Thymidylate kinase

Overview
NameThymidylate kinase
Smed IDSMED30016384
Length (bp)2591
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Thymidylate kinase (SMED30016384) t-SNE clustered cells

Violin plots show distribution of expression levels for Thymidylate kinase (SMED30016384) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Thymidylate kinase (SMED30016384) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Thymidylate kinase (SMED30016384) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016384

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30016384SMESG000016256.1 SMESG000016255.1 SMESG000010584.1 SMESG000009925.1 dd_Smed_v4_2090_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30016384SMESG000016256.1 SMESG000016255.1 SMESG000010584.1 SMESG000009925.1 dd_Smed_v4_2090_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30016384SMESG000016256.1 SMESG000016255.1 SMESG000010584.1 SMESG000009925.1 dd_Smed_v4_2090_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30016384SMESG000016181.1 dd_Smed_v4_3849_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30016384SMESG000016181.1 dd_Smed_v4_3849_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30016384SMESG000016181.1 dd_Smed_v4_3849_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30016384SMESG000016255.1 SMESG000010584.1 SMESG000016256.1 SMESG000009925.1 dd_Smed_v6_2090_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Thymidylate kinase vs. Ensembl Human
Match: DTYMK (deoxythymidylate kinase [Source:HGNC Symbol;Acc:HGNC:3061])

HSP 1 Score: 174.096 bits (440), Expect = 5.265e-49
Identity = 76/182 (41.76%), Postives = 120/182 (65.93%), Query Frame = 2
Query: 1088 RKQLFVVLEGLDRSGKSTQVEKLREYFLNLNLKANVIKFPDRETEIGQMIDCYLKKKTNIVDQVIHLLFTANRWEKVDKINSMLAMNEIIICDRYSFSGIAYSAAKDTVDVKWCQAVEMNLPRPDIVFFLDISLDKSIMRQGFGDERYELKEFQKRVKENFNLLIKENPYNDNWKVINADQT 1633
            R+   +VLEG+DR+GKSTQ  KL E       +A +++FP+R TEIG+++  YL+KK+++ D  +HLLF+ANRWE+V  I   L+    ++ DRY+FSG+A++ AK+   + WC+  ++ LP+PD+V FL + L  +  R  FG ERYE   FQ+R    F+ L+K+     NWK+++A ++
Sbjct:    4 RRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQERALRCFHQLMKDTTL--NWKMVDASKS 183          
BLAST of Thymidylate kinase vs. Ensembl Human
Match: DTYMK (deoxythymidylate kinase [Source:HGNC Symbol;Acc:HGNC:3061])

HSP 1 Score: 115.931 bits (289), Expect = 6.113e-29
Identity = 58/180 (32.22%), Postives = 93/180 (51.67%), Query Frame = 2
Query: 1211 RETEIGQMIDCYLKKKTNIVDQVIHLLFTANRWEKV---------------------------------------DKINSMLAMNEIIICDRYSFSGIAYSAAKDTVDVKWCQAVEMNLPRPDIVFFLDISLDKSIMRQGFGDERYELKEFQKRVKENFNLLIKENPYNDNWKVINADQT 1633
            R TEIG+++  YL+KK+++ D  +HLLF+ANRWE+V                                         I   L+    ++ DRY+FSG+A++ AK+   + WC+  ++ LP+PD+V FL + L  +  R  FG ERYE   FQ+R    F+ L+K+     NWK+++A ++
Sbjct:    2 RSTEIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVFILVAQTGVQWGDLGSLQPTPRRFKRFSCLSLSSSCDHRPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQERALRCFHQLMKDTTL--NWKMVDASKS 179          
BLAST of Thymidylate kinase vs. Ensembl Human
Match: DTYMK (deoxythymidylate kinase [Source:HGNC Symbol;Acc:HGNC:3061])

HSP 1 Score: 107.842 bits (268), Expect = 2.429e-26
Identity = 55/161 (34.16%), Postives = 90/161 (55.90%), Query Frame = 2
Query: 1151 KLREYFLNLNLKANVIKFPDRETEIGQMIDCYLKKKTNIVDQVIHLLFTANRWEKVDKINSMLAMNEIIICDRYSFSGIAYSAAKDTVDVKWCQAVEMNLPRPDIVFFLDISLDKSIMRQGFGDERYELKEFQKRVKENFNLLIKENPYNDNWKVINADQT 1633
            KL E       +A +++FP+R TEIG+++  YL+KK+++ D  +HLLF+ANRWE+V        ++  +  D +S                WC+  ++ LP+PD+V FL + L  +  R  FG ERYE   FQ+R    F+ L+K+     NWK+++A ++
Sbjct:    2 KLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQV-----RFPLHSTLNVDNFSLD--------------WCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQERALRCFHQLMKDTTL--NWKMVDASKS 141          
BLAST of Thymidylate kinase vs. Ensembl Human
Match: DTYMK (deoxythymidylate kinase [Source:HGNC Symbol;Acc:HGNC:3061])

HSP 1 Score: 90.5077 bits (223), Expect = 2.320e-21
Identity = 38/77 (49.35%), Postives = 57/77 (74.03%), Query Frame = 2
Query: 1088 RKQLFVVLEGLDRSGKSTQVEKLREYFLNLNLKANVIKFPDRETEIGQMIDCYLKKKTNIVDQVIHLLFTANRWEKV 1318
            R+   +VLEG+DR+GKSTQ  KL E       +A +++FP+R TEIG+++  YL+KK+++ D  +HLLF+ANRWE+V
Sbjct:    4 RRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQV 80          
BLAST of Thymidylate kinase vs. Ensembl Human
Match: DTYMK (deoxythymidylate kinase [Source:HGNC Symbol;Acc:HGNC:3061])

HSP 1 Score: 80.4925 bits (197), Expect = 1.188e-17
Identity = 35/74 (47.30%), Postives = 52/74 (70.27%), Query Frame = 2
Query: 1121 DRSGKSTQVEKLREYFLNLNLKANVIKFPDRETEIGQMIDCYLKKKTNIVDQVIHLLFTANRWEKVDKINSMLA 1342
            DR+GKSTQ  KL E       +A +++FP+R TEIG+++  YL+KK+++ D  +HLLF+ANRWE+V  +  M A
Sbjct:    2 DRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVQGLCVMQA 75          
BLAST of Thymidylate kinase vs. Ensembl Celegans
Match: dtmk-1 (Thymidylate kinase [Source:UniProtKB/Swiss-Prot;Acc:Q22018])

HSP 1 Score: 139.428 bits (350), Expect = 2.999e-37
Identity = 73/189 (38.62%), Postives = 114/189 (60.32%), Query Frame = 2
Query: 1088 RKQLFVVLEGLDRSGKSTQVEKLREYF---------LNLNLKANVIKFPDRETEIGQMIDCYLKKKTNIVDQVIHLLFTANRWEKVDKINSMLAMNEIIICDRYSFSGIAYSAAKDTVDVKWCQAVEMNLPRPDIVFFLDISLDKSIMRQGFGDERYELKEFQKRVKENFNLLIKENPYNDNWKVINAD 1627
            ++ L +V EGLDRSGKSTQ ++L E            + +  A +  FPDR + IG++ID YL+K+ ++ +  +HLLF+A+R+ K   I   +A    +ICDRY +SG+AYS AK   + +W ++ ++ LP+PD V F D+S + +  R GFG+ER E    Q++V      L +++ Y   WK +NAD
Sbjct:    6 KRGLLIVFEGLDRSGKSTQAKRLVESINKKSTESGDASSSPSAVLQAFPDRSSSIGKLIDQYLRKEIDMDEHALHLLFSADRFSKNQMIRDNIAKGIDVICDRYCYSGVAYSLAKGLPE-QWVRSSDVGLPKPDAVLFFDVSPEVAAQRGGFGEERLETATIQQKVAAVMPTL-RDDAY---WKTVNAD 189          
BLAST of Thymidylate kinase vs. Ensembl Celegans
Match: dtmk-1 (Thymidylate kinase [Source:UniProtKB/Swiss-Prot;Acc:Q22018])

HSP 1 Score: 139.428 bits (350), Expect = 2.999e-37
Identity = 73/189 (38.62%), Postives = 114/189 (60.32%), Query Frame = 2
Query: 1088 RKQLFVVLEGLDRSGKSTQVEKLREYF---------LNLNLKANVIKFPDRETEIGQMIDCYLKKKTNIVDQVIHLLFTANRWEKVDKINSMLAMNEIIICDRYSFSGIAYSAAKDTVDVKWCQAVEMNLPRPDIVFFLDISLDKSIMRQGFGDERYELKEFQKRVKENFNLLIKENPYNDNWKVINAD 1627
            ++ L +V EGLDRSGKSTQ ++L E            + +  A +  FPDR + IG++ID YL+K+ ++ +  +HLLF+A+R+ K   I   +A    +ICDRY +SG+AYS AK   + +W ++ ++ LP+PD V F D+S + +  R GFG+ER E    Q++V      L +++ Y   WK +NAD
Sbjct:    6 KRGLLIVFEGLDRSGKSTQAKRLVESINKKSTESGDASSSPSAVLQAFPDRSSSIGKLIDQYLRKEIDMDEHALHLLFSADRFSKNQMIRDNIAKGIDVICDRYCYSGVAYSLAKGLPE-QWVRSSDVGLPKPDAVLFFDVSPEVAAQRGGFGEERLETATIQQKVAAVMPTL-RDDAY---WKTVNAD 189          
BLAST of Thymidylate kinase vs. Ensembl Fly
Match: CG5757 (gene:FBgn0034299 transcript:FBtr0086787)

HSP 1 Score: 147.132 bits (370), Expect = 6.539e-40
Identity = 73/172 (42.44%), Postives = 103/172 (59.88%), Query Frame = 2
Query: 1085 NRKQLFVVLEGLDRSGKSTQVEKLREYFLNLNLKANVIKFPDRETEIGQMIDCYLKKKTNIVDQVIHLLFTANRWEKVDKINSMLAMNEIIICDRYSFSGIAYSAAKDTVDVKWCQAVEMNLPRPDIVFFLDISLDKSIMRQGFGDERYELKEFQKRVKENFN-LLIKENPY 1597
             ++   ++ EG DRSGK+TQ   L E   +  +    + FP+R + IGQ+I+ YL    ++ D+VIHL+F+ANRWE ++++   L     ++ DRYSFSG+AYSAAK  +D  WC A E  L +PD VF+L    +    R  +G ERYE  EFQ RV E FN +  KE  Y
Sbjct:    4 GKRGALIIFEGCDRSGKTTQSRLLVELLKSKGIPTLPMNFPERSSSIGQVINSYLTNSKDLPDEVIHLMFSANRWEHINQVKEKLLEGTTLVVDRYSFSGVAYSAAKG-LDFDWCYAPERGLIKPDAVFYLRAPPNDLTHRGQYGKERYEKVEFQGRVAEVFNRICSKEGSY 174          
BLAST of Thymidylate kinase vs. Ensembl Fly
Match: CG5757 (gene:FBgn0034299 transcript:FBtr0329995)

HSP 1 Score: 147.132 bits (370), Expect = 6.539e-40
Identity = 73/172 (42.44%), Postives = 103/172 (59.88%), Query Frame = 2
Query: 1085 NRKQLFVVLEGLDRSGKSTQVEKLREYFLNLNLKANVIKFPDRETEIGQMIDCYLKKKTNIVDQVIHLLFTANRWEKVDKINSMLAMNEIIICDRYSFSGIAYSAAKDTVDVKWCQAVEMNLPRPDIVFFLDISLDKSIMRQGFGDERYELKEFQKRVKENFN-LLIKENPY 1597
             ++   ++ EG DRSGK+TQ   L E   +  +    + FP+R + IGQ+I+ YL    ++ D+VIHL+F+ANRWE ++++   L     ++ DRYSFSG+AYSAAK  +D  WC A E  L +PD VF+L    +    R  +G ERYE  EFQ RV E FN +  KE  Y
Sbjct:    4 GKRGALIIFEGCDRSGKTTQSRLLVELLKSKGIPTLPMNFPERSSSIGQVINSYLTNSKDLPDEVIHLMFSANRWEHINQVKEKLLEGTTLVVDRYSFSGVAYSAAKG-LDFDWCYAPERGLIKPDAVFYLRAPPNDLTHRGQYGKERYEKVEFQGRVAEVFNRICSKEGSY 174          
BLAST of Thymidylate kinase vs. Ensembl Zebrafish
Match: dtymk (deoxythymidylate kinase (thymidylate kinase) [Source:ZFIN;Acc:ZDB-GENE-990603-11])

HSP 1 Score: 169.088 bits (427), Expect = 1.689e-47
Identity = 78/186 (41.94%), Postives = 123/186 (66.13%), Query Frame = 2
Query: 1088 RKQLFVVLEGLDRSGKSTQVEKLREYFLNLNLKANVIKFPDRETEIGQMIDCYLKKKTNIVDQVIHLLFTANRWEKVDKINSMLAMNEIIICDRYSFSGIAYSAAKDTVDVKWCQAVEMNLPRPDIVFFLDISLDKSIMRQGFGDERYELKEFQKRVKENFNLLIKENPYNDNWKVINADQTPSEV 1645
            R+   +VLEG+DR+GK+TQ +KL +        A +++FPDR T+IGQ+I  YL+KK+N+ D  +HLLF+ANRWE V  +   L     ++ DRY+FSG+A+++AK    ++WC   ++ LP+PD+V FL ++ + +  R  +G+ERYE   FQ+ V++ F  L+++     NWKVI+A +T  EV
Sbjct:    4 RRGALIVLEGVDRAGKTTQCQKLVQAIQQSGRAAEIMRFPDRTTKIGQLISSYLEKKSNLEDHTVHLLFSANRWEMVPVMKQKLEEGINLVVDRYAFSGVAFTSAKPGFSLEWCMNPDVGLPKPDLVMFLQLNPNVAANRGEYGNERYETSAFQRTVQQRFEELMQDTSI--NWKVIDAARTIEEV 187          
BLAST of Thymidylate kinase vs. Ensembl Xenopus
Match: aqp3 (aquaporin 3 (Gill blood group) [Source:Xenbase;Acc:XB-GENE-488014])

HSP 1 Score: 170.244 bits (430), Expect = 1.006e-47
Identity = 76/177 (42.94%), Postives = 118/177 (66.67%), Query Frame = 2
Query: 1100 FVVLEGLDRSGKSTQVEKLREYFLNLNLKANVIKFPDRETEIGQMIDCYLKKKTNIVDQVIHLLFTANRWEKVDKINSMLAMNEIIICDRYSFSGIAYSAAKDTVDVKWCQAVEMNLPRPDIVFFLDISLDKSIMRQGFGDERYELKEFQKRVKENFNLLIKENPYNDNWKVINADQ 1630
             +VLEG DR+GKSTQ  +L E       K   ++FP+R TEIG++I  YL+KK+N+ D  IHLLF+ANRWE+V  I   L     ++ DRY+FSG+A++++K+  D+ WC+  ++ LP+PD+V FL++S + +  R GFG+E YE   FQ++V + +  L+++     NW +I+A Q
Sbjct:    8 LIVLEGADRAGKSTQARRLVEALKERGYKTEGLRFPERTTEIGRLIGSYLEKKSNLEDHTIHLLFSANRWEQVPMIKEKLRSGVTLVIDRYAFSGVAFTSSKENFDLHWCKQPDVGLPKPDLVLFLNVSPEVAASRGGFGNEIYETNSFQEKVSKRYAELMEDKTV--NWTLIDASQ 182          
BLAST of Thymidylate kinase vs. Ensembl Mouse
Match: Dtymk (deoxythymidylate kinase [Source:MGI Symbol;Acc:MGI:108396])

HSP 1 Score: 159.458 bits (402), Expect = 5.464e-44
Identity = 87/216 (40.28%), Postives = 133/216 (61.57%), Query Frame = 2
Query: 1085 NRKQLFVVLEGLDRSGKSTQVEKLREYFLNLNLKANVIKFPDRETEIGQMIDCYLKKKTNIVDQVIHLLFTANRWEKVDKINSMLAMNEIIICDRYSFSGIAYSAAKDTVDVKWCQAVEMNLPRPDIVFFLDISLDKSIMRQGFGDERYELKEFQKRVKENFNLLIKENPYNDNWKVINADQTPSEV---INGKVSNFITN--QSPLSL*YFQCWK 1717
            +R+   +VLEG+DR+GK+TQ  KL         +A +++FP+R TEIG++++ YL+KKT + D  +HLLF+ANRWE+V  I + L     ++ DRY+FSG+A++ AK+   + WC+  ++ LP+PD++ FL + L  +  R  FG ERYE   FQK+V   F  L++E   N NWKV++A ++  EV   I     + I N  Q PL     + WK
Sbjct:    3 SRRGALIVLEGVDRAGKTTQGLKLVTALCASGHRAELLRFPERSTEIGKLLNSYLEKKTELEDHSVHLLFSANRWEQVPLIKAKLNQGVTLVLDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPDLILFLQLQLLDAAARGEFGLERYETGTFQKQVLLCFQQLMEEK--NLNWKVVDASKSIEEVHKEIRAHSEDAIRNAAQRPLG----ELWK 212          
BLAST of Thymidylate kinase vs. Ensembl Mouse
Match: Dtymk (deoxythymidylate kinase [Source:MGI Symbol;Acc:MGI:108396])

HSP 1 Score: 85.8853 bits (211), Expect = 6.637e-20
Identity = 37/78 (47.44%), Postives = 57/78 (73.08%), Query Frame = 2
Query: 1085 NRKQLFVVLEGLDRSGKSTQVEKLREYFLNLNLKANVIKFPDRETEIGQMIDCYLKKKTNIVDQVIHLLFTANRWEKV 1318
            +R+   +VLEG+DR+GK+TQ  KL         +A +++FP+R TEIG++++ YL+KKT + D  +HLLF+ANRWE+V
Sbjct:    3 SRRGALIVLEGVDRAGKTTQGLKLVTALCASGHRAELLRFPERSTEIGKLLNSYLEKKTELEDHSVHLLFSANRWEQV 80          
BLAST of Thymidylate kinase vs. Ensembl Mouse
Match: Dtymk (deoxythymidylate kinase [Source:MGI Symbol;Acc:MGI:108396])

HSP 1 Score: 77.411 bits (189), Expect = 4.326e-16
Identity = 54/158 (34.18%), Postives = 83/158 (52.53%), Query Frame = 2
Query: 1289 LFTANRWEKVDKINSMLAMNEII----------ICDRYSFSGIAYSAAKDTVDVKWCQAVEMNLPRPDIVFFLDISLDKSIMRQGFGDERYELKEFQKRVKENFNLLIKENPYNDNWKVINADQTPSEV---INGKVSNFITN--QSPLSL*YFQCWK 1717
              T + W+ V  + S+L    +I          + DRY+FSG+A++ AK+   + WC+  ++ LP+PD++ FL + L  +  R  FG ERYE   FQK+V   F  L++E   N NWKV++A ++  EV   I     + I N  Q PL     + WK
Sbjct:    3 FLTWDSWKPVPGLRSILFFRPLIKAKLNQGVTLVLDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPDLILFLQLQLLDAAARGEFGLERYETGTFQKQVLLCFQQLMEEK--NLNWKVVDASKSIEEVHKEIRAHSEDAIRNAAQRPLG----ELWK 154          
BLAST of Thymidylate kinase vs. UniProt/SwissProt
Match: sp|Q0WW55|ZEUS1_ARATH (Thymidylate kinase OS=Arabidopsis thaliana OX=3702 GN=ZEU1 PE=2 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 1.233e-49
Identity = 93/206 (45.15%), Postives = 126/206 (61.17%), Query Frame = 2
Query: 1100 FVVLEGLDRSGKSTQVEKLREYFLNLNLKANVIKFPDRETEIGQMIDCYLKKKTNIVDQVIHLLFTANRWEKVDKINSMLAMNEIIICDRYSFSGIAYSAAKDTVDVKWCQAVEMNLPRPDIVFFLDISLDKSIMRQGFGDERYELKEFQKRVKENFNLLIKENPYNDNWKVINADQTPSEVINGKVSNFITNQ-------SPLSL 1696
             +VLEGLDRSGKSTQ  KL  +   L     + +FPDRET +GQMI  YL  K+ + D  IHLLF+ANRWEK   +   L     +I DRYS+SG+A+S+AK  +D++WC+A E+ L  PD V +LDIS +++  R G+GDERYE  EFQK+V + +  L      + +WK+INA     EV   K+   + +Q        PLSL
Sbjct:   61 LIVLEGLDRSGKSTQCAKLLSFLNGLGHPTELWRFPDRETSVGQMISAYLSNKSQLDDHTIHLLFSANRWEKRSLMEEKLKTGTTLIVDRYSYSGVAFSSAKG-LDIEWCKAPEIGLLAPDSVLYLDISPERAAERGGYGDERYERVEFQKKVADFYQTL-----GDSSWKIINASDAMEEV-EKKIQQVVLDQVKECTEGKPLSL 259          
BLAST of Thymidylate kinase vs. UniProt/SwissProt
Match: sp|Q54GN2|KTHY_DICDI (Thymidylate kinase OS=Dictyostelium discoideum OX=44689 GN=dtymk PE=3 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 3.079e-49
Identity = 86/191 (45.03%), Postives = 128/191 (67.02%), Query Frame = 2
Query: 1082 MNRKQLFVVLEGLDRSGKSTQVEKLREYFLNLN-LKANVIKFPDRETEIGQMIDCYLKKKTNIVDQVIHLLFTANRWEKVDKINSMLAMNEIIICDRYSFSGIAYSAAKDTVDVKWCQAVEMNLPRPDIVFFLDISLDKSIMRQGFGDERYELKEFQKRVKENFNLLIKENPYNDNWKVINADQTPSEVIN 1651
            M ++ LF++ EG+DR GKSTQV+ L  +  N+  L    ++FPDR T IGQ+I+ YL+  TN+ D+ +HLLF++NRWE  D I  +L     I+ DRYS+SG+AYSAAK  +D  WC A E  LP+PD++F+L +S + +  R  +G ERYE  EFQK++K+    + +E   +D WK+INA+++  E+ N
Sbjct:   15 MIKRGLFILFEGVDRVGKSTQVQSLTNHISNVQKLPTKSLRFPDRTTPIGQIINQYLQNATNMDDRALHLLFSSNRWEARDSILELLNNGTNIVVDRYSYSGVAYSAAKG-IDFDWCYACEKGLPKPDLIFYLSMSSEDATKRGEYGGERYEKLEFQKKIKQ----IYEEKLVDDQWKIINANRSIDEISN 200          
BLAST of Thymidylate kinase vs. UniProt/SwissProt
Match: sp|P23919|KTHY_HUMAN (Thymidylate kinase OS=Homo sapiens OX=9606 GN=DTYMK PE=1 SV=4)

HSP 1 Score: 174.096 bits (440), Expect = 2.529e-48
Identity = 76/182 (41.76%), Postives = 120/182 (65.93%), Query Frame = 2
Query: 1088 RKQLFVVLEGLDRSGKSTQVEKLREYFLNLNLKANVIKFPDRETEIGQMIDCYLKKKTNIVDQVIHLLFTANRWEKVDKINSMLAMNEIIICDRYSFSGIAYSAAKDTVDVKWCQAVEMNLPRPDIVFFLDISLDKSIMRQGFGDERYELKEFQKRVKENFNLLIKENPYNDNWKVINADQT 1633
            R+   +VLEG+DR+GKSTQ  KL E       +A +++FP+R TEIG+++  YL+KK+++ D  +HLLF+ANRWE+V  I   L+    ++ DRY+FSG+A++ AK+   + WC+  ++ LP+PD+V FL + L  +  R  FG ERYE   FQ+R    F+ L+K+     NWK+++A ++
Sbjct:    4 RRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQERALRCFHQLMKDTTL--NWKMVDASKS 183          
BLAST of Thymidylate kinase vs. UniProt/SwissProt
Match: sp|P36590|KTHY_SCHPO (Thymidylate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tmp1 PE=2 SV=2)

HSP 1 Score: 160.999 bits (406), Expect = 1.011e-43
Identity = 88/203 (43.35%), Postives = 131/203 (64.53%), Query Frame = 2
Query: 1073 LYQMNRKQLFVVLEGLDRSGKSTQVEKLREYFLNLNLKANVIKFPDRETEIGQMIDCYLKKKTNIVDQVIHLLFTANRWEKVDKINSMLAMNEIIICDRYSFSGIAYSAAKDTVDVKWCQAVEMNLPRPDIVFFLDISLDKSIMRQGFGDERYELKEFQKRVKENFNLLIKENPYNDNWKVINADQTPS-EVINGKVSNFITN 1678
            + + NR +L +V+EGLDRSGKSTQ + L +  ++ + KA + KFPDR T IG+ ID YLK+   + DQVIHLLF+ANRWE +  I   +      I DRY+FSGIA+SAAK  +D +WC++ +  LPRPD+V FL++    +  R  +G+ERYE  E Q++V +NF  L KE    +  + I  D + S E ++ ++ + ++N
Sbjct:    1 MSKQNRGRL-IVIEGLDRSGKSTQCQLLVDKLISQHEKAELFKFPDRTTAIGKKIDDYLKESVQLNDQVIHLLFSANRWETIQYIYEQINKGVTCILDRYAFSGIAFSAAK-GLDWEWCKSPDRGLPRPDLVIFLNVDPRIAATRGQYGEERYEKIEMQEKVLKNFQRLQKEF-REEGLEFITLDASSSLEDVHSQIVDLVSN 200          
BLAST of Thymidylate kinase vs. UniProt/SwissProt
Match: sp|P97930|KTHY_MOUSE (Thymidylate kinase OS=Mus musculus OX=10090 GN=Dtymk PE=1 SV=2)

HSP 1 Score: 159.458 bits (402), Expect = 3.822e-43
Identity = 87/216 (40.28%), Postives = 133/216 (61.57%), Query Frame = 2
Query: 1085 NRKQLFVVLEGLDRSGKSTQVEKLREYFLNLNLKANVIKFPDRETEIGQMIDCYLKKKTNIVDQVIHLLFTANRWEKVDKINSMLAMNEIIICDRYSFSGIAYSAAKDTVDVKWCQAVEMNLPRPDIVFFLDISLDKSIMRQGFGDERYELKEFQKRVKENFNLLIKENPYNDNWKVINADQTPSEV---INGKVSNFITN--QSPLSL*YFQCWK 1717
            +R+   +VLEG+DR+GK+TQ  KL         +A +++FP+R TEIG++++ YL+KKT + D  +HLLF+ANRWE+V  I + L     ++ DRY+FSG+A++ AK+   + WC+  ++ LP+PD++ FL + L  +  R  FG ERYE   FQK+V   F  L++E   N NWKV++A ++  EV   I     + I N  Q PL     + WK
Sbjct:    3 SRRGALIVLEGVDRAGKTTQGLKLVTALCASGHRAELLRFPERSTEIGKLLNSYLEKKTELEDHSVHLLFSANRWEQVPLIKAKLNQGVTLVLDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPDLILFLQLQLLDAAARGEFGLERYETGTFQKQVLLCFQQLMEEK--NLNWKVVDASKSIEEVHKEIRAHSEDAIRNAAQRPLG----ELWK 212          
BLAST of Thymidylate kinase vs. TrEMBL
Match: A0A3G3CAW7 (Thymidylate kinase OS=Fowlpox virus OX=10261 PE=3 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 4.965e-53
Identity = 98/186 (52.69%), Postives = 129/186 (69.35%), Query Frame = 2
Query: 1088 RKQLFVVLEGLDRSGKSTQVEKLREYFLNLNLKANVIKFPDRETEIGQMIDCYLKKKTNIVDQVIHLLFTANRWEKVDKINSMLAMNEIIICDRYSFSGIAYSAAKDTVDVKWCQAVEMNLPRPDIVFFLDISLDKSIMRQGFGDERYELKEFQKRVKENFNLLIKENPYNDNWKVINADQTPSEV 1645
            ++ +F+VLEGLDRSGK+ Q EKL +Y L    KA  +KFPDRETEIG++I+ YL+KK NI D+ IHLLF+ANRWE+ D I   L  N  ++ DRY+FSG A++AAK+ V ++WC+  +  LP PD+V FLDI   KS  R+ FG ERYE   FQ  VK  F  LIK N  + NWKVI+A +T  ++
Sbjct:    2 QRGMFIVLEGLDRSGKTIQCEKLLKYMLEKGYKAESLKFPDRETEIGKVINSYLEKKVNINDRAIHLLFSANRWERADLIKKKLESNINLVVDRYAFSGAAFTAAKNNVSLEWCKLTDSGLPLPDLVIFLDIPASKSSDRENFGMERYETVSFQDEVKRCFYDLIKSND-SVNWKVIDATKTIEDI 186          
BLAST of Thymidylate kinase vs. TrEMBL
Match: A0A4Y7Q901 (Thymidylate kinase OS=Rickenella mellea OX=50990 GN=BD410DRAFT_787099 PE=3 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 2.316e-52
Identity = 89/183 (48.63%), Postives = 127/183 (69.40%), Query Frame = 2
Query: 1088 RKQLFVVLEGLDRSGKSTQVEKLREYFLNLNLKANVIKFPDRETEIGQMIDCYLKKKTNIVDQVIHLLFTANRWEKVDKINSMLAMNEIIICDRYSFSGIAYSAAKDTVDVKWCQAVEMNLPRPDIVFFLDISLDKSIMRQGFGDERYELKEFQKRVKENFNLLIKENPYN--DNWKVINADQ 1630
            ++  F+V+EGLDRSGKSTQ   L+    N N+   ++KFPDR T +G+MID YL+ ++++ D+ IHLLF+ANRWE V  I S LA    IICDRY+FSG+A+SAAK  + + WC++ +++LP PD+  FLDIS D +  R G+G+ERYE +E Q+RV+  F+ L  E P +    W VI+A +
Sbjct:    5 QRGAFIVIEGLDRSGKSTQAALLQSRLQNANVSVKLMKFPDRTTPVGKMIDAYLRSQSDVDDRTIHLLFSANRWEAVSSIESTLAAGTTIICDRYAFSGVAFSAAKG-LPLAWCRSPDVSLPAPDLTLFLDISPDIAKSRGGYGEERYEKEELQRRVRNIFHQLGDELPKDGAGRWAVIDAGR 186          
BLAST of Thymidylate kinase vs. TrEMBL
Match: A0A167ZMA6 (Thymidylate kinase OS=Moelleriella libera RCEF 2490 OX=1081109 GN=AAL_05881 PE=3 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 6.781e-52
Identity = 88/165 (53.33%), Postives = 117/165 (70.91%), Query Frame = 2
Query: 1091 KQLFVVLEGLDRSGKSTQVEKLREYFLNLNLKANVIKFPDRETEIGQMIDCYLKKKTNIVDQVIHLLFTANRWEKVDKINSMLAMNEIIICDRYSFSGIAYSAAKD--TVDVKWCQAVEMNLPRPDIVFFLDISLDKSIMRQGFGDERYELKEFQKRVKENFNLL 1579
            +  F+VLEGLDRSGK+TQV++L E F+    K  V++FPDR T IGQMID YLK  +++ D VIHLLF+ANRWE V++I S+LA    ++CDRY +SGI YSAAK   T+ + W +A E  LPRPD+V FLD+  + +  R G+G+E YE  E Q+RV+E F  L
Sbjct:   14 RGAFIVLEGLDRSGKTTQVKRLEERFVQAGHKVAVMRFPDRTTPIGQMIDSYLKSNSSLEDHVIHLLFSANRWEAVERIKSLLAAGTTVLCDRYYYSGIVYSAAKQNPTLSLSWARAPERGLPRPDMVLFLDLDEEAASSRGGWGNEIYEKAEMQRRVRELFRAL 178          
BLAST of Thymidylate kinase vs. TrEMBL
Match: A0A0D7BNP2 (Thymidylate kinase OS=Cylindrobasidium torrendii FP15055 ss-10 OX=1314674 GN=CYLTODRAFT_486920 PE=3 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 1.172e-51
Identity = 94/204 (46.08%), Postives = 132/204 (64.71%), Query Frame = 2
Query: 1091 KQLFVVLEGLDRSGKSTQVEKLREYFLNLNLKANVIKFPDRETEIGQMIDCYLKKKTNIVDQVIHLLFTANRWEKVDKINSMLAMNEIIICDRYSFSGIAYSAAKDTVDVKWCQAVEMNLPRPDIVFFLDISLDKSIMRQGFGDERYELKEFQKRVKENFNLLIKENPYNDNWKVINA----DQTPSEVINGKVSNFITNQSPL 1690
            +  F+V+EGLDRSGK+TQ+  L E+ ++L  K   IKFPDR T IG+MID YLK + +I D  IHLLF+ANRWE V KI  +L     I+CDRY+FSGIA+SA+K  +   WC+  ++ LP PD+V FLD+S + +  R G+G+ERYE +E QKRV+E F  +      +  W+V+NA    DQ   ++ N   + F   + P+
Sbjct:    3 RGAFIVIEGLDRSGKTTQIAALYEHLISLGKKVEQIKFPDRTTAIGKMIDAYLKSQADIDDHAIHLLFSANRWESVSKILKLLEEGTTILCDRYAFSGIAFSASKG-LPFDWCKTPDVGLPEPDMVLFLDVSPEVAQERGGYGEERYEKEEMQKRVREEFVRVRDCGGRSLRWEVVNAGRAKDQVELDIRNATQALFNGVEGPI 205          
BLAST of Thymidylate kinase vs. TrEMBL
Match: A0A1V0QGB5 (SWPV2-ORF158 OS=Shearwaterpox virus OX=1974596 GN=SWPV2-158 PE=3 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 1.363e-51
Identity = 95/186 (51.08%), Postives = 129/186 (69.35%), Query Frame = 2
Query: 1088 RKQLFVVLEGLDRSGKSTQVEKLREYFLNLNLKANVIKFPDRETEIGQMIDCYLKKKTNIVDQVIHLLFTANRWEKVDKINSMLAMNEIIICDRYSFSGIAYSAAKDTVDVKWCQAVEMNLPRPDIVFFLDISLDKSIMRQGFGDERYELKEFQKRVKENFNLLIKENPYNDNWKVINADQTPSEV 1645
            ++ +F+VLEGLDRSGK+ Q EKL +Y L    K   +KFP+RETEIG++I+ YL+KK NI D+ IHLLF+ANRWE  D I   L+ N  +I DRY+FSG A++AAK+ V ++WC+  +  LP PD+V FLDIS  +S  R+ FG ERYE   FQ  V++ F  LIK    + NWKVI+A +T  ++
Sbjct:    2 QRGMFIVLEGLDRSGKTVQCEKLLQYMLEKGYKTESLKFPNRETEIGKVINSYLEKKININDRAIHLLFSANRWELADLIKDKLSHNINLIVDRYAFSGAAFTAAKNNVSLEWCKLTDSGLPLPDLVIFLDISASESSDRENFGMERYETASFQDEVRKRFYDLIKGTD-SINWKVIDATKTIEDI 186          
BLAST of Thymidylate kinase vs. Ensembl Cavefish
Match: dtymk (deoxythymidylate kinase [Source:NCBI gene;Acc:103022277])

HSP 1 Score: 175.252 bits (443), Expect = 1.068e-49
Identity = 81/186 (43.55%), Postives = 123/186 (66.13%), Query Frame = 2
Query: 1088 RKQLFVVLEGLDRSGKSTQVEKLREYFLNLNLKANVIKFPDRETEIGQMIDCYLKKKTNIVDQVIHLLFTANRWEKVDKINSMLAMNEIIICDRYSFSGIAYSAAKDTVDVKWCQAVEMNLPRPDIVFFLDISLDKSIMRQGFGDERYELKEFQKRVKENFNLLIKENPYNDNWKVINADQTPSEV 1645
            R+ + +VLEG+DR+GKSTQ  +L +       +A +I+FPDR T+IGQ+I  YL+KK+N+ D  +HLLF+ANRWE V  I   L     ++ DRY+FSG+A+++AK    + WC+  ++ LP+PD+V FL +S + +  R  FG ERYE+  FQ+ V++ F  +   N  + NWKVI+A ++  EV
Sbjct:    4 RRGVLIVLEGVDRAGKSTQCARLVQALQQNGRRAEIIRFPDRTTQIGQLISSYLEKKSNLEDHTVHLLFSANRWELVPLIREKLEQGINLVVDRYAFSGVAFTSAKPGFSLDWCKQPDVGLPKPDLVMFLQLSPEVAAQRGQFGAERYEISSFQQTVQQRFEEI--RNDTSINWKVIDASRSIEEV 187          
BLAST of Thymidylate kinase vs. Ensembl Yeast
Match: CDC8 (Thymidylate and uridylate kinase; functions in de novo biosynthesis of pyrimidine deoxyribonucleotides; converts dTMP to dTDP and dUMP to dUTP; essential for mitotic and meiotic DNA replication; homologous to S. pombe tmp1; human homolog DTYMK can complement yeast cdc8 null mutant [Source:SGD;Acc:S000003818])

HSP 1 Score: 140.584 bits (353), Expect = 2.013e-38
Identity = 80/174 (45.98%), Postives = 112/174 (64.37%), Query Frame = 2
Query: 1082 MNRKQLFVVLEGLDRSGKSTQVEKLREYFLNLNLKANVIKFPDRETEIGQMIDCYLKKKT-NIVDQVIHLLFTANRWEKVDKINSMLAMNEIIICDRYSFSGIAYSAAKDT--VDVKWCQAVEMNLPRPDIVFFLDIS-LDKSIMRQGFGDERYELKEFQKRVKENF-NLLIKE 1588
            M R +L +++EGLDR+GK+TQ   L   +  L     ++KFP+R T IG +I+ YL   +  + DQ IHLLF+ANRWE VDKI   L   + I+ DRY +SG+AYSAAK T  +D+ WC   ++ L +PD+  FL    +D +  + GFGDERYE  +FQ++VK+ F  LL KE
Sbjct:    2 MGRGKL-ILIEGLDRTGKTTQCNIL---YKKLQPNCKLLKFPERSTRIGGLINEYLTDDSFQLSDQAIHLLFSANRWEIVDKIKKDLLEGKNIVMDRYVYSGVAYSAAKGTNGMDLDWCLQPDVGLLKPDLTLFLSTQDVDNNAEKSGFGDERYETVKFQEKVKQTFMKLLDKE 171          
BLAST of Thymidylate kinase vs. Ensembl Nematostella
Match: EDO39969 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8M7])

HSP 1 Score: 176.792 bits (447), Expect = 1.170e-50
Identity = 82/188 (43.62%), Postives = 118/188 (62.77%), Query Frame = 2
Query: 1082 MNRKQLFVVLEGLDRSGKSTQVEKLREYFLNLNLKANVIKFPDRETEIGQMIDCYLKKKTNIVDQVIHLLFTANRWEKVDKINSMLAMNEIIICDRYSFSGIAYSAAKDTVDVKWCQAVEMNLPRPDIVFFLDISLDKSIMRQGFGDERYELKEFQKRVKENFNLLIKENPYNDNWKVINADQTPSEV 1645
            ++ +   +  EG DRSGKSTQ   L +Y  +L      ++FPDR T IGQ I+ YL+  + + D  IHLLF+ANRWE V KI S+L     I+ DRY+FSG+A+++AK   D++WC+A +  LP PDIV FLDIS+D +  R  +G ERYE  +FQ+ V   +  L       D+WKV++A ++  E+
Sbjct:    3 LSTRGALICFEGCDRSGKSTQSRLLVDYLRSLGTNIEHMRFPDRSTAIGQCINSYLQGTSELDDHAIHLLFSANRWESVSKIRSLLNTGTTIVVDRYAFSGVAFTSAKKGFDLEWCKAPDRGLPAPDIVIFLDISVDNAAERSEYGGERYETSDFQRSVANRYKEL-----QADSWKVLDAGKSIEEL 185          
BLAST of Thymidylate kinase vs. Ensembl Medaka
Match: dtymk (deoxythymidylate kinase [Source:NCBI gene;Acc:101155671])

HSP 1 Score: 169.088 bits (427), Expect = 1.715e-47
Identity = 77/186 (41.40%), Postives = 121/186 (65.05%), Query Frame = 2
Query: 1088 RKQLFVVLEGLDRSGKSTQVEKLREYFLNLNLKANVIKFPDRETEIGQMIDCYLKKKTNIVDQVIHLLFTANRWEKVDKINSMLAMNEIIICDRYSFSGIAYSAAKDTVDVKWCQAVEMNLPRPDIVFFLDISLDKSIMRQGFGDERYELKEFQKRVKENFNLLIKENPYNDNWKVINADQTPSEV 1645
            ++   +VLEG+DR+GK+TQ + L +        A  ++FPDR T IGQ+I  YL+KK+ + D  +HLLF+ANRWE V  +   L     ++ DRY+FSG A+++AK    ++WC   ++ LP+PD+V FL +S  ++ +R  FG ERYE + FQ  V++ F LL+K++  + NW+VI+A ++  EV
Sbjct:    4 QRGALIVLEGVDRAGKTTQCKMLVQALQKSGRPAEAMRFPDRTTTIGQLISAYLEKKSELEDHTVHLLFSANRWELVPTMKKKLEQGITLVVDRYAFSGAAFTSAKPGFSLEWCMKPDVGLPKPDLVMFLQLSPAEAALRGQFGVERYETRVFQNAVQQKFELLMKDS--SVNWQVIDASKSVEEV 187          
BLAST of Thymidylate kinase vs. Ensembl Medaka
Match: dtymk (deoxythymidylate kinase [Source:NCBI gene;Acc:101155671])

HSP 1 Score: 163.31 bits (412), Expect = 1.223e-45
Identity = 77/193 (39.90%), Postives = 120/193 (62.18%), Query Frame = 2
Query: 1100 FVVLEGLDRSGKSTQVEKLREYFLNLNLKANVIKFPDRETEIGQMIDCYLKKKTNIVDQVIHLLFTANRWEKVDKINSMLAMNEIIICDRYSFSGIAYSAAKDTVDVKWCQAVEMNLPRPDIVFFLDISLDKSIMRQGFGDERYELKEFQKRVKENFNLLIKENPYNDNWKVINADQTPSEVINGKVSNFITN 1678
             +VLEG+DR+GK+TQ + L +        A  ++FPDR T IGQ+I  YL+KK+ + D  +HLLF+ANRWE V  +   L     ++ DRY+FSG A+++AK    ++WC   ++ LP+PD+V FL +S  ++ +R  FG ERYE + FQ  V++ F LL+K++  + NW+V +        +  +VS FI +
Sbjct:    8 LIVLEGVDRAGKTTQCKMLVQALQKSGRPAEAMRFPDRTTTIGQLISAYLEKKSELEDHTVHLLFSANRWELVPTMKKKLEQGITLVVDRYAFSGAAFTSAKPGFSLEWCMKPDVGLPKPDLVMFLQLSPAEAALRGQFGVERYETRVFQNAVQQKFELLMKDS--SVNWQVQDG-------LGCRVSPFIVS 191          
BLAST of Thymidylate kinase vs. Planmine SMEST
Match: SMESG000016181.1 (SMESG000016181.1)

HSP 1 Score: 380.948 bits (977), Expect = 2.344e-127
Identity = 187/188 (99.47%), Postives = 187/188 (99.47%), Query Frame = 2
Query: 1082 MNRKQLFVVLEGLDRSGKSTQVEKLREYFLNLNLKANVIKFPDRETEIGQMIDCYLKKKTNIVDQVIHLLFTANRWEKVDKINSMLAMNEIIICDRYSFSGIAYSAAKDTVDVKWCQAVEMNLPRPDIVFFLDISLDKSIMRQGFGDERYELKEFQKRVKENFNLLIKENPYNDNWKVINADQTPSEV 1645
            MNRK LFVVLEGLDRSGKSTQVEKLREYFLNLNLKANVIKFPDRETEIGQMIDCYLKKKTNIVDQVIHLLFTANRWEKVDKINSMLAMNEIIICDRYSFSGIAYSAAKDTVDVKWCQAVEMNLPRPDIVFFLDISLDKSIMRQGFGDERYELKEFQKRVKENFNLLIKENPYNDNWKVINADQTPSEV
Sbjct:    1 MNRK-LFVVLEGLDRSGKSTQVEKLREYFLNLNLKANVIKFPDRETEIGQMIDCYLKKKTNIVDQVIHLLFTANRWEKVDKINSMLAMNEIIICDRYSFSGIAYSAAKDTVDVKWCQAVEMNLPRPDIVFFLDISLDKSIMRQGFGDERYELKEFQKRVKENFNLLIKENPYNDNWKVINADQTPSEV 187          
BLAST of Thymidylate kinase vs. Planmine SMEST
Match: SMESG000016255.1 (SMESG000016255.1)

HSP 1 Score: 80.1073 bits (196), Expect = 2.919e-17
Identity = 44/61 (72.13%), Postives = 46/61 (75.41%), Query Frame = 3
Query:   21 MIKIYLAFSICVELLLALTMIKEIDDYIYVGGKLLF*NN*F*IDYFRNNLAKYVESNGKVS 203
            MIKIYLAFSICVELLLALTMIKEI+DYIYVGGK              NNLAKYVESNGK+ 
Sbjct:    1 MIKIYLAFSICVELLLALTMIKEIEDYIYVGGK--------------NNLAKYVESNGKLE 47          

HSP 2 Score: 55.4546 bits (132), Expect = 1.083e-8
Identity = 24/27 (88.89%), Postives = 25/27 (92.59%), Query Frame = -3
Query: 1669 LNATVRDSAFDFQHWKYHRLSGDWLVM 1749
            LNATVRDSAFDFQHW+YH  SGDWLVM
Sbjct:   99 LNATVRDSAFDFQHWRYHTPSGDWLVM 125          
BLAST of Thymidylate kinase vs. Planmine SMEST
Match: SMESG000010584.1 (SMESG000010584.1)

HSP 1 Score: 59.3066 bits (142), Expect = 1.212e-8
Identity = 24/27 (88.89%), Postives = 25/27 (92.59%), Query Frame = -3
Query: 1669 LNATVRDSAFDFQHWKYHRLSGDWLVM 1749
            LNATVRDSAFDFQHW+YH  SGDWLVM
Sbjct: 1156 LNATVRDSAFDFQHWRYHTPSGDWLVM 1182          
BLAST of Thymidylate kinase vs. Planmine SMEST
Match: SMESG000010584.1 (SMESG000010584.1)

HSP 1 Score: 59.3066 bits (142), Expect = 1.489e-8
Identity = 24/27 (88.89%), Postives = 25/27 (92.59%), Query Frame = -3
Query: 1669 LNATVRDSAFDFQHWKYHRLSGDWLVM 1749
            LNATVRDSAFDFQHW+YH  SGDWLVM
Sbjct: 1046 LNATVRDSAFDFQHWRYHTPSGDWLVM 1072          
BLAST of Thymidylate kinase vs. Planmine SMEST
Match: SMESG000010584.1 (SMESG000010584.1)

HSP 1 Score: 58.9214 bits (141), Expect = 1.659e-8
Identity = 24/27 (88.89%), Postives = 25/27 (92.59%), Query Frame = -3
Query: 1669 LNATVRDSAFDFQHWKYHRLSGDWLVM 1749
            LNATVRDSAFDFQHW+YH  SGDWLVM
Sbjct: 1041 LNATVRDSAFDFQHWRYHTPSGDWLVM 1067          
The following BLAST results are available for this feature:
BLAST of Thymidylate kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DTYMK5.265e-4941.76deoxythymidylate kinase [Source:HGNC Symbol;Acc:HG... [more]
DTYMK6.113e-2932.22deoxythymidylate kinase [Source:HGNC Symbol;Acc:HG... [more]
DTYMK2.429e-2634.16deoxythymidylate kinase [Source:HGNC Symbol;Acc:HG... [more]
DTYMK2.320e-2149.35deoxythymidylate kinase [Source:HGNC Symbol;Acc:HG... [more]
DTYMK1.188e-1747.30deoxythymidylate kinase [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Thymidylate kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dtmk-12.999e-3738.62Thymidylate kinase [Source:UniProtKB/Swiss-Prot;A... [more]
dtmk-12.999e-3738.62Thymidylate kinase [Source:UniProtKB/Swiss-Prot;A... [more]
back to top
BLAST of Thymidylate kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG57576.539e-4042.44gene:FBgn0034299 transcript:FBtr0086787[more]
CG57576.539e-4042.44gene:FBgn0034299 transcript:FBtr0329995[more]
back to top
BLAST of Thymidylate kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dtymk1.689e-4741.94deoxythymidylate kinase (thymidylate kinase) [Sour... [more]
back to top
BLAST of Thymidylate kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
aqp31.006e-4742.94aquaporin 3 (Gill blood group) [Source:Xenbase;Acc... [more]
back to top
BLAST of Thymidylate kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Dtymk5.464e-4440.28deoxythymidylate kinase [Source:MGI Symbol;Acc:MGI... [more]
Dtymk6.637e-2047.44deoxythymidylate kinase [Source:MGI Symbol;Acc:MGI... [more]
Dtymk4.326e-1634.18deoxythymidylate kinase [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Thymidylate kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q0WW55|ZEUS1_ARATH1.233e-4945.15Thymidylate kinase OS=Arabidopsis thaliana OX=3702... [more]
sp|Q54GN2|KTHY_DICDI3.079e-4945.03Thymidylate kinase OS=Dictyostelium discoideum OX=... [more]
sp|P23919|KTHY_HUMAN2.529e-4841.76Thymidylate kinase OS=Homo sapiens OX=9606 GN=DTYM... [more]
sp|P36590|KTHY_SCHPO1.011e-4343.35Thymidylate kinase OS=Schizosaccharomyces pombe (s... [more]
sp|P97930|KTHY_MOUSE3.822e-4340.28Thymidylate kinase OS=Mus musculus OX=10090 GN=Dty... [more]
back to top
BLAST of Thymidylate kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3G3CAW74.965e-5352.69Thymidylate kinase OS=Fowlpox virus OX=10261 PE=3 ... [more]
A0A4Y7Q9012.316e-5248.63Thymidylate kinase OS=Rickenella mellea OX=50990 G... [more]
A0A167ZMA66.781e-5253.33Thymidylate kinase OS=Moelleriella libera RCEF 249... [more]
A0A0D7BNP21.172e-5146.08Thymidylate kinase OS=Cylindrobasidium torrendii F... [more]
A0A1V0QGB51.363e-5151.08SWPV2-ORF158 OS=Shearwaterpox virus OX=1974596 GN=... [more]
back to top
BLAST of Thymidylate kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dtymk1.068e-4943.55deoxythymidylate kinase [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of Thymidylate kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Thymidylate kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
CDC82.013e-3845.98Thymidylate and uridylate kinase; functions in de ... [more]
back to top
BLAST of Thymidylate kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO399691.170e-5043.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Thymidylate kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dtymk1.715e-4741.40deoxythymidylate kinase [Source:NCBI gene;Acc:1011... [more]
dtymk1.223e-4539.90deoxythymidylate kinase [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Thymidylate kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016181.12.344e-12799.47SMESG000016181.1[more]
SMESG000016255.12.919e-1772.13SMESG000016255.1[more]
SMESG000010584.11.212e-888.89SMESG000010584.1[more]
SMESG000010584.11.489e-888.89SMESG000010584.1[more]
SMESG000010584.11.659e-888.89SMESG000010584.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016384 ID=SMED30016384|Name=Thymidylate kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=2591bp
TTTGTTTTGTTTATTATCAAATGATTAAAATTTATTTAGCGTTTTCAATT
TGCGTAGAGTTACTTTTAGCACTGACAATGATTAAAGAGATTGACGATTA
TATTTATGTCGGTGGAAAGTTGCTTTTTTAGAATAATTAATTTTGAATTG
ACTATTTTAGGAATAATTTAGCTAAATATGTCGAATCGAATGGGAAAGTT
AGTTAATAATATGAAGTTTATTGCATAATTTTATATATTATTTGATATAA
ATGTTCCTGTTTAGCTATTTGGCTTTTTTAAAATATTTCAATCATTTTGG
TGTTTATATTGATTGATTTAGGCTATAATTGTGAGGCGATTCACATTTAA
TTCAAAAGATTTTCGTCCTTGAGACTATCAACAATATTAATTATCGATTT
AATGGGATGCAGTTACACTGGGGTAACGGGGGGAGGGATGGGGTAAAGCT
GAATGGCGACATTTATAAGGGAAAATAAACACCTGCCATTCCGATATTCA
ATAATTCTTGGCTGGAATTAGATTAAAAGTTTTAAATAAGTCTTTCACCG
CTTGTAAACTCGTTTCCTTCCCGTTCCGGAAGCTGCTTATAACCGAACCG
TAAAATCAATAATATTATATCGTTCTGCTGAAATCCCCAAGAAACGAGCA
GTTGATTCAGACAAATTTACGATCTCAACAAGTTCATTTCCAGTTGGAAA
AAAGTTTATTGTTGGTTTGAATATCGAAAAAGTCGAGTAAAATTGCATTT
GTTCATTGATTGAGTTCCAATGAAGGAAATTAACAGCTGGCAACATAGAT
GGAAATGTTAGCAATATTGCAATTGAATCGCTGCAATAAATAACTCATAG
TCTGATCTCCATAGTTGCCAGTAGCATTAGCAGAATTCACCTATGATTCT
TCAATTGATATTCTCCAGTGCCAAAATTTCACTTATTTACCGCAATAAAT
TCCCCCTTTTATCGGTTTCTTCTTTGCTTTCTACTGATGTCAATAATTTA
TCTGCGTCACGAAAATTTATAGATTTTCACGTATAATAAATTTGCATAAA
GCTAACCTAGCTTATCGTTTTACTTTATCAAATGAATAGAAAACAATTAT
TTGTTGTACTTGAAGGATTGGATAGATCGGGAAAGAGTACACAAGTTGAA
AAGCTTCGAGAATATTTTTTAAATTTAAATCTTAAAGCCAATGTTATAAA
ATTCCCAGATCGCGAAACTGAAATAGGTCAAATGATAGATTGCTATTTGA
AAAAGAAAACCAATATTGTTGATCAAGTAATTCACTTGTTATTTACAGCC
AACCGGTGGGAAAAAGTTGATAAAATCAACTCCATGTTGGCAATGAATGA
AATCATCATTTGTGATCGGTATTCGTTTTCTGGAATTGCCTACTCTGCAG
CTAAAGATACAGTCGATGTGAAATGGTGTCAGGCAGTTGAGATGAATCTC
CCCAGGCCGGATATTGTCTTTTTTTTGGACATTTCTTTAGATAAAAGTAT
CATGCGACAGGGATTCGGAGATGAAAGATATGAACTAAAAGAATTCCAAA
AGCGTGTAAAAGAAAATTTTAATTTATTAATTAAAGAGAATCCTTATAAT
GATAATTGGAAAGTAATTAATGCCGATCAAACTCCTTCTGAAGTAATTAA
TGGGAAAGTAAGTAATTTCATAACTAACCAATCGCCACTGAGCCTGTGAT
ATTTCCAATGCTGGAAATCAAATGCGCTATCTCTCACGGTGGCATTCAAG
CTGGATTATAATAATTTGAGCAGAAAGTGCTGCACATGTTTAGTGCTTCC
AAGTGACAGTTTCCCATTGATTGGCAAGAAGTGCAAGTGAATGCAAGCAT
GTGTTTGCAGTAAGCGAACGGAGTAGGGTAGGATAAGCCAGCGGAGTCCC
ATCTAACTACTACAGGAAGTAATGTTTTCTTTTTTATAAAGTTTCCCGAG
AAAATCGAATGGGCAAGAAAAAAAGTTGATTAATTATAGAGATCAATTCT
GTCAAATTCCCAGTTTAAATGAGCTCATCATCTTCACGAACATTAATTCA
TTTTCCATATGATTTTCCATATGATTCCCTACAGCAGATCTTCTGATAAT
CCACAGCATTAGTCAGACCGCGTTTATAAACGCTTTGATAATAATTTGCA
GTAGGCGAACTGAGCATATCAATGTAAGCTTTCGGTTCAAGAAATGTCAT
TCCGACTGATGAAATGCCTGGTGATGTCGAATCTCAGGGACGGTATAGAT
GCCGTGCTGGGTAGCCAATAGTTGAGAATGGGATCATTGGTGTCCTTTCG
TTGGTGTCCTTTTGTGACTTGCCTTTGTCAGAAACCGAGCTGACGACACG
CAGAAAACATTCGCAGCTGTGACTAGTTTAAAGGCAATAACGATCTCACC
TCTAACGGAACAACAGAGAGAGGTTACTCGTGGAAACCGAAAAGAATATC
GTAACCAGTAATATAACTGGAGACATTGTAAATGTTTCTCATTGATAATT
GTGTTATTAGAATTGTTGCGTTCGTCTTTGTTGCTATTTTGTTTGAGAAT
TAAATTCTTTTTTTTTGTATTATTGGTAAGCAATTTCTCAG
back to top

protein sequence of SMED30016384-orf-1

>SMED30016384-orf-1 ID=SMED30016384-orf-1|Name=SMED30016384-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=206bp
MNRKQLFVVLEGLDRSGKSTQVEKLREYFLNLNLKANVIKFPDRETEIGQ
MIDCYLKKKTNIVDQVIHLLFTANRWEKVDKINSMLAMNEIIICDRYSFS
GIAYSAAKDTVDVKWCQAVEMNLPRPDIVFFLDISLDKSIMRQGFGDERY
ELKEFQKRVKENFNLLIKENPYNDNWKVINADQTPSEVINGKVSNFITNQ
SPLSL*
back to top

protein sequence of SMED30016384-orf-2

>SMED30016384-orf-2 ID=SMED30016384-orf-2|Name=SMED30016384-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=102bp
EKLLTNNTKKKNLILKQNSNKDERNNSNNTIINEKHLQCLQLYYWLRYSF
RFPRVTSLCCSVRGEIVIAFKLVTAANVFCVSSARFLTKASHKRTPTKGH
Q*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0046940nucleoside monophosphate phosphorylation
GO:0006233dTDP biosynthetic process
GO:0016310phosphorylation
GO:0046939nucleotide phosphorylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000429neoblast
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR027417P-loop_NTPase
IPR018095Thymidylate_kin_CS
Vocabulary: molecular function
TermDefinition
GO:0004798thymidylate kinase activity
GO:0005524ATP binding
GO:0016301kinase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 10..27