Voltage-gated hydrogen channel 1

Overview
NameVoltage-gated hydrogen channel 1
Smed IDSMED30016391
Length (bp)2459
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Voltage-gated hydrogen channel 1 (SMED30016391) t-SNE clustered cells

Violin plots show distribution of expression levels for Voltage-gated hydrogen channel 1 (SMED30016391) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Voltage-gated hydrogen channel 1 (SMED30016391) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Voltage-gated hydrogen channel 1 (SMED30016391) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016391

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30016391SMESG000002770.1 SmedASXL_010244SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30016391SMESG000002770.1 dd_Smed_v4_16233_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30016391SMESG000002770.1 dd_Smed_v6_16233_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30016391SMESG000002770.1 OX_Smed_1.0.13201ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
enteric muscle cellSMED30016391SMESG000002770.1 dd_Smed_v4_16233_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Human
Match: HVCN1 (hydrogen voltage gated channel 1 [Source:HGNC Symbol;Acc:HGNC:28240])

HSP 1 Score: 65.4698 bits (158), Expect = 4.861e-11
Identity = 37/107 (34.58%), Postives = 63/107 (58.88%), Query Frame = 2
Query:  893 GMYLHYISIGILVVFMIELILRILCIGERFFKKKVEMFDGTIIVTSFMADII--FVQLKSDQISVMVVFLLWRIVRLINGLMMHEKQRDEFRITLQKKTRRMCQMKV 1207
             M  HY+SI ILV FM+E+I ++      FF  K E+ D  ++V SF+ DI+  F + + + + ++++  LWR+ R+ING+++  K R E      ++  R+ QM V
Sbjct:  136 AMVFHYMSITILVFFMMEIIFKLFVFRLEFFHHKFEILDAVVVVVSFILDIVLLFQEHQFEALGLLILLRLWRVARIINGIIISVKTRSE------RQLLRLKQMNV 236          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Human
Match: HVCN1 (hydrogen voltage gated channel 1 [Source:HGNC Symbol;Acc:HGNC:28240])

HSP 1 Score: 65.4698 bits (158), Expect = 5.833e-11
Identity = 37/107 (34.58%), Postives = 63/107 (58.88%), Query Frame = 2
Query:  893 GMYLHYISIGILVVFMIELILRILCIGERFFKKKVEMFDGTIIVTSFMADII--FVQLKSDQISVMVVFLLWRIVRLINGLMMHEKQRDEFRITLQKKTRRMCQMKV 1207
             M  HY+SI ILV FM+E+I ++      FF  K E+ D  ++V SF+ DI+  F + + + + ++++  LWR+ R+ING+++  K R E      ++  R+ QM V
Sbjct:  136 AMVFHYMSITILVFFMMEIIFKLFVFRLEFFHHKFEILDAVVVVVSFILDIVLLFQEHQFEALGLLILLRLWRVARIINGIIISVKTRSE------RQLLRLKQMNV 236          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Human
Match: HVCN1 (hydrogen voltage gated channel 1 [Source:HGNC Symbol;Acc:HGNC:28240])

HSP 1 Score: 65.4698 bits (158), Expect = 5.833e-11
Identity = 37/107 (34.58%), Postives = 63/107 (58.88%), Query Frame = 2
Query:  893 GMYLHYISIGILVVFMIELILRILCIGERFFKKKVEMFDGTIIVTSFMADII--FVQLKSDQISVMVVFLLWRIVRLINGLMMHEKQRDEFRITLQKKTRRMCQMKV 1207
             M  HY+SI ILV FM+E+I ++      FF  K E+ D  ++V SF+ DI+  F + + + + ++++  LWR+ R+ING+++  K R E      ++  R+ QM V
Sbjct:  136 AMVFHYMSITILVFFMMEIIFKLFVFRLEFFHHKFEILDAVVVVVSFILDIVLLFQEHQFEALGLLILLRLWRVARIINGIIISVKTRSE------RQLLRLKQMNV 236          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Human
Match: HVCN1 (hydrogen voltage gated channel 1 [Source:HGNC Symbol;Acc:HGNC:28240])

HSP 1 Score: 65.4698 bits (158), Expect = 5.833e-11
Identity = 37/107 (34.58%), Postives = 63/107 (58.88%), Query Frame = 2
Query:  893 GMYLHYISIGILVVFMIELILRILCIGERFFKKKVEMFDGTIIVTSFMADII--FVQLKSDQISVMVVFLLWRIVRLINGLMMHEKQRDEFRITLQKKTRRMCQMKV 1207
             M  HY+SI ILV FM+E+I ++      FF  K E+ D  ++V SF+ DI+  F + + + + ++++  LWR+ R+ING+++  K R E      ++  R+ QM V
Sbjct:  136 AMVFHYMSITILVFFMMEIIFKLFVFRLEFFHHKFEILDAVVVVVSFILDIVLLFQEHQFEALGLLILLRLWRVARIINGIIISVKTRSE------RQLLRLKQMNV 236          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Human
Match: HVCN1 (hydrogen voltage gated channel 1 [Source:HGNC Symbol;Acc:HGNC:28240])

HSP 1 Score: 65.0846 bits (157), Expect = 6.800e-11
Identity = 37/107 (34.58%), Postives = 63/107 (58.88%), Query Frame = 2
Query:  893 GMYLHYISIGILVVFMIELILRILCIGERFFKKKVEMFDGTIIVTSFMADII--FVQLKSDQISVMVVFLLWRIVRLINGLMMHEKQRDEFRITLQKKTRRMCQMKV 1207
             M  HY+SI ILV FM+E+I ++      FF  K E+ D  ++V SF+ DI+  F + + + + ++++  LWR+ R+ING+++  K R E      ++  R+ QM V
Sbjct:  116 AMVFHYMSITILVFFMMEIIFKLFVFRLEFFHHKFEILDAVVVVVSFILDIVLLFQEHQFEALGLLILLRLWRVARIINGIIISVKTRSE------RQLLRLKQMNV 216          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Zebrafish
Match: hvcn1 (hydrogen voltage-gated channel 1 [Source:NCBI gene;Acc:436618])

HSP 1 Score: 70.8626 bits (172), Expect = 3.941e-13
Identity = 31/90 (34.44%), Postives = 55/90 (61.11%), Query Frame = 2
Query:  902 LHYISIGILVVFMIELILRILCIGERFFKKKVEMFDGTIIVTSFMADIIFVQLKS--DQISVMVVFLLWRIVRLINGLMMHEKQRDEFRI 1165
             HY+S+ +L  FM+EL  +I      F   K E+FDG ++V SF+ DII++  +   D + ++++  LWR+ R+ING+++  + R   R+
Sbjct:  104 FHYLSLALLTFFMVELAGKIFAYRLEFLHHKFEVFDGIVVVVSFILDIIYISKEDAFDAMGLLILLRLWRVARIINGILVSVQNRANHRV 193          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Zebrafish
Match: tmem266 (transmembrane protein 266 [Source:ZFIN;Acc:ZDB-GENE-070112-2382])

HSP 1 Score: 61.2326 bits (147), Expect = 3.057e-9
Identity = 34/118 (28.81%), Postives = 68/118 (57.63%), Query Frame = 2
Query:  887 EIGMYLHYISIGILVVFMIELILRILCIG-ERFFKKKVEMFDGTIIVTSFMADIIFVQLKS------DQISVMVVFLLWRIVRLINGLMMHEKQRDEFRITLQKKTRRMCQMKVDRLS 1219
            +    +H+IS+ IL VF  E + RI+ +G   + + KVE+FDG +IV S +A ++   + +      D IS+++   +WR+ R+I+  ++  K   E  I   +K++ + + +++RL+
Sbjct:  128 QFACIIHWISLVILSVFFTETVFRIVVLGIWDYIENKVEVFDGAVIVLS-LAPMVASTVANGPSSPWDAISLIITLRIWRVKRIIDAYVLQVKVEMELEIQQYEKSKAVREEQLERLT 244          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Xenopus
Match: hvcn1 (hydrogen voltage gated channel 1 [Source:NCBI gene;Acc:496712])

HSP 1 Score: 68.1662 bits (165), Expect = 3.826e-12
Identity = 38/133 (28.57%), Postives = 70/133 (52.63%), Query Frame = 2
Query:  884 HEIGMYLHYISIGILVVFMIELILRILCIGERFFKKKVEMFDGTIIVTSFMADIIFVQLKS--DQISVMVVFLLWRIVRLINGLMMHEKQRDEFRITLQKKTRRMCQMKVDRLSTEKELLTKHVLTLEELCKE 1276
            H I    HY+SI +L  F++E+  ++      FF  K E+FD  I+V SF+ DI+++  +   + + ++++  LWR+ R++NG+++  K + E               K+ RL   +E L + V  LE+ C +
Sbjct:   91 HIIPEIFHYLSISVLSFFILEIAGKLYAFRLEFFHHKFEVFDAAIVVISFIIDIVYISREDIFNAVGLLILLRLWRVARIVNGIIVSVKTQAE--------------DKIHRLKENQESLLEKVAHLEQQCAQ 209          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Xenopus
Match: hvcn1 (hydrogen voltage gated channel 1 [Source:NCBI gene;Acc:496712])

HSP 1 Score: 65.4698 bits (158), Expect = 3.331e-11
Identity = 36/133 (27.07%), Postives = 73/133 (54.89%), Query Frame = 2
Query:  884 HEIGMYLHYISIGILVVFMIELILRILCIGERFFKKKVEMFDGTIIVTSFMADIIFVQLKS--DQISVMVVFLLWRIVRLINGLMMHEKQRDEFRITLQKKTRRMCQMKVDRLSTEKELLTKHVLTLEELCKE 1276
            H I    HY+SI +L  F++E+  ++      FF  K E+FD  I+V SF+ DI+++  +   + + ++++  LWR+ R++NG+++  K + E +I   K+ +     KV  L  +     + ++ L+ L ++
Sbjct:   91 HIIPEIFHYLSISVLSFFILEIAGKLYAFRLEFFHHKFEVFDAAIVVISFIIDIVYISREDIFNAVGLLILLRLWRVARIVNGIIVSVKTQAEDKIHRLKENQESLLEKVAHLEQQCAQQEQEIVRLQTLLQQ 223          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Xenopus
Match: mcf2l2 (MCF.2 cell line derived transforming sequence-like 2 [Source:Xenbase;Acc:XB-GENE-6037884])

HSP 1 Score: 53.5286 bits (127), Expect = 1.196e-6
Identity = 31/113 (27.43%), Postives = 65/113 (57.52%), Query Frame = 2
Query:  902 LHYISIGILVVFMIELILRILCIG-ERFFKKKVEMFDGTIIVTSFMADIIFVQLKS------DQISVMVVFLLWRIVRLINGLMMHEKQRDEFRITLQKKTRRMCQMKVDRLS 1219
            +H+IS+ IL +F +E +LRI+ +G   + + KVE+ DG +IV S +A ++   + +      D IS+ +   +WR+ R+I+  ++  K   E  +   +K + + + +++ L+
Sbjct:   77 IHWISLAILSMFFVETVLRIVILGIWDYIENKVEVIDGAVIVLS-LAPMVASTVANGPSSPWDAISLFISLRIWRVKRIIDAYILPVKVEMEILVQQYEKAKLIQEEQMEHLT 188          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Mouse
Match: Hvcn1 (hydrogen voltage-gated channel 1 [Source:MGI Symbol;Acc:MGI:1921346])

HSP 1 Score: 61.6178 bits (148), Expect = 9.181e-10
Identity = 38/116 (32.76%), Postives = 61/116 (52.59%), Query Frame = 2
Query:  902 LHYISIGILVVFMIELILRILCIGERFFKKKVEMFDGTIIVTSFMADIIFVQLKSDQISV---MVVFLLWRIVRLINGLMMHEKQRDEFRITLQKKTRRMCQMKVDRL---STEKE 1231
             HY+S  ILV FM+E+  +I      FF  K E+ D  ++V SF+ D++ +  KS        +++  LWR+ R+ING+++  K R E +I   K+       K+  L    +EKE
Sbjct:  135 FHYMSFAILVFFMLEIFFKIFVFRLEFFHHKFEILDAFVVVVSFVLDLVLL-FKSHHFEALGLLILLRLWRVARIINGIIISVKTRSERQILRLKQINIQLATKIQHLEFSCSEKE 249          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Mouse
Match: Hvcn1 (hydrogen voltage-gated channel 1 [Source:MGI Symbol;Acc:MGI:1921346])

HSP 1 Score: 61.6178 bits (148), Expect = 9.181e-10
Identity = 38/116 (32.76%), Postives = 61/116 (52.59%), Query Frame = 2
Query:  902 LHYISIGILVVFMIELILRILCIGERFFKKKVEMFDGTIIVTSFMADIIFVQLKSDQISV---MVVFLLWRIVRLINGLMMHEKQRDEFRITLQKKTRRMCQMKVDRL---STEKE 1231
             HY+S  ILV FM+E+  +I      FF  K E+ D  ++V SF+ D++ +  KS        +++  LWR+ R+ING+++  K R E +I   K+       K+  L    +EKE
Sbjct:  135 FHYMSFAILVFFMLEIFFKIFVFRLEFFHHKFEILDAFVVVVSFVLDLVLL-FKSHHFEALGLLILLRLWRVARIINGIIISVKTRSERQILRLKQINIQLATKIQHLEFSCSEKE 249          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Mouse
Match: Tmem266 (transmembrane protein 266 [Source:MGI Symbol;Acc:MGI:2142980])

HSP 1 Score: 60.077 bits (144), Expect = 8.440e-9
Identity = 39/140 (27.86%), Postives = 75/140 (53.57%), Query Frame = 2
Query:  902 LHYISIGILVVFMIELILRILCIG-ERFFKKKVEMFDGTIIVTSF---MADIIFVQLKS--DQISVMVVFLLWRIVRLINGLMMHEKQRDEFRITLQKKTRRMCQMKVDRLSTEKELLTKHVLTLEELCKELGANEDQLK 1303
            +H+IS+ IL VF  E +LRI+ +G   + + K+E+FDG +I+ S    +A  +    +S  D IS++++F +WR+ R+I+  ++  K   E      +K + +   +++RL+              ++C+E G    QL+
Sbjct:  138 IHWISLVILSVFFSETVLRIVVLGIWDYIENKIEVFDGAVIILSLAPMVASTVANGPRSPWDAISLIIMFRIWRVKRVIDAYVLPVKLEMEMVTQQYEKAKAIQDEQLERLT--------------QICQEQGFEIRQLR 263          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Mouse
Match: Tmem266 (transmembrane protein 266 [Source:MGI Symbol;Acc:MGI:2142980])

HSP 1 Score: 55.8398 bits (133), Expect = 7.563e-8
Identity = 38/141 (26.95%), Postives = 76/141 (53.90%), Query Frame = 2
Query:  902 LHYISIGILVVFMIELILRILCIG-ERFFKKKVEMFDGTIIVTSFMADIIFVQLKS------DQISVMVVFLLWRIVRLINGLMMHEKQRDEFRITLQKKTRRMCQMKVDRLSTEKELLTKHVLTLEELCKELGANEDQLK 1303
            +H+IS+ IL VF  E +LRI+ +G   + + K+E+FDG +I+ S +A ++   + +      D IS++++F +WR+ R+I+  ++  K   E      +K + +   +++RL+              ++C+E G    QL+
Sbjct:   73 IHWISLVILSVFFSETVLRIVVLGIWDYIENKIEVFDGAVIILS-LAPMVASTVANGPRSPWDAISLIIMFRIWRVKRVIDAYVLPVKLEMEMVTQQYEKAKAIQDEQLERLT--------------QICQEQGFEIRQLR 198          
BLAST of Voltage-gated hydrogen channel 1 vs. UniProt/SwissProt
Match: sp|Q5F4C0|HVCN1_CHICK (Voltage-gated hydrogen channel 1 OS=Gallus gallus OX=9031 GN=HVCN1 PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 1.583e-12
Identity = 36/115 (31.30%), Postives = 68/115 (59.13%), Query Frame = 2
Query:  902 LHYISIGILVVFMIELILRILCIGERFFKKKVEMFDGTIIVTSFMADII--FVQLKSDQISVMVVFLLWRIVRLINGLMMHEKQRDEFRITLQKKTRRMCQMKVDRLS---TEKE 1231
             HY+S+ IL +F++E+  +I   G  FF  K E+ D  ++V SF+ D++  F + + + + ++++  LWR+ R+ING+++  K R E +++  K+       KV++L     EKE
Sbjct:  101 FHYLSLSILTIFLVEVGFKIFVYGREFFHHKFEVLDSIVVVVSFILDLVLLFREHEFEAVGLLILLRLWRVARIINGIILSVKTRSEQQVSKLKQVNLKLATKVEQLQHSCVEKE 215          
BLAST of Voltage-gated hydrogen channel 1 vs. UniProt/SwissProt
Match: sp|Q6DHQ1|HVCN1_DANRE (Voltage-gated hydrogen channel 1 OS=Danio rerio OX=7955 GN=hvcn1 PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 3.032e-12
Identity = 31/90 (34.44%), Postives = 55/90 (61.11%), Query Frame = 2
Query:  902 LHYISIGILVVFMIELILRILCIGERFFKKKVEMFDGTIIVTSFMADIIFVQLKS--DQISVMVVFLLWRIVRLINGLMMHEKQRDEFRI 1165
             HY+S+ +L  FM+EL  +I      F   K E+FDG ++V SF+ DII++  +   D + ++++  LWR+ R+ING+++  + R   R+
Sbjct:  104 FHYLSLALLTFFMVELAGKIFAYRLEFLHHKFEVFDGIVVVVSFILDIIYISKEDAFDAMGLLILLRLWRVARIINGILVSVQNRANHRV 193          
BLAST of Voltage-gated hydrogen channel 1 vs. UniProt/SwissProt
Match: sp|Q5M7E9|HVCN1_XENLA (Voltage-gated hydrogen channel 1 OS=Xenopus laevis OX=8355 GN=hvcn1 PE=2 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 1.271e-10
Identity = 30/93 (32.26%), Postives = 56/93 (60.22%), Query Frame = 2
Query:  884 HEIGMYLHYISIGILVVFMIELILRILCIGERFFKKKVEMFDGTIIVTSFMADIIFVQLKS--DQISVMVVFLLWRIVRLINGLMMHEKQRDE 1156
            H I    HY+SI +L  F++E+  ++      FF  K E+FD  I+V SF+ DI+++  +   + + ++++  LWR+ R++NG+++  K R E
Sbjct:   91 HIIPEIFHYLSISVLTFFILEIAGKLYAFRLEFFHHKFEVFDAAIVVISFIIDIVYISREDIFNAVGLLILLRLWRVARIVNGVIVSVKTRAE 183          
BLAST of Voltage-gated hydrogen channel 1 vs. UniProt/SwissProt
Match: sp|Q5M8L8|HVCN1_XENTR (Voltage-gated hydrogen channel 1 OS=Xenopus tropicalis OX=8364 GN=hvcn1 PE=2 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 1.765e-10
Identity = 36/133 (27.07%), Postives = 73/133 (54.89%), Query Frame = 2
Query:  884 HEIGMYLHYISIGILVVFMIELILRILCIGERFFKKKVEMFDGTIIVTSFMADIIFVQLKS--DQISVMVVFLLWRIVRLINGLMMHEKQRDEFRITLQKKTRRMCQMKVDRLSTEKELLTKHVLTLEELCKE 1276
            H I    HY+SI +L  F++E+  ++      FF  K E+FD  I+V SF+ DI+++  +   + + ++++  LWR+ R++NG+++  K + E +I   K+ +     KV  L  +     + ++ L+ L ++
Sbjct:   91 HIIPEIFHYLSISVLSFFILEIAGKLYAFRLEFFHHKFEVFDAAIVVISFIIDIVYISREDIFNAVGLLILLRLWRVARIVNGIIVSVKTQAEDKIHRLKENQESLLEKVAHLEQQCAQQEQEIVRLQTLLQQ 223          
BLAST of Voltage-gated hydrogen channel 1 vs. UniProt/SwissProt
Match: sp|Q96D96|HVCN1_HUMAN (Voltage-gated hydrogen channel 1 OS=Homo sapiens OX=9606 GN=HVCN1 PE=1 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 2.801e-10
Identity = 37/107 (34.58%), Postives = 63/107 (58.88%), Query Frame = 2
Query:  893 GMYLHYISIGILVVFMIELILRILCIGERFFKKKVEMFDGTIIVTSFMADII--FVQLKSDQISVMVVFLLWRIVRLINGLMMHEKQRDEFRITLQKKTRRMCQMKV 1207
             M  HY+SI ILV FM+E+I ++      FF  K E+ D  ++V SF+ DI+  F + + + + ++++  LWR+ R+ING+++  K R E      ++  R+ QM V
Sbjct:  136 AMVFHYMSITILVFFMMEIIFKLFVFRLEFFHHKFEILDAVVVVVSFILDIVLLFQEHQFEALGLLILLRLWRVARIINGIIISVKTRSE------RQLLRLKQMNV 236          
BLAST of Voltage-gated hydrogen channel 1 vs. TrEMBL
Match: A0A564Y6F8 (Ion_trans domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS2644 PE=4 SV=1)

HSP 1 Score: 288.115 bits (736), Expect = 1.504e-81
Identity = 169/419 (40.33%), Postives = 241/419 (57.52%), Query Frame = 2
Query:  308 DDY-KYTINIEWLNNKKFIKQLEKDNIDVELLREELTRQHRIKRHYTWREKTLQLIKGNFVQVLLSLLILIDAGIVITEIILE------------IHS------MKNKKEHYEDE-----NVIYKN-FIQTSLNAL--------LNSSKGVTGTHNKKLSLLEIISNISKFH---SKYSLMPLCNLSF-----HLPKPSESQTXXXXXXXXXXXXXXXXKVNSEYTLHRSTLLHEIGMYLHYISIGILVVFMIELILRILCIGERFFKKKVEMFDGTIIVTSFMADIIFVQLKSDQISVMVVFLLWRIVRLINGLMMHEKQRDEFRITLQKKTRRMCQMKVDRLSTEKELLTKHVLTLEELCKELGANEDQLKNCKPRFKKYSKEQTNNALKSIAALTTGFMGGMVGAPSSNQSAINRY 1441
            DDY +Y   + W N+K FIKQL KDNID  LL EEL R    +R  +WR K L   + N  Q+LL +L+LID+GIVITEIILE            IH+      M N+  H+         +I +N  I+TS + L        +        T   +L++LE      + +   ++ + +  CNL       HL   SE Q  +                 SE  L     LH     +HYISIG+  +F++  +L+I+C+G++FF    E+ D  +I+TSF++DI +++L S +I+ MV+ LLWRIVRLIN ++M+E+QR EFR+ LQK+ RR+ + KVD L   KEL  KH+  LEEL + +G +E+ L++CKPR+  +SKEQT NALKSIAALTTGFMGG+VGAP + + +I R+
Sbjct:   46 DDYTRYNYELSWANSKTFIKQLAKDNIDSSLLNEELQRHAENRRRRSWRAKCLGRFRSNIAQILLCILVLIDSGIVITEIILEIRSIQNYKQFFDIHAQRLSYIMANQNFHWTGSWCVPPGIILENKPIETSNDRLHMNQIHRTIIPLGSTASTDEHRLAVLEDFLECWRAYVDNAEKTKLGGCNLDLLQRCIHL-NTSEIQEPE----------------TSERNLTNPATLHRASEAMHYISIGVTGLFIVTTVLKIVCLGKKFFLNVYEVIDALVILTSFISDISYIKLDSQEIAAMVILLLWRIVRLINAMLMYERQRCEFRVVLQKRARRLQERKVDNLQRTKELQEKHITNLEELARNIGCSEETLRDCKPRYVYHSKEQTQNALKSIAALTTGFMGGLVGAPLAQKESIARF 447          
BLAST of Voltage-gated hydrogen channel 1 vs. TrEMBL
Match: A0A158QF49 (Ion_trans domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS8325 PE=4 SV=1)

HSP 1 Score: 286.96 bits (733), Expect = 9.270e-81
Identity = 168/419 (40.10%), Postives = 241/419 (57.52%), Query Frame = 2
Query:  308 DDY-KYTINIEWLNNKKFIKQLEKDNIDVELLREELTRQHRIKRHYTWREKTLQLIKGNFVQVLLSLLILIDAGIVITEIIL------------EIHS------MKNKKEHYEDE-----NVIYKN-FIQTSLNAL--------LNSSKGVTGTHNKKLSLLEIISNISKFH---SKYSLMPLCNLSF-----HLPKPSESQTXXXXXXXXXXXXXXXXKVNSEYTLHRSTLLHEIGMYLHYISIGILVVFMIELILRILCIGERFFKKKVEMFDGTIIVTSFMADIIFVQLKSDQISVMVVFLLWRIVRLINGLMMHEKQRDEFRITLQKKTRRMCQMKVDRLSTEKELLTKHVLTLEELCKELGANEDQLKNCKPRFKKYSKEQTNNALKSIAALTTGFMGGMVGAPSSNQSAINRY 1441
            DDY +Y   + W N+K FIKQL KDNID  LL EEL R    +R  +WR K L   + N  Q+LL +L+LID+GIVITEIIL            +IH+      M N+  H+         +I +N  I+TS + L        +        T   +L++LE      + +   ++ + +  CNL       HL   SE Q  +                 SE  L     LH     +HYISIG+  +F++  +L+I+C+G++FF    E+ D  +I+TSF++DI +++L S +I+ MV+ LLWRIVRLIN ++M+E+QR EFR+ LQK+ RR+ + KVD L   KEL  KH+  LEEL + +G +E+ L++CKPR+  +SKEQT NALKSIAALTTGFMGG+VGAP + + +I R+
Sbjct:   46 DDYTRYNYELSWANSKTFIKQLAKDNIDSSLLNEELQRHAENRRRRSWRAKCLGRFRSNIAQILLCILVLIDSGIVITEIILEIRSIQNYKQFFDIHAQRLSYIMANQNFHWTGSWCVPPGIILENKPIETSNDRLHMNQIHRTIIPLGSTASTDEHRLAVLEDFLECWRAYVDNAEKTKLGGCNLDLLQRCIHL-NTSEIQEPE----------------TSERNLTNPATLHRASEAMHYISIGVTGLFIVTTVLKIVCLGKKFFLNVYEVIDALVILTSFISDISYIKLDSQEIAAMVILLLWRIVRLINAMLMYERQRCEFRVVLQKRARRLQERKVDNLQRTKELQEKHITNLEELARNIGCSEETLRDCKPRYVYHSKEQTQNALKSIAALTTGFMGGLVGAPLAQKESIARF 447          
BLAST of Voltage-gated hydrogen channel 1 vs. TrEMBL
Match: G7YBB9 (Voltage-gated hydrogen channel 1 OS=Clonorchis sinensis OX=79923 GN=CLF_104291 PE=4 SV=1)

HSP 1 Score: 268.855 bits (686), Expect = 6.063e-78
Identity = 145/383 (37.86%), Postives = 231/383 (60.31%), Query Frame = 2
Query:  320 YTINIEWLNNKKFIKQLEKDNIDVELLREELTRQHRIKRHYTWREKTLQLIKGNFVQVLLSLLILIDAGIVITEIILEIHSMKNKKEHYEDENVIYKNFIQTSLNALLNSSKGVT---------GTHNKKLSLLEIISNISKFHSKYSLMPLCNLSFHLPKPSESQTXXXXXXXXXXXXXXXXKVNSEYTLHRSTLLHEIGMYLHYISIGILVVFMIELILRILCIGERFFKKKVEMFDGTIIVTSFMADIIFVQLKSDQISVMVVFLLWRIVRLINGLMMHEKQRDEFRITLQKKTRRMCQMKVDRLSTEKELLTKHVLTLEELCKELGANEDQLKNCKPRFKKYSKEQTNNALKSIAALTTGFMGGMVGAPSSNQSAINRY 1441
            Y  + +W  N+  +KQL KDNID+ +L++E++   + +   TWR+  L +++ + +Q++LSLL+L+DAGIVITEI+LEI S++              N   +   A L  ++  +         GTH      L+  S I +    Y+     N++      S+ Q     +++            +    + + ++HE    LHY+SI I  +F+I +I++I+C+  +F +   E FD  II+ SF +D+++V+  S+  + MVVFLLWRI+R+IN LMMH++Q+ E RI +QK+ RR+   K++ + TEKE+  KH+  LE+L +ELGA+ + ++ CKPR+KK +KEQTNNALKSIAALTTG MGG+VGAPS+ Q  I++Y
Sbjct:   18 YGYDFDWSRNRAILKQLVKDNIDISMLKDEMSTTLQQRGRKTWRQYLLTILRSHMMQIILSLLVLLDAGIVITEIVLEIQSLQKANAQL--------NHTPSKSGAALRRTRKYSKIILHRQRNGTH------LQTFSEIHRQPRNYTTPTTPNIAL-----SDVQIDRLGEENIFAHDPLSFTHGTNVD-NSAQMMHEASEVLHYLSIAITGLFLICVIIKIICLKRKFLRDTNEYFDAGIIMASFASDVLYVRYASETAAAMVVFLLWRIIRIINALMMHKQQQYELRIAMQKRARRLLGRKMEIIRTEKEMQDKHIGALEDLLRELGASAEVIRRCKPRYKKCTKEQTNNALKSIAALTTGVMGGLVGAPSNFQGVISKY 380          
BLAST of Voltage-gated hydrogen channel 1 vs. TrEMBL
Match: W6VCQ5 (Voltage-gated hydrogen channel OS=Echinococcus granulosus OX=6210 GN=EGR_00639 PE=4 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 2.000e-60
Identity = 95/189 (50.26%), Postives = 139/189 (73.54%), Query Frame = 2
Query:  875 TLLHEIGMYLHYISIGILVVFMIELILRILCIGERFFKKKVEMFDGTIIVTSFMADIIFVQLKSDQISVMVVFLLWRIVRLINGLMMHEKQRDEFRITLQKKTRRMCQMKVDRLSTEKELLTKHVLTLEELCKELGANEDQLKNCKPRFKKYSKEQTNNALKSIAALTTGFMGGMVGAPSSNQSAINRY 1441
             +LH     +H++SIG+  +F+   +L+I+C+G +FF    E+ D  +I+ SF++DI +++L S +IS MV+ LLWRIVRLIN ++M+E+QR EFR+ LQK+ RR+ + KVD L   KEL  KH+  LEEL + LG +E+ +++CKPR+  +SKEQT NALKSIAALTTGFMGG+VGAP + + +I R+
Sbjct:   36 AMLHHASEVMHFVSIGVTGLFIAFTVLKIVCLGRKFFTNIYEVTDALVILVSFVSDISYIKLDSQEISAMVILLLWRIVRLINAMLMYERQRCEFRVILQKRARRLQERKVDNLQRNKELFQKHITNLEELARNLGCSEESIRDCKPRYVYHSKEQTQNALKSIAALTTGFMGGLVGAPLAQKESIARF 224          
BLAST of Voltage-gated hydrogen channel 1 vs. TrEMBL
Match: A0A0R3T0R3 (Ion_trans domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS428 PE=4 SV=2)

HSP 1 Score: 221.861 bits (564), Expect = 5.892e-60
Identity = 100/197 (50.76%), Postives = 143/197 (72.59%), Query Frame = 2
Query:  851 SEYTLHRSTLLHEIGMYLHYISIGILVVFMIELILRILCIGERFFKKKVEMFDGTIIVTSFMADIIFVQLKSDQISVMVVFLLWRIVRLINGLMMHEKQRDEFRITLQKKTRRMCQMKVDRLSTEKELLTKHVLTLEELCKELGANEDQLKNCKPRFKKYSKEQTNNALKSIAALTTGFMGGMVGAPSSNQSAINRY 1441
            SE  L     LH     +HYISIG+  +F++  +L+I+C+G +FF    E+ D  +I+TSF++DI +++L S +I+ MV+ LLWRIVRLIN ++M+E+QR EFR+ LQK+ RR+ + KVD L   KEL  KH+  LEEL + +G +E+ L++CKPR+  +SKEQT NALKSIAALTTGFMGG+VGAP + + +I R+
Sbjct:  265 SEGNLTNPATLHRASEAMHYISIGVTGLFIVTTVLKIVCLGRKFFSNVYEVIDALVILTSFISDISYIKLDSQEIAAMVLLLLWRIVRLINAMLMYERQRCEFRVVLQKRARRLQERKVDNLQRTKELQEKHITNLEELARNIGCSEETLRDCKPRYVYHSKEQTQNALKSIAALTTGFMGGLVGAPFTQKDSIARF 461          

HSP 2 Score: 100.523 bits (249), Expect = 2.313e-18
Identity = 49/97 (50.52%), Postives = 65/97 (67.01%), Query Frame = 2
Query:  302 DLDDY-KYTINIEWLNNKKFIKQLEKDNIDVELLREELTRQHRIKRHYTWREKTLQLIKGNFVQVLLSLLILIDAGIVITEIILEIHSMKNKKEHYE 589
            + DDY +Y   + W N+K FIKQL KDN D  LL EEL R    +R  +WR K L   + N  Q+LL +L+LID+GIVITEIILEI S++N K+ ++
Sbjct:   44 ETDDYTRYNYELGWANSKAFIKQLAKDNTDPSLLNEELQRHAENRRRRSWRAKCLGRFRSNIAQILLCILVLIDSGIVITEIILEIRSIQNYKQFFD 140          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Cavefish
Match: hvcn1 (hydrogen voltage gated channel 1 [Source:NCBI gene;Acc:103044620])

HSP 1 Score: 79.337 bits (194), Expect = 3.258e-16
Identity = 40/128 (31.25%), Postives = 76/128 (59.38%), Query Frame = 2
Query:  902 LHYISIGILVVFMIELILRILCIGERFFKKKVEMFDGTIIVTSFMADIIFVQLKS--DQISVMVVFLLWRIVRLINGLMMHEKQRDEFRIT-LQKKTRRMCQMKVDRLSTEKELLTKHVLTLEELCKE 1276
             HY+S+ +L  FM+EL+L++      FFK K E+FDG ++V SF+ DI+++  +   D +  +++  LWR+ R+ING+++  + R   ++  +Q+   R+ Q +V+ L  +K  +   +  L  L K+
Sbjct:   98 FHYLSLALLTFFMVELLLKLFAYRLEFFKHKFEVFDGIVVVVSFVLDIVYISKEDAFDGMGFLILLRLWRVARIINGILVTVENRAHHKVQKVQESNDRLVQ-QVNELQEQKATMEHEISRLRALLKQ 224          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Cavefish
Match: tmem266 (transmembrane protein 266 [Source:ZFIN;Acc:ZDB-GENE-070112-2382])

HSP 1 Score: 60.077 bits (144), Expect = 7.061e-9
Identity = 33/113 (29.20%), Postives = 66/113 (58.41%), Query Frame = 2
Query:  902 LHYISIGILVVFMIELILRILCIG-ERFFKKKVEMFDGTIIVTSFMADIIFVQLKS------DQISVMVVFLLWRIVRLINGLMMHEKQRDEFRITLQKKTRRMCQMKVDRLS 1219
            +H+IS+ IL VF  E + RI+ +G   + + KVE+FDG +IV S +A ++   + +      D IS+++   +WR+ R+I+  ++  K   E  +   +K + + + +++RL+
Sbjct:  132 IHWISLVILSVFFTETVFRIVVLGIWDYIENKVEVFDGAVIVLS-LAPMVASTVANGPSSPWDAISLIITLRIWRVKRIIDAYVLQVKVEMELELQQYEKAKAVREEQLERLT 243          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Sea Lamprey
Match: hvcn1 (hydrogen voltage-gated channel 1 [Source:NCBI gene;Acc:436618])

HSP 1 Score: 73.1738 bits (178), Expect = 9.563e-15
Identity = 39/125 (31.20%), Postives = 68/125 (54.40%), Query Frame = 2
Query:  866 HRSTLLHEIGMYLHYISIGILVVFMIELILRILCIGERFFKKKVEMFDGTIIVTSFMADIIFVQLKS--DQISVMVVFLLWRIVRLINGLMMHEKQRDEFRITLQKKTRRMCQMKVDRLSTEKEL 1234
            H+ ++  E+   LHY+S+ IL +FM+EL +++      FF   +E+ DG ++  SF  DI +       D  + +++  LWRI R+ NG++M  K R   R+ + K+ +   Q +   L  E+EL
Sbjct:   88 HKDSVAPEV---LHYMSLAILSLFMVELAVKLFAFRLEFFWHPLEVLDGAVVAISFALDIFYASRHDGFDATAFLILLRLWRIARIANGIVMSVKNRTGRRVAVLKREKEALQRRC--LEQEQEL 207          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Nematostella
Match: EDO34401 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPG1])

HSP 1 Score: 83.5741 bits (205), Expect = 4.841e-18
Identity = 42/108 (38.89%), Postives = 69/108 (63.89%), Query Frame = 2
Query:  902 LHYISIGILVVFMIELILRILCIGERFFKKKVEMFDGTIIVTSFMADIIFVQL-KSDQISVMVVFLLWRIVRLINGLMMHEKQRDEFRITLQKKTRRMCQMKVDRLST 1222
            LH +SI IL +F+IELI++I  +G  FF  K+E+FDG +++ SF  DI F     ++  S++++  LWR+ R++NG+++  K +DE +I    K     Q ++DRL T
Sbjct:  104 LHDVSIAILSLFIIELIVKIYAMGMEFFHHKLEVFDGIVVIVSFALDIAFSGGNAAEGASLLIILRLWRVTRIVNGIILSVKMQDEKKIHHLHKVIEELQEELDRLKT 211          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Nematostella
Match: EDO37671 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF11])

HSP 1 Score: 55.0694 bits (131), Expect = 1.808e-8
Identity = 30/117 (25.64%), Postives = 64/117 (54.70%), Query Frame = 2
Query:  902 LHYISIGILVVFMIELILRILCIGERFFK-KKVEMFDGTIIVTSFMADIIFVQLKSDQ----ISVMVVFLLWRIVRLINGLMMHEKQRDEFRITLQKKTRRMCQMKVDRLSTEKELL 1237
            LH++ I IL +F +E+ L++  +G  +FK +K+E+FD  I++T+ + +I+     + +    +  ++   LWR+ R+I  ++   ++  E       +++R      + L TE+E L
Sbjct:   91 LHFVGISILAIFALEVFLKLFALGIEYFKIEKLEIFDAVIVITALIVEILLSATHTSKAWKSLGFVIGLRLWRVCRVITNIIEFREELYELIDESDGRSKRPTSSATETLHTERESL 207          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Medaka
Match: hvcn1 (hydrogen voltage gated channel 1 [Source:NCBI gene;Acc:101159070])

HSP 1 Score: 75.0998 bits (183), Expect = 9.187e-15
Identity = 42/127 (33.07%), Postives = 72/127 (56.69%), Query Frame = 2
Query:  902 LHYISIGILVVFMIELILRILCIGERFFKKKVEMFDGTIIVTSFMADIIFV--QLKSDQISVMVVFLLWRIVRLINGLMMHEKQRDEFRITLQKKTRRMCQMKVDRLSTEKELLTKHVLTLEELCKE 1276
             HY+S+ +L  FM+EL  ++      FF  K EMFDG ++V SF+ DI+F+  +   D + ++++  LWR+ R+ING+++  K R + RI   K++      +V  L    + LT+    L+ + KE
Sbjct:   95 FHYLSLAVLTFFMMELAGKLFAFRLEFFHHKFEMFDGLVVVVSFILDIVFIFHEDAFDGMGLLILLRLWRVARIINGIVVSVKNRADQRIHKLKESYDHVVQRVTELQKSCDDLTQENHRLKAILKE 221          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Medaka
Match: tmem266 (transmembrane protein 266 [Source:NCBI gene;Acc:101156009])

HSP 1 Score: 62.3882 bits (150), Expect = 1.202e-9
Identity = 34/113 (30.09%), Postives = 65/113 (57.52%), Query Frame = 2
Query:  902 LHYISIGILVVFMIELILRILCIG-ERFFKKKVEMFDGTIIVTSFMADIIFVQLKS------DQISVMVVFLLWRIVRLINGLMMHEKQRDEFRITLQKKTRRMCQMKVDRLS 1219
            +H+IS+ IL VF  E + RI+ +G   + + KVE+FDG IIV S +A ++   + +      D I +++   +WR+ R+I+  ++  K   E  +   +K + + + ++DRL+
Sbjct:  129 IHWISLAILSVFFTETVFRIVVLGIWDYIENKVEVFDGAIIVLS-LAPMVASTVANGPSSPWDAIGLIITLRIWRVKRIIDAYVLQVKVDMELEMQQYEKAKALREEQLDRLT 240          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Medaka
Match: ENSORLT00000046304.1 (transmembrane protein 266 [Source:NCBI gene;Acc:101174011])

HSP 1 Score: 61.2326 bits (147), Expect = 3.134e-9
Identity = 36/112 (32.14%), Postives = 65/112 (58.04%), Query Frame = 2
Query:  902 LHYISIGILVVFMIELILRILCIG-ERFFKKKVEMFDGTIIVTSF---MADIIFVQLKS--DQISVMVVFLLWRIVRLINGLMMHEKQRDEFRITLQKKTRRMCQMKVDRLS 1219
            +H+IS+ IL +F  E + RI+ +G   + + KVE+FDG +IV S    MA  +     S  D IS+++   +WR+ R+I+  ++  K   E  I   +KT+ + + +++RL+
Sbjct:  131 IHWISLIILSLFFSETVFRIVVLGIWDYIENKVEVFDGAVIVLSLAPMMASTVANGPSSPWDAISLIITLRIWRVKRIIDAYVLQVKVEMELEIQQCEKTKAVREEQLERLT 242          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Medaka
Match: ENSORLT00000015469.2 (transmembrane protein 266 [Source:NCBI gene;Acc:101174011])

HSP 1 Score: 61.2326 bits (147), Expect = 3.278e-9
Identity = 36/112 (32.14%), Postives = 65/112 (58.04%), Query Frame = 2
Query:  902 LHYISIGILVVFMIELILRILCIG-ERFFKKKVEMFDGTIIVTSF---MADIIFVQLKS--DQISVMVVFLLWRIVRLINGLMMHEKQRDEFRITLQKKTRRMCQMKVDRLS 1219
            +H+IS+ IL +F  E + RI+ +G   + + KVE+FDG +IV S    MA  +     S  D IS+++   +WR+ R+I+  ++  K   E  I   +KT+ + + +++RL+
Sbjct:  132 IHWISLIILSLFFSETVFRIVVLGIWDYIENKVEVFDGAVIVLSLAPMMASTVANGPSSPWDAISLIITLRIWRVKRIIDAYVLQVKVEMELEIQQCEKTKAVREEQLERLT 243          
BLAST of Voltage-gated hydrogen channel 1 vs. Planmine SMEST
Match: SMESG000002770.1 (SMESG000002770.1)

HSP 1 Score: 1196.8 bits (3095), Expect = 0.000e+0
Identity = 630/631 (99.84%), Postives = 630/631 (99.84%), Query Frame = 2
Query:  236 MVRSINNVHKDGQLLGQNNPTLDLDDYKYTINIEWLNNKKFIKQLEKDNIDVELLREELTRQHRIKRHYTWREKTLQLIKGNFVQVLLSLLILIDAGIVITEIILEIHSMKNKKEHYEDENVIYKNFIQTSLNALLNSSKGVTGTHNKKLSLLEIISNISKFHSKYSLMPLCNLSFHLPKPSESQTXXXXXXXXXXXXXXXXKVNSEYTLHRSTLLHEIGMYLHYISIGILVVFMIELILRILCIGERFFKKKVEMFDGTIIVTSFMADIIFVQLKSDQISVMVVFLLWRIVRLINGLMMHEKQRDEFRITLQKKTRRMCQMKVDRLSTEKELLTKHVLTLEELCKELGANEDQLKNCKPRFKKYSKEQTNNALKSIAALTTGFMGGMVGAPSSNQSAINRYXXXXXXXXXXXXXXXKKLKVMRKISETPYSSFDNSELELTPMTSHTLFLPSSDSPMNSVDRESPFRFLACTKKRQRGTKLHHSLLTDSEQEEKDQIPVMEQQELLLPSDREENNHQLVVIRNHENTISTEEHEKATDRDSNTNAQSRGYAXXXXXXXXXXEPNENDVDDTRELPKVSLTQAERCRTFREKFRSQEVITTQESSLDSRPSLDEGIDFNSCSQYPVSTTSK 2128
            MVRSINNVHKDGQLLGQNNPTLDLDDYKYTINIEWLNNKKFIKQLEKDNIDVELLREELTRQHRIKRHYTWREKTLQLIKGNFVQVLLSLLILIDAGIVITEIILEIHSMKNKKEHYEDENVIYKNFIQTSLNALLNSSK VTGTHNKKLSLLEIISNISKFHSKYSLMPLCNLSFHLPKPSESQTSDNHDDSHKDSYSSDHKVNSEYTLHRSTLLHEIGMYLHYISIGILVVFMIELILRILCIGERFFKKKVEMFDGTIIVTSFMADIIFVQLKSDQISVMVVFLLWRIVRLINGLMMHEKQRDEFRITLQKKTRRMCQMKVDRLSTEKELLTKHVLTLEELCKELGANEDQLKNCKPRFKKYSKEQTNNALKSIAALTTGFMGGMVGAPSSNQSAINRYSGTSPSPSIQSPTSSKKLKVMRKISETPYSSFDNSELELTPMTSHTLFLPSSDSPMNSVDRESPFRFLACTKKRQRGTKLHHSLLTDSEQEEKDQIPVMEQQELLLPSDREENNHQLVVIRNHENTISTEEHEKATDRDSNTNAQSRGYASSVSHSTSASEPNENDVDDTRELPKVSLTQAERCRTFREKFRSQEVITTQESSLDSRPSLDEGIDFNSCSQYPVSTTSK
Sbjct:    1 MVRSINNVHKDGQLLGQNNPTLDLDDYKYTINIEWLNNKKFIKQLEKDNIDVELLREELTRQHRIKRHYTWREKTLQLIKGNFVQVLLSLLILIDAGIVITEIILEIHSMKNKKEHYEDENVIYKNFIQTSLNALLNSSKVVTGTHNKKLSLLEIISNISKFHSKYSLMPLCNLSFHLPKPSESQTSDNHDDSHKDSYSSDHKVNSEYTLHRSTLLHEIGMYLHYISIGILVVFMIELILRILCIGERFFKKKVEMFDGTIIVTSFMADIIFVQLKSDQISVMVVFLLWRIVRLINGLMMHEKQRDEFRITLQKKTRRMCQMKVDRLSTEKELLTKHVLTLEELCKELGANEDQLKNCKPRFKKYSKEQTNNALKSIAALTTGFMGGMVGAPSSNQSAINRYSGTSPSPSIQSPTSSKKLKVMRKISETPYSSFDNSELELTPMTSHTLFLPSSDSPMNSVDRESPFRFLACTKKRQRGTKLHHSLLTDSEQEEKDQIPVMEQQELLLPSDREENNHQLVVIRNHENTISTEEHEKATDRDSNTNAQSRGYASSVSHSTSASEPNENDVDDTRELPKVSLTQAERCRTFREKFRSQEVITTQESSLDSRPSLDEGIDFNSCSQYPVSTTSK 631          
BLAST of Voltage-gated hydrogen channel 1 vs. Planmine SMEST
Match: SMESG000070756.1 (SMESG000070756.1)

HSP 1 Score: 304.294 bits (778), Expect = 6.529e-93
Identity = 174/433 (40.18%), Postives = 265/433 (61.20%), Query Frame = 2
Query:  215 VEKDMEDMVRSINNVHKD---GQLLGQNNPTLDLDDY----KYTINIEWLNNKKFIKQLEKDNIDVELLREELTRQHRIKRHYTWREKTLQLIKGNFVQVLLSLLILIDAGIVITEIILEIHSMKNKKEHYED---ENVIYKNFIQTSLNALLNSSKGVTGTHNKKLSLLEIISNISKFHSKYSLMPLCNL-----SFHL---------PKPSESQTXXXXXXXXXXXXXXXXKVNSEYTLHRSTLLHEIGMYLHYISIGILVVFMIELILRILCIGERFFKKKVEMFDGTIIVTSFMADIIFVQLKSDQISVMVVFLLWRIVRLINGLMMHEKQRDEFRITLQKKTRRMCQMKVDRLSTEKELLTKHVLTLEELCKELGANEDQLKNCKPRFKKYSKEQTNNALKSIAALTTGFMGGMVGAPSSNQSAINRY 1441
            +E  + D V + N  +KD   G    +    L +DD      Y+  + W+ ++K + QL+KDNID+EL + E  ++   K H T + + L  ++ N +Q++++LL+L+DAGIVI EIILEIHS+KN  E +++   E +++ N    S  A LN       +H++  ++  I+  ++++    +   L N+       HL          KP  +  +   + +   S+    K       H S  LH +   LHY SI IL +F++E+ L+I C+G +FFK K E+ D  +IVTSF+ADII V + S +ISVM++FLLWRIVR+INGL+MHEKQRDEFRI LQKK RR+ +MKV++L+ + E+  KH++ LE+  +E G  E  +K C+P++ +Y+K+QTNN LKSIAA+TTGFMGG+VGA  SN+  INR+
Sbjct:    1 MEGIIRDAVMNNNKANKDQNKGNKYSKAKTHLTIDDTFAERSYSFRVNWMKDEKLLNQLKKDNIDIELFQCEFKQETNQKNHKTMKSRLLLFLQSNPIQIIIALLVLVDAGIVIAEIILEIHSLKNSIEAHQEQIRETIVFVNKTFRSQIAHLNQG----DSHDEIGTMETILDTLNEYSFNCTTPKLKNIYNSKKDSHLKIKRSVKKKSKPKANNNNHGQNSTSTSSHKVSEK------KHTSQTLHVVSETLHYASIIILGLFVLEVGLKIACVGCKFFKAKFEVVDAVVIVTSFVADIIIVNIGSQEISVMIIFLLWRIVRVINGLLMHEKQRDEFRIALQKKARRVSEMKVEQLTIQTEMQEKHIMALEDCSREAGVPEIIIKRCRPKYIQYTKDQTNNPLKSIAAMTTGFMGGLVGAQHSNKE-INRF 422          
BLAST of Voltage-gated hydrogen channel 1 vs. Planmine SMEST
Match: SMESG000070756.1 (SMESG000070756.1)

HSP 1 Score: 301.212 bits (770), Expect = 1.247e-91
Identity = 167/402 (41.54%), Postives = 252/402 (62.69%), Query Frame = 2
Query:  287 NNPTLDLDDYKYTINIEWLNNKKFIKQLEKDNIDVELLREELTRQHRIKRHYTWREKTLQLIKGNFVQVLLSLLILIDAGIVITEIILEIHSMKNKKEHYED---ENVIYKNFIQTSLNALLNSSKGVTGTHNKKLSLLEIISNISKFHSKYSLMPLCNL-----SFHL---------PKPSESQTXXXXXXXXXXXXXXXXKVNSEYTLHRSTLLHEIGMYLHYISIGILVVFMIELILRILCIGERFFKKKVEMFDGTIIVTSFMADIIFVQLKSDQISVMVVFLLWRIVRLINGLMMHEKQRDEFRITLQKKTRRMCQMKVDRLSTEKELLTKHVLTLEELCKELGANEDQLKNCKPRFKKYSKEQTNNALKSIAALTTGFMGGMVGAPSSNQSAINRY 1441
            N P   L    Y+  + W+ ++K + QL+KDNID+EL + E  ++   K H T + + L  ++ N +Q++++LL+L+DAGIVI EIILEIHS+KN  E +++   E +++ N    S  A LN       +H++  ++  I+  ++++    +   L N+       HL          KP  +  +   + +   S+    K       H S  LH +   LHY SI IL +F++E+ L+I C+G +FFK K E+ D  +IVTSF+ADII V + S +ISVM++FLLWRIVR+INGL+MHEKQRDEFRI LQKK RR+ +MKV++L+ + E+  KH++ LE+  +E G  E  +K C+P++ +Y+K+QTNN LKSIAA+TTGFMGG+VGA  SN+  INR+
Sbjct:   46 NLPIAILRSKSYSFRVNWMKDEKLLNQLKKDNIDIELFQCEFKQETNQKNHKTMKSRLLLFLQSNPIQIIIALLVLVDAGIVIAEIILEIHSLKNSIEAHQEQIRETIVFVNKTFRSQIAHLNQG----DSHDEIGTMETILDTLNEYSFNCTTPKLKNIYNSKKDSHLKIKRSVKKKSKPKANNNNHGQNSTSTSSHKVSEKK------HTSQTLHVVSETLHYASIIILGLFVLEVGLKIACVGCKFFKAKFEVVDAVVIVTSFVADIIIVNIGSQEISVMIIFLLWRIVRVINGLLMHEKQRDEFRIALQKKARRVSEMKVEQLTIQTEMQEKHIMALEDCSREAGVPEIIIKRCRPKYIQYTKDQTNNPLKSIAAMTTGFMGGLVGAQHSNKE-INRF 436          
BLAST of Voltage-gated hydrogen channel 1 vs. Planmine SMEST
Match: SMESG000070756.1 (SMESG000070756.1)

HSP 1 Score: 293.123 bits (749), Expect = 3.103e-89
Identity = 162/384 (42.19%), Postives = 245/384 (63.80%), Query Frame = 2
Query:  341 LNNKKFIKQLEKDNIDVELLREELTRQHRIKRHYTWREKTLQLIKGNFVQVLLSLLILIDAGIVITEIILEIHSMKNKKEHYED---ENVIYKNFIQTSLNALLNSSKGVTGTHNKKLSLLEIISNISKFHSKYSLMPLCNL-----SFHL---------PKPSESQTXXXXXXXXXXXXXXXXKVNSEYTLHRSTLLHEIGMYLHYISIGILVVFMIELILRILCIGERFFKKKVEMFDGTIIVTSFMADIIFVQLKSDQISVMVVFLLWRIVRLINGLMMHEKQRDEFRITLQKKTRRMCQMKVDRLSTEKELLTKHVLTLEELCKELGANEDQLKNCKPRFKKYSKEQTNNALKSIAALTTGFMGGMVGAPSSNQSAINRY 1441
            + ++K + QL+KDNID+EL + E  ++   K H T + + L  ++ N +Q++++LL+L+DAGIVI EIILEIHS+KN  E +++   E +++ N    S  A LN       +H++  ++  I+  ++++    +   L N+       HL          KP  +  +   + +   S+    K       H S  LH +   LHY SI IL +F++E+ L+I C+G +FFK K E+ D  +IVTSF+ADII V + S +ISVM++FLLWRIVR+INGL+MHEKQRDEFRI LQKK RR+ +MKV++L+ + E+  KH++ LE+  +E G  E  +K C+P++ +Y+K+QTNN LKSIAA+TTGFMGG+VGA  SN+  INR+
Sbjct:    1 MKDEKLLNQLKKDNIDIELFQCEFKQETNQKNHKTMKSRLLLFLQSNPIQIIIALLVLVDAGIVIAEIILEIHSLKNSIEAHQEQIRETIVFVNKTFRSQIAHLNQG----DSHDEIGTMETILDTLNEYSFNCTTPKLKNIYNSKKDSHLKIKRSVKKKSKPKANNNNHGQNSTSTSSHKVSEK------KHTSQTLHVVSETLHYASIIILGLFVLEVGLKIACVGCKFFKAKFEVVDAVVIVTSFVADIIIVNIGSQEISVMIIFLLWRIVRVINGLLMHEKQRDEFRIALQKKARRVSEMKVEQLTIQTEMQEKHIMALEDCSREAGVPEIIIKRCRPKYIQYTKDQTNNPLKSIAAMTTGFMGGLVGAQHSNKE-INRF 373          
BLAST of Voltage-gated hydrogen channel 1 vs. Planmine SMEST
Match: SMESG000077167.1 (SMESG000077167.1)

HSP 1 Score: 290.041 bits (741), Expect = 9.212e-89
Identity = 159/379 (41.95%), Postives = 238/379 (62.80%), Query Frame = 2
Query:  323 TINIEWLNNKKFIKQLEKDNIDVELLREELTRQHRIKRHYTWREKTLQLIKGNFVQVLLSLLILIDAGIVITEIILEIHSMKNKKEHYEDE-----NVIYKNFIQTSL--NALLNSSKGVTGTHNKKLSLLEII-----SNISKFHSKYSLMPLCNLSFHLPKPSESQTXXXXXXXXXXXXXXXXKVNSEYTLHRSTLLHEIGMYLHYISIGILVVFMIELILRILCIGERFFKKKVEMFDGTIIVTSFMADIIFVQLKSDQISVMVVFLLWRIVRLINGLMMHEKQRDEFRITLQKKTRRMCQMKVDRLSTEKELLTKHVLTLEELCKELGANEDQLKNCKPRFKKYSKEQTNNALKSIAALTTGFMGGMVGAPSSNQ 1423
            ++++ WLN+ KF++QL +DNID+++L +EL  +   ++    ++  L +++ + +Q+L+++L+LIDAGIVI EI+LEIHSMKNK E Y ++     + +   F+ T +  N  + + +    TH K+L LL  I      +I+ F  +       N   +   P E      H                    HRST LH+    LH+ SI +L +F++EL ++ILCIG  FFK + E+ D  +I+TSF+ADI+ V + S +ISVM++FLLWRIVR+INGL+MHEKQRDE RI LQKK RR+ +MK++ L  +KE+  KH + LEELC   GA+ D ++ CKP+F   +K  TNN LKSIAALT+GFMG +VGA ++N+
Sbjct:   10 SLHVRWLNDTKFLQQLSEDNIDIDILNKELYAEESGRKQTHIQKIILNILQCHPMQILIAILVLIDAGIVIAEIVLEIHSMKNKIEAYSEQMRDTIHFLNHTFVDTHIFDNVDIQALEESPSTH-KELDLLAQILQLLPQSIASFQIQSQFQCFKNSPVNGSHPKEKTQITKHGHQEATYIKQ----------HRSTNLHKASEMLHFASIALLGLFVVELTVKILCIGPTFFKARFEVIDAIVILTSFIADIVIVVVGSQEISVMIIFLLWRIVRVINGLIMHEKQRDELRIFLQKKARRISEMKLEDLIIQKEMQEKHCIVLEELCVRAGASPDLIQKCKPKFTPINKCHTNNPLKSIAALTSGFMGTIVGAHATNK 377          
The following BLAST results are available for this feature:
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HVCN14.861e-1134.58hydrogen voltage gated channel 1 [Source:HGNC Symb... [more]
HVCN15.833e-1134.58hydrogen voltage gated channel 1 [Source:HGNC Symb... [more]
HVCN15.833e-1134.58hydrogen voltage gated channel 1 [Source:HGNC Symb... [more]
HVCN15.833e-1134.58hydrogen voltage gated channel 1 [Source:HGNC Symb... [more]
HVCN16.800e-1134.58hydrogen voltage gated channel 1 [Source:HGNC Symb... [more]
back to top
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
hvcn13.941e-1334.44hydrogen voltage-gated channel 1 [Source:NCBI gene... [more]
tmem2663.057e-928.81transmembrane protein 266 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
hvcn13.826e-1228.57hydrogen voltage gated channel 1 [Source:NCBI gene... [more]
hvcn13.331e-1127.07hydrogen voltage gated channel 1 [Source:NCBI gene... [more]
mcf2l21.196e-627.43MCF.2 cell line derived transforming sequence-like... [more]
back to top
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Hvcn19.181e-1032.76hydrogen voltage-gated channel 1 [Source:MGI Symbo... [more]
Hvcn19.181e-1032.76hydrogen voltage-gated channel 1 [Source:MGI Symbo... [more]
Tmem2668.440e-927.86transmembrane protein 266 [Source:MGI Symbol;Acc:M... [more]
Tmem2667.563e-826.95transmembrane protein 266 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Voltage-gated hydrogen channel 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5F4C0|HVCN1_CHICK1.583e-1231.30Voltage-gated hydrogen channel 1 OS=Gallus gallus ... [more]
sp|Q6DHQ1|HVCN1_DANRE3.032e-1234.44Voltage-gated hydrogen channel 1 OS=Danio rerio OX... [more]
sp|Q5M7E9|HVCN1_XENLA1.271e-1032.26Voltage-gated hydrogen channel 1 OS=Xenopus laevis... [more]
sp|Q5M8L8|HVCN1_XENTR1.765e-1027.07Voltage-gated hydrogen channel 1 OS=Xenopus tropic... [more]
sp|Q96D96|HVCN1_HUMAN2.801e-1034.58Voltage-gated hydrogen channel 1 OS=Homo sapiens O... [more]
back to top
BLAST of Voltage-gated hydrogen channel 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A564Y6F81.504e-8140.33Ion_trans domain-containing protein OS=Hymenolepis... [more]
A0A158QF499.270e-8140.10Ion_trans domain-containing protein OS=Hymenolepis... [more]
G7YBB96.063e-7837.86Voltage-gated hydrogen channel 1 OS=Clonorchis sin... [more]
W6VCQ52.000e-6050.26Voltage-gated hydrogen channel OS=Echinococcus gra... [more]
A0A0R3T0R35.892e-6050.76Ion_trans domain-containing protein OS=Rodentolepi... [more]
back to top
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
hvcn13.258e-1631.25hydrogen voltage gated channel 1 [Source:NCBI gene... [more]
tmem2667.061e-929.20transmembrane protein 266 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
hvcn19.563e-1531.20hydrogen voltage-gated channel 1 [Source:NCBI gene... [more]
back to top
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO344014.841e-1838.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO376711.808e-825.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
hvcn19.187e-1533.07hydrogen voltage gated channel 1 [Source:NCBI gene... [more]
tmem2661.202e-930.09transmembrane protein 266 [Source:NCBI gene;Acc:10... [more]
ENSORLT00000046304.13.134e-932.14transmembrane protein 266 [Source:NCBI gene;Acc:10... [more]
ENSORLT00000015469.23.278e-932.14transmembrane protein 266 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Voltage-gated hydrogen channel 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000002770.10.000e+099.84SMESG000002770.1[more]
SMESG000070756.16.529e-9340.18SMESG000070756.1[more]
SMESG000070756.11.247e-9141.54SMESG000070756.1[more]
SMESG000070756.13.103e-8942.19SMESG000070756.1[more]
SMESG000077167.19.212e-8941.95SMESG000077167.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016391 ID=SMED30016391|Name=Voltage-gated hydrogen channel 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2459bp
GGCTGAATTATTTTGGAGGATTTTAATACAGTTTTTCATCTCGAGACAGC
AGTGTAAATTGTGAATCGCTACGTTCCTTTGCCTCTGCAACTATCTCTAC
AGCCAGAGCTCAAATTTGCTTAAATCAAAAAGACTACGTTATACTTTGCA
AGTGCTAGTTAAATATTTCCATTATATTTTGATTATTTTTATTTGGAAAA
ATACTTTTTCGTCTGTTGAAAAAGACATGGAAGACATGGTTCGATCAATA
AATAATGTCCACAAAGATGGCCAACTTCTTGGCCAGAACAATCCAACCTT
GGACCTTGATGACTACAAATATACGATCAACATCGAATGGCTCAACAACA
AAAAATTCATCAAACAGTTGGAAAAGGACAATATAGACGTCGAACTGTTA
CGCGAAGAACTAACACGGCAGCATAGGATTAAACGACACTATACATGGCG
AGAGAAAACTCTACAACTTATCAAAGGAAACTTTGTTCAAGTGCTTCTCA
GTCTATTAATATTAATAGATGCTGGTATTGTTATCACAGAAATTATACTT
GAGATTCATTCTATGAAAAACAAAAAAGAACATTATGAGGATGAGAACGT
GATTTATAAAAACTTCATACAGACTTCTCTCAACGCTCTACTTAATTCGT
CAAAGGGGGTCACAGGAACCCACAATAAAAAGTTGAGTCTGCTTGAGATC
ATATCTAACATTAGTAAATTTCATTCAAAATACTCACTGATGCCTTTGTG
TAATCTGTCATTCCATCTTCCAAAACCGTCTGAAAGCCAAACAAGCGACA
ATCACGACGACTCTCACAAAGATTCATATTCATCTGATCACAAAGTCAAT
TCAGAGTACACTCTTCATAGGTCGACCCTTCTCCACGAAATCGGGATGTA
TTTGCACTATATCAGCATAGGAATTCTTGTGGTTTTCATGATCGAGTTGA
TCTTGCGGATTTTGTGCATTGGGGAAAGATTTTTCAAGAAAAAAGTTGAA
ATGTTCGATGGGACGATCATTGTTACGTCGTTTATGGCCGACATCATATT
CGTTCAATTGAAATCTGATCAAATCTCAGTAATGGTAGTATTCTTGCTAT
GGAGAATTGTCAGATTGATCAATGGTCTCATGATGCACGAAAAACAGAGA
GACGAATTCCGAATCACTTTGCAAAAGAAAACCAGGCGCATGTGTCAAAT
GAAAGTAGATAGACTGTCTACAGAGAAAGAACTATTGACGAAACATGTTT
TAACTCTGGAAGAACTTTGTAAAGAATTGGGAGCAAATGAGGACCAGCTG
AAAAATTGCAAACCAAGATTCAAAAAATACTCCAAGGAACAGACTAACAA
TGCTTTAAAATCAATTGCCGCCTTAACCACTGGCTTTATGGGAGGAATGG
TCGGGGCCCCATCATCCAATCAATCAGCTATTAATAGGTATTCTGGCACC
AGTCCAAGTCCCAGCATACAGAGTCCAACTAGTTCAAAAAAGCTGAAAGT
TATGAGAAAGATTAGTGAAACTCCATACAGCAGTTTTGATAATTCTGAAT
TAGAACTGACTCCGATGACCTCTCATACTCTGTTTTTACCGTCATCCGAC
TCGCCGATGAACAGTGTAGATAGAGAATCCCCATTCAGATTTTTGGCATG
CACTAAGAAAAGACAACGTGGTACCAAATTGCATCATAGTTTGCTGACAG
ATTCGGAGCAAGAAGAGAAAGACCAGATACCTGTAATGGAACAACAAGAG
TTACTGCTACCGTCTGATAGAGAAGAAAATAACCATCAATTAGTTGTCAT
TCGAAATCACGAAAATACCATCTCAACTGAAGAGCATGAAAAAGCCACTG
ATCGAGATTCAAACACCAATGCTCAAAGTAGAGGATATGCTAGCTCAGTA
TCTCATTCTACATCAGCTTCAGAACCGAATGAAAATGATGTAGATGATAC
CCGAGAGCTTCCAAAAGTTAGTCTAACTCAAGCCGAACGTTGTCGAACAT
TTCGCGAAAAATTTCGTTCTCAAGAGGTTATTACAACTCAAGAAAGCTCA
TTAGATTCTCGACCGTCTCTGGATGAAGGCATAGACTTCAACTCATGCTC
TCAGTATCCAGTTTCCACGACATCAAAGTGATGTTTGGCTATTGTTTCCG
CTGGTCGGAATTCTATGGACAACGTACAAGTACTCACTCTATCCCATTGA
ACTGATTAATCTAGTAGATTTTCAAGCAAGATCAGATTCAGATTATGACG
TTTAGATTGTGAATGTGTTAATATTTTTGTAAGTACCTTGATCGTATTAG
ATATTTTGTAAGACATTAGAGAATTGTTTTACTATTTTCATATTTTTGCC
TCATGCTTCGGTGAGCAGAGTTACAGACTTCATTGTCTAGAATAATAGAT
GTTACTGCCTCAAAATGGCTGTTTGTCATCGTATTATAGCGTTAAATAAA
TAAATTCGA
back to top

protein sequence of SMED30016391-orf-1

>SMED30016391-orf-1 ID=SMED30016391-orf-1|Name=SMED30016391-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=635bp
MEDMVRSINNVHKDGQLLGQNNPTLDLDDYKYTINIEWLNNKKFIKQLEK
DNIDVELLREELTRQHRIKRHYTWREKTLQLIKGNFVQVLLSLLILIDAG
IVITEIILEIHSMKNKKEHYEDENVIYKNFIQTSLNALLNSSKGVTGTHN
KKLSLLEIISNISKFHSKYSLMPLCNLSFHLPKPSESQTSDNHDDSHKDS
YSSDHKVNSEYTLHRSTLLHEIGMYLHYISIGILVVFMIELILRILCIGE
RFFKKKVEMFDGTIIVTSFMADIIFVQLKSDQISVMVVFLLWRIVRLING
LMMHEKQRDEFRITLQKKTRRMCQMKVDRLSTEKELLTKHVLTLEELCKE
LGANEDQLKNCKPRFKKYSKEQTNNALKSIAALTTGFMGGMVGAPSSNQS
AINRYSGTSPSPSIQSPTSSKKLKVMRKISETPYSSFDNSELELTPMTSH
TLFLPSSDSPMNSVDRESPFRFLACTKKRQRGTKLHHSLLTDSEQEEKDQ
IPVMEQQELLLPSDREENNHQLVVIRNHENTISTEEHEKATDRDSNTNAQ
SRGYASSVSHSTSASEPNENDVDDTRELPKVSLTQAERCRTFREKFRSQE
VITTQESSLDSRPSLDEGIDFNSCSQYPVSTTSK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005887integral component of plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0030171voltage-gated proton channel activity
GO:0005216ion channel activity
Vocabulary: biological process
TermDefinition
GO:1902600hydrogen ion transmembrane transport
GO:0006811ion transport
GO:0034220ion transmembrane transport
GO:0055085transmembrane transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR031846Hvcn1
IPR027359Volt_channel_dom_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 45..65
NoneNo IPR availableCOILSCoilCoilcoord: 103..123
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 546..566
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 596..634
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 481..501
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 601..634
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 526..584
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 567..584
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 485..501
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 530..545
NoneNo IPR availableTMHMMTMhelixcoord: 224..246
NoneNo IPR availableTMHMMTMhelixcoord: 273..295
NoneNo IPR availableTMHMMTMhelixcoord: 86..108
IPR027359Voltage-dependent channel domain superfamilyGENE3DG3DSA:1.20.120.350coord: 211..310
e-value: 3.5E-14
score: 54.5
IPR031846Voltage-gated hydrogen channel 1PANTHERPTHR46480FAMILY NOT NAMEDcoord: 44..553