKVTGKDAVDAWYSEIKDYNFKK-PGSQSGTGHFTQVVWKESKELGLGMATDGRM-AFVVGQYRPPGNFTNPGQFEANV 145          
BLAST of Venom allergen 5 vs. Ensembl Medaka
Match: ENSORLT00000043877.1 (Golgi-associated plant pathogenesis-related protein 1-like [Source:NCBI gene;Acc:101166141])

HSP 1 Score: 106.686 bits (265), Expect = 5.545e-27
Identity = 66/155 (42.58%), Postives = 91/155 (58.71%), Query Frame = 3
Query:   99 EDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAM-SMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFV--GKYLENVPP 554
            E+F  E L++HN  R  H APPL Y+K+L  +AQ++A+       + HS  E+    GEN+   S  P V  K +G  A  +WYSEIKDY+F K   P +   TGHFTQ++WK SKE G G A +      ++VG+Y+P GNF   G++  NV P
Sbjct:    9 EEFQQEFLNAHNAYRALHGAPPLTYNKELCDEAQKWADTCLRTHTLGHSDTEE----GENVFYKSGSPPV--KVTGKDAVDAWYSEIKDYNFKK---PGSQSGTGHFTQVVWKESKELGLGMATD--GRMAFVVGQYRPPGNFTNPGQFEANVLP 152          

HSP 2 Score: 65.4698 bits (158), Expect = 2.080e-12
Identity = 50/147 (34.01%), Postives = 81/147 (55.10%), Query Frame = 3
Query:  909 FIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGN-VTEESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXESFIVCFYSPAGNTKN--EFSQNV 1340
            F +  ++ HN YR  H    L  + +L   AQ WAD     + +  S     +   GEN+  K G+   + + K  VD+WY+E ++YN++K P +    GHFTQ++WK+SK++G+G+  + +  +F+V  Y P GN  N  +F  NV
Sbjct:   11 FQQEFLNAHNAYRALHGAPPLTYNKELCDEAQKWADTCLRTHTLGHS-----DTEEGENVFYKSGSPPVKVTGKDAVDAWYSEIKDYNFKK-PGSQSGTGHFTQVVWKESKELGLGMATDGRM-AFVVGQYRPPGNFTNPGQFEANV 150          
BLAST of Venom allergen 5 vs. Ensembl Medaka
Match: glipr2l (GLI pathogenesis related 2 [Source:NCBI gene;Acc:101165836])

HSP 1 Score: 106.686 bits (265), Expect = 7.531e-27
Identity = 60/160 (37.50%), Postives = 88/160 (55.00%), Query Frame = 3
Query:   81 LKMSELEDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFV--GKYLENVPP 554
            +  S  + F+ E L  HN  RK+H AP L+ S +LS +A RYAE +A+   ++HS+   R   GENLA     +  Y  +G   +  WY E+K Y+F++   P     TGHFT ++WK +K+ G G+A   +    ++V RY PAGN    G +  NV P
Sbjct:    1 MGKSASKQFSEELLRCHNEYRKKHQAPELKLSSKLSTEAARYAESLASIRILKHSEASARGSCGENLA-----WASYDQTGKDVTDRWYEEVKQYNFSR---PGFTTGTGHFTAMVWKNTKKLGVGKAV-ASDGSSFVVARYFPAGNITNQGHFENNVLP 151          

HSP 2 Score: 67.3958 bits (163), Expect = 5.976e-13
Identity = 53/148 (35.81%), Postives = 76/148 (51.35%), Query Frame = 3
Query:  903 KSFIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGNVTEESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXESFIVCFYSPAGNTKNE--FSQNV 1340
            K F E ++  HN YR+ H    L L ++L+T A  +A+ LA    +  S         GEN+        +++ K + D WY E + YN+ + P      GHFT ++WK +KK+GVG    S G SF+V  Y PAGN  N+  F  NV
Sbjct:    7 KQFSEELLRCHNEYRKKHQAPELKLSSKLSTEAARYAESLASIRILKHSEASARG-SCGENLAWAS---YDQTGKDVTDRWYEEVKQYNFSR-PGFTTGTGHFTAMVWKNTKKLGVGKAVASDGSSFVVARYFPAGNITNQGHFENNV 149          
BLAST of Venom allergen 5 vs. Ensembl Medaka
Match: ENSORLT00000031186.1 (Golgi-associated plant pathogenesis-related protein 1-like [Source:NCBI gene;Acc:101165896])

HSP 1 Score: 98.2117 bits (243), Expect = 5.922e-24
Identity = 62/153 (40.52%), Postives = 86/153 (56.21%), Query Frame = 3
Query:  105 FNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAM-SMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFV--GKYLENVPP 554
            F  E L +HN  R  H APPL Y+ ++  +AQ++A+       + HS+ +D    GEN+   S  P V    +G  A  +WYSEIKDY+F K   P     TGHFTQ++WK SKE G G A +      ++VG+Y+P GNF   G++  NV P
Sbjct:    6 FQQEFLETHNAYRALHGAPPLTYNSKMCGEAQKWADECLRIHTLGHSETKD----GENVFFKSGSPSVS--ITGKDAVDAWYSEIKDYNFKK---PGFKSGTGHFTQVVWKESKELGLGMATD--GRMAFVVGQYRPPGNFSNPGQFEANVLP 147          

HSP 2 Score: 65.4698 bits (158), Expect = 2.461e-12
Identity = 52/150 (34.67%), Postives = 83/150 (55.33%), Query Frame = 3
Query:  903 KSFIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGNVTEE-SAKALVDSWYNEGRNYNYRKEPDNFKS-VGHFTQLLWXXXXXXXXXXXXXXXXESFIVCFYSPAGNTKN--EFSQNV 1340
            + F +  +  HN YR  H    L  ++++   AQ WADE    + +  S         GEN+  K G+ +   + K  VD+WY+E ++YN++K    FKS  GHFTQ++WK+SK++G+G+  + +  +F+V  Y P GN  N  +F  NV
Sbjct:    4 RKFQQEFLETHNAYRALHGAPPLTYNSKMCGEAQKWADECLRIHTLGHS-----ETKDGENVFFKSGSPSVSITGKDAVDAWYSEIKDYNFKKP--GFKSGTGHFTQVVWKESKELGLGMATDGRM-AFVVGQYRPPGNFSNPGQFEANV 145          
BLAST of Venom allergen 5 vs. Planmine SMEST
Match: SMESG000005602.1 (SMESG000005602.1)

HSP 1 Score: 810.831 bits (2093), Expect = 0.000e+0
Identity = 417/418 (99.76%), Postives = 418/418 (100.00%), Query Frame = 3
Query:   87 MSELEDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFVGKYLENVPPLPRGQKWDKVPIIEEYLDELRTMEYTPARKHILDDWRANWMSGTKAGVSYCDVVEXXXXXXXXXXXGENHFSEDPRKLPRPIFQSQLDDSVYDLGDDQLNGYASDKDSDKGENEEIKSFIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGNVTEESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXESFIVCFYSPAGNTKNEFSQNV 1340
            MSELEDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFVGKYLENVPPLPRGQKWDKVPIIEEYLDELRTMEYTPARKHILDDWRANWMSGTKAGVSYCDVVETFTTPTGSTYTGENHFSEDPRKLPRPIFQSQLDDSVYDLGDDQLNGYASDK+SDKGENEEIKSFIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGNVTEESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWKKSKKIGVGVGKNSKGESFIVCFYSPAGNTKNEFSQNV
Sbjct:    1 MSELEDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFVGKYLENVPPLPRGQKWDKVPIIEEYLDELRTMEYTPARKHILDDWRANWMSGTKAGVSYCDVVETFTTPTGSTYTGENHFSEDPRKLPRPIFQSQLDDSVYDLGDDQLNGYASDKNSDKGENEEIKSFIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGNVTEESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWKKSKKIGVGVGKNSKGESFIVCFYSPAGNTKNEFSQNV 418          
BLAST of Venom allergen 5 vs. Planmine SMEST
Match: SMESG000005601.1 (SMESG000005601.1)

HSP 1 Score: 286.96 bits (733), Expect = 4.411e-94
Identity = 139/246 (56.50%), Postives = 179/246 (72.76%), Query Frame = 3
Query:   87 MSELEDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFVGKYLENVPPLPRGQKWDKVPIIEEYLDELRTMEYTPARKHILDDWRANWMSGTKAGVSYCDVVEXXXXXXXXXXXGENHFSEDPRKLPRPIFQSQLDDS 824
            ++E+++FN ECL +HNGLR+ HN+PPL Y KQLS +AQ+YA+ IA+KD M HS +EDRN  GENLAMSM+    YK+SGLGA+  WYSEI+D DF    +  N   TGHFTQ+IWK +K+AGFGRA+N  S+CWYIVGRY P+GN    Y ENV PL   Q+WD +PI+E YL EL+T E+T AR+H+LD W+A +++  K G    DV+E+FTTP G  Y G+  FSEDP K PRPIF+   +D 
Sbjct:   10 ITEMDEFNCECLDAHNGLRRFHNSPPLEYCKQLSREAQKYADFIASKDRMVHSNREDRNLVGENLAMSMKQISSYKFSGLGATVFWYSEIRDCDFELGNRERNLMKTGHFTQVIWKDTKKAGFGRARNAESDCWYIVGRYFPSGNCFDNYNENVFPLKENQRWDTLPIVELYLQELQTTEFTNARRHVLDGWKAEFVNSVKNGSHTYDVIESFTTPNGDKYIGKTSFSEDPTKTPRPIFKKFFEDC 255          

HSP 2 Score: 55.8398 bits (133), Expect = 1.965e-8
Identity = 49/153 (32.03%), Postives = 80/153 (52.29%), Query Frame = 3
Query:  897 EIKSFIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGNVTEESAKALVDS--WYNEGRNYNYR--KEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXES-FIVCFYSPAGNTKNEFSQNV 1340
            E+  F    +  HN  RR HN   L    QL+  AQ +AD +A +++M  SN    N+ +GEN+      ++      L  +  WY+E R+ ++       N    GHFTQ++WK +KK G G  +N++ +  +IV  Y P+GN  + +++NV
Sbjct:   12 EMDEFNCECLDAHNGLRRFHNSPPLEYCKQLSREAQKYADFIASKDRMVHSNREDRNL-VGENLAMSMKQISSYKFSGLGATVFWYSEIRDCDFELGNRERNLMKTGHFTQVIWKDTKKAGFGRARNAESDCWYIVGRYFPSGNCFDNYNENV 163          
BLAST of Venom allergen 5 vs. Planmine SMEST
Match: SMESG000005601.1 (SMESG000005601.1)

HSP 1 Score: 286.574 bits (732), Expect = 5.914e-94
Identity = 139/246 (56.50%), Postives = 179/246 (72.76%), Query Frame = 3
Query:   87 MSELEDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFVGKYLENVPPLPRGQKWDKVPIIEEYLDELRTMEYTPARKHILDDWRANWMSGTKAGVSYCDVVEXXXXXXXXXXXGENHFSEDPRKLPRPIFQSQLDDS 824
            ++E+++FN ECL +HNGLR+ HN+PPL Y KQLS +AQ+YA+ IA+KD M HS +EDRN  GENLAMSM+    YK+SGLGA+  WYSEI+D DF    +  N   TGHFTQ+IWK +K+AGFGRA+N  S+CWYIVGRY P+GN    Y ENV PL   Q+WD +PI+E YL EL+T E+T AR+H+LD W+A +++  K G    DV+E+FTTP G  Y G+  FSEDP K PRPIF+   +D 
Sbjct:   12 ITEMDEFNCECLDAHNGLRRFHNSPPLEYCKQLSREAQKYADFIASKDRMVHSNREDRNLVGENLAMSMKQISSYKFSGLGATVFWYSEIRDCDFELGNRERNLMKTGHFTQVIWKDTKKAGFGRARNAESDCWYIVGRYFPSGNCFDNYNENVFPLKENQRWDTLPIVELYLQELQTTEFTNARRHVLDGWKAEFVNSVKNGSHTYDVIESFTTPNGDKYIGKTSFSEDPTKTPRPIFKKFFEDC 257          

HSP 2 Score: 55.8398 bits (133), Expect = 2.205e-8
Identity = 49/153 (32.03%), Postives = 80/153 (52.29%), Query Frame = 3
Query:  897 EIKSFIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGNVTEESAKALVDS--WYNEGRNYNYR--KEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXES-FIVCFYSPAGNTKNEFSQNV 1340
            E+  F    +  HN  RR HN   L    QL+  AQ +AD +A +++M  SN    N+ +GEN+      ++      L  +  WY+E R+ ++       N    GHFTQ++WK +KK G G  +N++ +  +IV  Y P+GN  + +++NV
Sbjct:   14 EMDEFNCECLDAHNGLRRFHNSPPLEYCKQLSREAQKYADFIASKDRMVHSNREDRNL-VGENLAMSMKQISSYKFSGLGATVFWYSEIRDCDFELGNRERNLMKTGHFTQVIWKDTKKAGFGRARNAESDCWYIVGRYFPSGNCFDNYNENV 165          
BLAST of Venom allergen 5 vs. Planmine SMEST
Match: SMESG000070308.1 (SMESG000070308.1)

HSP 1 Score: 275.789 bits (704), Expect = 1.876e-88
Identity = 151/357 (42.30%), Postives = 222/357 (62.18%), Query Frame = 3
Query:   87 MSELEDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFVGKYLENVPPLPRGQKWDKVPIIEEYLDELRTMEYTPARKHILDDWRANWMSGT-KAGVSYCDVVEXXXXXXXXXXXGENHFSEDPRKLPRPIFQSQL--DDSVYDLGDDQLNGYASDKDS-------DKGENEEIKSFIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGNVTEESAK 1127
            M ELE FN ECL++HNGLRK H    L + K+L+++AQ+YA+LIA       SK E  N  GEN++ S++ FV+Y YSGLGA+ +WY EI++Y+FN E Q   N +T +FTQL+WK SK+AGFGRA+NP +N WYIVGRY P GN  G + ENVPPL    KW+ V I+EEYL+EL+  E++ AR+H+LD +    ++ T   G     V ET+ +  G  Y     F  +  KLPRP+F+  L  ++ + ++   +   + ++  S       +  +  E++ F ++V+ +HN YR+N+ V  L+ D++L   AQ WAD L     + FS+Y F+   +GENI  K G++T ES +
Sbjct:    1 MQELEQFNQECLYAHNGLRKSHGVSSLIFDKKLAIEAQKYAQLIAETKTFHRSKPETGNSYGENISQSVKGFVNYVYSGLGATVNWYCEIRNYNFNSENQTTAN-STENFTQLVWKDSKKAGFGRARNPINNIWYIVGRYYPQGNVKGSFRENVPPLISRIKWENVSIVEEYLEELQLWEFSKARRHVLDSYVFAVITLTNNKGFL---VKETYKSLNGDIYYESQIFDTNITKLPRPMFEDLLSPNELIANIYSQKKEIFGTNDKSPLNLIKNEYLQQTEVELFKKSVLERHNLYRKNYGVQKLSFDDELCKCAQKWADHLRDGYYIGFSHYKFKGSDIGENIAMKSGSLTIESGE 353          

HSP 2 Score: 51.9878 bits (123), Expect = 5.174e-7
Identity = 55/153 (35.95%), Postives = 77/153 (50.33%), Query Frame = 3
Query:  894 EEIKSFIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENIT-TKKGNVTEE-SAKALVDSWYNEGRNYNYRKE-PDNFKSVGHFTQLLWXXXXXXXXXXXXXXXXES-FIVCFYSPAGNTKNEFSQNV 1340
            +E++ F +  +  HN  R++H V++L  D +L   AQ +A +L  E K    +        GENI+ + KG V    S      +WY E RNYN+  E      S  +FTQL+WK SKK G G  +N      +IV  Y P GN K  F +NV
Sbjct:    2 QELEQFNQECLYAHNGLRKSHGVSSLIFDKKLAIEAQKYA-QLIAETKTFHRSKPETGNSYGENISQSVKGFVNYVYSGLGATVNWYCEIRNYNFNSENQTTANSTENFTQLVWKDSKKAGFGRARNPINNIWYIVGRYYPQGNVKGSFRENV 153          
BLAST of Venom allergen 5 vs. Planmine SMEST
Match: SMESG000036937.1 (SMESG000036937.1)

HSP 1 Score: 178.718 bits (452), Expect = 3.064e-51
Identity = 132/426 (30.99%), Postives = 201/426 (47.18%), Query Frame = 3
Query:   93 ELEDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFVGKYLENVPPLPRGQKWD------KVPIIEEYLDELRTMEYTPARKHILDDWRANWMSGTKAGVSYCDVVEXXXXXXXXXXXGENHFSEDPRKLPRPIFQSQLDDSVYDLGDDQLNGYASDKDSDKGENEEIKSFIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGN-VTEESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWXXXXXXXXXXXXXXX---XESFIVCFYSPAGNTKNEFSQNV 1340
            E ++F  ECL  HN  R  H  PPLR+S  L   AQ +AE +   D + +S    + + GEN++M      +   SG+  S  WY + K+YDF K + P      G+FTQ++W+ ++E GFG A +    C  +VG Y+P GN  G Y++NV PL  G   +      K+PI              P +K             T+   S    +        S+ + ++HF    + LP                DD L          K E  +++ FI   V   N YR  H V  L  + +L+  AQ WA+EL  ++ +S SN  ++   +GENI ++  N   + +A  + D WY E   ++Y KEP N + +G+FTQ++WK +K+IG+G    +K       +VC Y PAGN   +F +NV
Sbjct:    2 ERQEFIDECLREHNKYRNLHGVPPLRHSIHLDKTAQEWAEDLVNSDSLRNSSVSSKGEVGENISMRKSTSPNVTLSGVDVSKQWYDDSKNYDFIKGSGP-----AGNFTQMVWRSTEEVGFGIA-HVKGKC-IVVGHYKPPGNVKGNYIDNVMPLLSGDNINSSNQEAKIPI----------QCSVPVKKQ------------TELDKSLSVFMAPLAHSRSSSVSSDDHFELQLQALP----------------DDVL----------KAEKRQLRQFIRDTVRSINRYRIKHGVLKLKHNKELDNLAQAWAEELVQKSTLSNSNNSYKGDRVGENIASRWSNGKCDYTADQVADHWYVESSKFSYEKEPPNVQGIGNFTQMIWKSTKEIGIGKAFLTKDNDTRVIVVCNYYPAGNVLRKFLENV 372          

HSP 2 Score: 81.2629 bits (199), Expect = 1.703e-16
Identity = 57/159 (35.85%), Postives = 82/159 (51.57%), Query Frame = 3
Query:   93 ELEDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRND-AGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSN--CWYIVGRYQPAGNFVGKYLENV-PPL 557
            +L  F  + + S N  R +H    L+++K+L   AQ +AE +  K  + +S    + D  GEN+A S        Y+    +  WY E   + + KE  PPN    G+FTQ+IWK +KE G G+A     N     +V  Y PAGN + K+LENV PPL
Sbjct:  221 QLRQFIRDTVRSINRYRIKHGVLKLKHNKELDNLAQAWAEELVQKSTLSNSNNSYKGDRVGENIA-SRWSNGKCDYTADQVADHWYVESSKFSYEKE--PPNVQGIGNFTQMIWKSTKEIGIGKAFLTKDNDTRVIVVCNYYPAGNVLRKFLENVKPPL 376          
The following BLAST results are available for this feature:
BLAST of Venom allergen 5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GLIPR21.959e-2838.75GLI pathogenesis related 2 [Source:HGNC Symbol;Acc... [more]
GLIPR21.072e-1834.39GLI pathogenesis related 2 [Source:HGNC Symbol;Acc... [more]
CRISP21.948e-1435.62cysteine rich secretory protein 2 [Source:HGNC Sym... [more]
CRISP21.948e-1435.62cysteine rich secretory protein 2 [Source:HGNC Sym... [more]
CRISP27.584e-1334.72cysteine rich secretory protein 2 [Source:HGNC Sym... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
C07A4.31.032e-1337.07pep chromosome:WBcel235:X:10174985:10175896:1 gene... [more]
F57B7.21.988e-1129.94pep chromosome:WBcel235:V:11441925:11443484:-1 gen... [more]
F57B7.23.324e-1129.38pep chromosome:WBcel235:V:11441925:11443603:-1 gen... [more]
F09B9.56.335e-1134.23pep chromosome:WBcel235:X:10154821:10156856:1 gene... [more]
D2062.16.547e-1032.81pep chromosome:WBcel235:II:2631473:2633054:1 gene:... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG314825.428e-2535.80gene:FBgn0051482 transcript:FBtr0081679[more]
CG169951.953e-1636.18gene:FBgn0031412 transcript:FBtr0077758[more]
CG42703.914e-1634.87gene:FBgn0031407 transcript:FBtr0077754[more]
CG340491.034e-1536.73gene:FBgn0054049 transcript:FBtr0302372[more]
CG42706.090e-1034.15gene:FBgn0031407 transcript:FBtr0077755[more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glipr2l3.417e-2939.51GLI pathogenesis-related 2, like [Source:ZFIN;Acc:... [more]
im:71509887.895e-2943.79im:7150988 [Source:ZFIN;Acc:ZDB-GENE-050309-169][more]
im:71509887.895e-2943.79im:7150988 [Source:ZFIN;Acc:ZDB-GENE-050309-169][more]
AL929549.22.904e-2741.88pep chromosome:GRCz11:CHR_ALT_CTG5_1_26:33034715:3... [more]
CR855258.33.417e-2741.36pep chromosome:GRCz11:CHR_ALT_CTG5_2_7:33042518:33... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
echdc11.998e-2943.45ethylmalonyl-CoA decarboxylase 1 [Source:Xenbase;A... [more]
trappc34.521e-2930.34trafficking protein particle complex 3 [Source:Xen... [more]
trappc31.385e-2037.13trafficking protein particle complex 3 [Source:Xen... [more]
ENSXETT00000021732.18.612e-731.30pep primary_assembly:Xenopus_tropicalis_v9.1:5:144... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Glipr26.181e-3140.00GLI pathogenesis-related 2 [Source:MGI Symbol;Acc:... [more]
Glipr21.265e-1345.68GLI pathogenesis-related 2 [Source:MGI Symbol;Acc:... [more]
Crisp23.650e-1235.33cysteine-rich secretory protein 2 [Source:MGI Symb... [more]
Crisp23.650e-1235.33cysteine-rich secretory protein 2 [Source:MGI Symb... [more]
Crisp23.650e-1235.33cysteine-rich secretory protein 2 [Source:MGI Symb... [more]
back to top
BLAST of Venom allergen 5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9CYL5|GAPR1_MOUSE4.323e-3040.00Golgi-associated plant pathogenesis-related protei... [more]
sp|Q9H4G4|GAPR1_HUMAN9.407e-2838.75Golgi-associated plant pathogenesis-related protei... [more]
sp|P47033|PRY3_YEAST3.751e-1634.12Cell wall protein PRY3 OS=Saccharomyces cerevisiae... [more]
sp|P36110|PRY2_YEAST2.566e-1533.33Protein PRY2 OS=Saccharomyces cerevisiae (strain A... [more]
sp|P47032|PRY1_YEAST3.228e-1536.24Protein PRY1 OS=Saccharomyces cerevisiae (strain A... [more]
back to top
BLAST of Venom allergen 5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S8X1T71.261e-5231.31SCP-like protein OS=Opisthorchis viverrini OX=6198... [more]
A0A2H1C4H41.452e-5130.41Golgi-associated plant pathogenesis protein 1 OS=F... [more]
A0A504Z2043.760e-5130.18Golgi-associated plant pathogenesis protein 1 OS=F... [more]
A0A4S2LPW34.303e-5131.07Uncharacterized protein OS=Opisthorchis felineus O... [more]
G7Y5C02.130e-5031.16Golgi-associated plant pathogenesis-related protei... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glipr2l1.594e-2941.36GLI pathogenesis related 2 [Source:NCBI gene;Acc:1... [more]
glipr2l1.594e-2941.36GLI pathogenesis related 2 [Source:NCBI gene;Acc:1... [more]
ENSAMXT00000046499.12.480e-2638.82pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000037136.16.209e-2638.55pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000051775.14.497e-2539.33pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002228.13.377e-1534.06pep scaffold:Pmarinus_7.0:GL477414:68597:85540:-1 ... [more]
ENSPMAT00000002231.11.001e-1332.21pep scaffold:Pmarinus_7.0:GL477414:68597:85459:-1 ... [more]
glipr2l1.424e-1033.70GLI pathogenesis-related 2, like [Source:ZFIN;Acc:... [more]
ENSPMAT00000002224.13.009e-1030.52pep scaffold:Pmarinus_7.0:GL477414:68570:72489:-1 ... [more]
CRISP31.482e-728.57cysteine rich secretory protein 3 [Source:HGNC Sym... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
PRY35.402e-1834.12Cell wall-associated protein involved in export of... [more]
PRY23.695e-1733.33Sterol binding protein involved in the export of a... [more]
PRY14.648e-1736.24Sterol binding protein involved in the export of a... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO486636.653e-4049.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO353831.949e-3141.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO347204.786e-3144.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405452.766e-3041.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO488802.834e-3042.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000020413.24.973e-2742.58Golgi-associated plant pathogenesis-related protei... [more]
ENSORLT00000028427.14.973e-2742.58Golgi-associated plant pathogenesis-related protei... [more]
ENSORLT00000043877.15.545e-2742.58Golgi-associated plant pathogenesis-related protei... [more]
glipr2l7.531e-2737.50GLI pathogenesis related 2 [Source:NCBI gene;Acc:1... [more]
ENSORLT00000031186.15.922e-2440.52Golgi-associated plant pathogenesis-related protei... [more]
back to top
BLAST of Venom allergen 5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005602.10.000e+099.76SMESG000005602.1[more]
SMESG000005601.14.411e-9456.50SMESG000005601.1[more]
SMESG000005601.15.914e-9456.50SMESG000005601.1[more]
SMESG000070308.11.876e-8842.30SMESG000070308.1[more]
SMESG000036937.13.064e-5130.99SMESG000036937.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016401 ID=SMED30016401|Name=Venom allergen 5|organism=Schmidtea mediterranea sexual|type=transcript|length=1445bp
TAAAATAGTAAAATAATTATGTGAGTAGGCTGCATATAAAAGCGATTTAT
TGTTAGTAGTTTTTAGAATTTTTAATTGGATTAAAAATGTCAGAATTAGA
GGATTTTAATTACGAATGTTTACATTCACATAATGGCTTGCGTAAAGAAC
ACAATGCCCCTCCACTGAGATATAGCAAACAGTTGAGTTTGGATGCTCAA
AGGTATGCTGAGCTGATAGCAGCGAAAGATGAAATGGAACACAGTAAAAA
GGAAGATCGTAACGATGCTGGTGAAAATCTAGCTATGAGCATGAGGCCGT
TTGTAGACTATAAATATTCCGGATTAGGAGCAAGTGCTAGCTGGTATTCA
GAAATTAAGGATTATGATTTTAACAAAGAAGCCCAGCCACCAAACAATCC
AGCGACAGGACATTTTACTCAATTGATTTGGAAAGGTTCTAAAGAAGCCG
GTTTTGGTCGAGCGAAAAACCCTACATCAAATTGTTGGTACATTGTTGGA
AGATATCAACCCGCTGGAAACTTTGTTGGAAAATATTTAGAAAATGTTCC
CCCGTTGCCTAGAGGACAGAAATGGGATAAAGTGCCGATTATTGAAGAAT
ATCTCGATGAACTGCGAACGATGGAATACACTCCAGCAAGAAAACACATT
CTAGATGATTGGAGAGCCAACTGGATGTCGGGAACAAAAGCTGGTGTTTC
CTACTGTGATGTTGTTGAAACCTTTACAACGCCAACTGGGTCGACATATA
CGGGAGAAAATCATTTTTCCGAAGATCCAAGAAAATTGCCAAGACCAATT
TTTCAAAGTCAATTGGATGACAGCGTTTATGATCTTGGTGATGATCAACT
GAATGGATATGCCAGTGACAAAGATTCAGATAAAGGAGAAAACGAAGAAA
TTAAAAGTTTCATTGAAGCAGTTGTATCTCAGCATAATTATTATCGAAGG
AATCATAATGTAGCAACTTTGAATTTGGACAACCAACTAAATACTTATGC
TCAAGACTGGGCTGATGAATTGGCGTTAGAAAATAAAATGTCCTTTAGTA
ATTATTTATTTGAAAATGTACCCTTAGGTGAAAATATTACTACGAAAAAA
GGAAATGTCACAGAAGAGTCAGCCAAAGCTCTTGTTGACAGCTGGTATAA
TGAAGGAAGAAATTACAATTATAGAAAAGAACCCGACAACTTCAAGAGTG
TTGGACATTTTACTCAATTGTTGTGGAAAAAGTCCAAGAAAATTGGAGTC
GGAGTGGGAAAGAATTCAAAAGGAGAATCTTTTATTGTTTGTTTTTATAG
TCCCGCAGGAAATACTAAAAATGAATTTTCTCAAAATGTTTTAAAATCAT
GAAAATTGAAACAAAAATTTATGCAACAATAATTGCCTTGCTTTGATTTA
TTTGAATTGAAATTATGATTTTTATTAAATTGTGTATTGTAAAAA
back to top

protein sequence of SMED30016401-orf-1

>SMED30016401-orf-1 ID=SMED30016401-orf-1|Name=SMED30016401-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=422bp
MSELEDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEM
EHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQ
PPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFVGKY
LENVPPLPRGQKWDKVPIIEEYLDELRTMEYTPARKHILDDWRANWMSGT
KAGVSYCDVVETFTTPTGSTYTGENHFSEDPRKLPRPIFQSQLDDSVYDL
GDDQLNGYASDKDSDKGENEEIKSFIEAVVSQHNYYRRNHNVATLNLDNQ
LNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGNVTEESAKALV
DSWYNEGRNYNYRKEPDNFKSVGHFTQLLWKKSKKIGVGVGKNSKGESFI
VCFYSPAGNTKNEFSQNVLKS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR035940CAP_sf
IPR034113SCP_GAPR1-like
IPR002413V5_allergen-like
IPR001283CRISP-related
IPR014044CAP_domain
IPR018244Allrgn_V5/Tpx1_CS
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002413Venom allergen 5-likePRINTSPR00838V5ALLERGENcoord: 347..362
score: 33.59
coord: 371..390
score: 49.38
coord: 295..313
score: 33.88
IPR001283Cysteine-rich secretory protein-relatedPRINTSPR00837V5TPXLIKEcoord: 399..412
score: 47.82
coord: 372..388
score: 45.45
coord: 295..313
score: 29.42
coord: 349..362
score: 34.06
IPR001283Cysteine-rich secretory protein-relatedPANTHERPTHR10334CYSTEINE-RICH SECRETORY PROTEIN-RELATEDcoord: 2..155
coord: 266..419
IPR014044CAP domainSMARTSM00198SCP_3coord: 274..412
e-value: 2.1E-31
score: 120.3
coord: 6..148
e-value: 2.1E-24
score: 97.0
IPR014044CAP domainPFAMPF00188CAPcoord: 13..133
e-value: 1.8E-16
score: 61.1
coord: 281..402
e-value: 8.7E-24
score: 84.8
IPR035940CAP superfamilyGENE3DG3DSA:3.40.33.10coord: 2..158
e-value: 8.5E-39
score: 135.1
coord: 269..421
e-value: 6.8E-40
score: 138.7
IPR035940CAP superfamilySUPERFAMILYSSF55797PR-1-likecoord: 273..415
IPR035940CAP superfamilySUPERFAMILYSSF55797PR-1-likecoord: 6..155
NoneNo IPR availablePANTHERPTHR10334:SF386GOLGI-ASSOCIATED PLANT PATHOGENESIS-RELATED PROTEIN 1coord: 2..155
coord: 266..419
IPR018244Allergen V5/Tpx-1-related, conserved sitePROSITEPS01009CRISP_1coord: 108..118
IPR018244Allergen V5/Tpx-1-related, conserved sitePROSITEPS01009CRISP_1coord: 373..383
IPR034113Golgi-associated plant pathogenesis-related protein 1, SCP domainCDDcd05382CAP_GAPR1-likecoord: 274..409
e-value: 1.23509E-45
score: 152.369
IPR034113Golgi-associated plant pathogenesis-related protein 1, SCP domainCDDcd05382CAP_GAPR1-likecoord: 6..146
e-value: 3.09326E-54
score: 174.711