Coiled-coil domain containing 112

Overview
NameCoiled-coil domain containing 112
Smed IDSMED30016383
Length (bp)1544
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Coiled-coil domain containing 112 (SMED30016383) t-SNE clustered cells

Violin plots show distribution of expression levels for Coiled-coil domain containing 112 (SMED30016383) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Coiled-coil domain containing 112 (SMED30016383) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Coiled-coil domain containing 112 (SMED30016383) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016383

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30016383SMESG000011105.1 SmedASXL_008898SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30016383SMESG000011105.1 dd_Smed_v4_12448_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30016383SMESG000011105.1 dd_Smed_v4_12448_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30016383SMESG000011105.1 dd_Smed_v6_12448_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30016383SMESG000011105.1 dd_Smed_v4_12448_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Coiled-coil domain containing 112 vs. Ensembl Human
Match: CCDC112 (coiled-coil domain containing 112 [Source:HGNC Symbol;Acc:HGNC:28599])

HSP 1 Score: 140.584 bits (353), Expect = 6.155e-36
Identity = 127/469 (27.08%), Postives = 246/469 (52.45%), Query Frame = 1
Query:   94 LESNIESYLGNNRN---VSHDFLTKFLNEFRQNSKFRSSDCDKLKNRVINIRLKIEKFKLSIENIQPNEEFVSSIKGXXXXXXXXXXXXKREQKDSYENLLRSEVSLWQECIFMEKKINSWVSGDNDRE--VEPPKPQLVSDLINKANKEKNAVIALQKYLDETGGKTGGWSTLDHQTFLRIRLKYTGICQTAEVSYPRDEDIFYSDLMSLLAPKTVNDVKTHEMWYRKYQELVSEKKKAISEWK---QQKSKQMKTVEMEIDETPKLSVKIDWETQKKRLEN---QRQALDFWRAEKALEEHRLXXXXXXXXXXXXXXXXXXXXXXXXXMRQMVDEYKQRKQAEDGEKRELALRLWEMSRE-----DKKRQIETHSARINERNTRMVEDKLIKQHQKQFEKERKIQRLNKLSEQVAITARRDPSRLLKPTSGWINRLTDTDENCSAGGISSGIRITNVQHKAVPAWRR 1452
            +E +  S+  N ++   + H  L +  N+   +   R ++  K++ ++  I   ++K +  +++++P  +FV  ++ ++EEIE  I   K EQ+  YE L++ E +   E   + +KI++W  G+++ E        ++  D +  +   +  V+  +K+L +TGG+ G W   DHQ F+++R K+ G            +  F  +++  L  KT ++V+ HE WY+K+  L   KK++I  WK   QQK +++  ++ + D TP L      + QK++ E    Q+ A++ W+ +K++E   +K   +  E+EE E+K +++   + +++ +++ Y Q+K+ +     E  LRL +  RE     +K++      +R  ER+   +E K++ +  K+ EK +K +RL KL E+V     RDPSRL KPT GW       +E     G +    + ++ H+A+P WR+
Sbjct:    1 MEKDKHSHFYNQKSDFRIEHSMLEELENKLIHS---RKTERAKIQQQLAKIHNNVKKLQHQLKDVKPTPDFVEKLREMMEEIENAINTFKEEQRLIYEELIKEEKTTNNELSAISRKIDTWALGNSETEKAFRAISSKVPVDKVTPSTLPEE-VLDFEKFLQQTGGRQGAWDDYDHQNFVKVRNKHKG------------KPTFMEEVLEHLPGKTQDEVQQHEKWYQKFLALEERKKESIQIWKTKKQQKREEIFKLKEKADNTPVLFHNKQEDNQKQKEEQRKKQKLAVEAWKKQKSIE-MSMKCASQLKEEEEKEKKHQKERQRQFKLKLLLESYTQQKKEQ-----EEFLRLEKEIREKAEKAEKRKNAADEISRFQERDLHKLELKILDRQAKEDEKSQKQRRLAKLKEKVENNVSRDPSRLYKPTKGW-------EERTKKIGPTGSGPLLHIPHRAIPTWRQ 440          
BLAST of Coiled-coil domain containing 112 vs. Ensembl Human
Match: CCDC112 (coiled-coil domain containing 112 [Source:HGNC Symbol;Acc:HGNC:28599])

HSP 1 Score: 140.584 bits (353), Expect = 6.155e-36
Identity = 127/469 (27.08%), Postives = 246/469 (52.45%), Query Frame = 1
Query:   94 LESNIESYLGNNRN---VSHDFLTKFLNEFRQNSKFRSSDCDKLKNRVINIRLKIEKFKLSIENIQPNEEFVSSIKGXXXXXXXXXXXXKREQKDSYENLLRSEVSLWQECIFMEKKINSWVSGDNDRE--VEPPKPQLVSDLINKANKEKNAVIALQKYLDETGGKTGGWSTLDHQTFLRIRLKYTGICQTAEVSYPRDEDIFYSDLMSLLAPKTVNDVKTHEMWYRKYQELVSEKKKAISEWK---QQKSKQMKTVEMEIDETPKLSVKIDWETQKKRLEN---QRQALDFWRAEKALEEHRLXXXXXXXXXXXXXXXXXXXXXXXXXMRQMVDEYKQRKQAEDGEKRELALRLWEMSRE-----DKKRQIETHSARINERNTRMVEDKLIKQHQKQFEKERKIQRLNKLSEQVAITARRDPSRLLKPTSGWINRLTDTDENCSAGGISSGIRITNVQHKAVPAWRR 1452
            +E +  S+  N ++   + H  L +  N+   +   R ++  K++ ++  I   ++K +  +++++P  +FV  ++ ++EEIE  I   K EQ+  YE L++ E +   E   + +KI++W  G+++ E        ++  D +  +   +  V+  +K+L +TGG+ G W   DHQ F+++R K+ G            +  F  +++  L  KT ++V+ HE WY+K+  L   KK++I  WK   QQK +++  ++ + D TP L      + QK++ E    Q+ A++ W+ +K++E   +K   +  E+EE E+K +++   + +++ +++ Y Q+K+ +     E  LRL +  RE     +K++      +R  ER+   +E K++ +  K+ EK +K +RL KL E+V     RDPSRL KPT GW       +E     G +    + ++ H+A+P WR+
Sbjct:    1 MEKDKHSHFYNQKSDFRIEHSMLEELENKLIHS---RKTERAKIQQQLAKIHNNVKKLQHQLKDVKPTPDFVEKLREMMEEIENAINTFKEEQRLIYEELIKEEKTTNNELSAISRKIDTWALGNSETEKAFRAISSKVPVDKVTPSTLPEE-VLDFEKFLQQTGGRQGAWDDYDHQNFVKVRNKHKG------------KPTFMEEVLEHLPGKTQDEVQQHEKWYQKFLALEERKKESIQIWKTKKQQKREEIFKLKEKADNTPVLFHNKQEDNQKQKEEQRKKQKLAVEAWKKQKSIE-MSMKCASQLKEEEEKEKKHQKERQRQFKLKLLLESYTQQKKEQ-----EEFLRLEKEIREKAEKAEKRKNAADEISRFQERDLHKLELKILDRQAKEDEKSQKQRRLAKLKEKVENNVSRDPSRLYKPTKGW-------EERTKKIGPTGSGPLLHIPHRAIPTWRQ 440          
BLAST of Coiled-coil domain containing 112 vs. Ensembl Human
Match: CCDC112 (coiled-coil domain containing 112 [Source:HGNC Symbol;Acc:HGNC:28599])

HSP 1 Score: 140.198 bits (352), Expect = 2.555e-35
Identity = 127/469 (27.08%), Postives = 246/469 (52.45%), Query Frame = 1
Query:   94 LESNIESYLGNNRN---VSHDFLTKFLNEFRQNSKFRSSDCDKLKNRVINIRLKIEKFKLSIENIQPNEEFVSSIKGXXXXXXXXXXXXKREQKDSYENLLRSEVSLWQECIFMEKKINSWVSGDNDRE--VEPPKPQLVSDLINKANKEKNAVIALQKYLDETGGKTGGWSTLDHQTFLRIRLKYTGICQTAEVSYPRDEDIFYSDLMSLLAPKTVNDVKTHEMWYRKYQELVSEKKKAISEWK---QQKSKQMKTVEMEIDETPKLSVKIDWETQKKRLEN---QRQALDFWRAEKALEEHRLXXXXXXXXXXXXXXXXXXXXXXXXXMRQMVDEYKQRKQAEDGEKRELALRLWEMSRE-----DKKRQIETHSARINERNTRMVEDKLIKQHQKQFEKERKIQRLNKLSEQVAITARRDPSRLLKPTSGWINRLTDTDENCSAGGISSGIRITNVQHKAVPAWRR 1452
            +E +  S+  N ++   + H  L +  N+   +   R ++  K++ ++  I   ++K +  +++++P  +FV  ++ ++EEIE  I   K EQ+  YE L++ E +   E   + +KI++W  G+++ E        ++  D +  +   +  V+  +K+L +TGG+ G W   DHQ F+++R K+ G            +  F  +++  L  KT ++V+ HE WY+K+  L   KK++I  WK   QQK +++  ++ + D TP L      + QK++ E    Q+ A++ W+ +K++E   +K   +  E+EE E+K +++   + +++ +++ Y Q+K+ +     E  LRL +  RE     +K++      +R  ER+   +E K++ +  K+ EK +K +RL KL E+V     RDPSRL KPT GW       +E     G +    + ++ H+A+P WR+
Sbjct:   84 MEKDKHSHFYNQKSDFRIEHSMLEELENKLIHS---RKTERAKIQQQLAKIHNNVKKLQHQLKDVKPTPDFVEKLREMMEEIENAINTFKEEQRLIYEELIKEEKTTNNELSAISRKIDTWALGNSETEKAFRAISSKVPVDKVTPSTLPEE-VLDFEKFLQQTGGRQGAWDDYDHQNFVKVRNKHKG------------KPTFMEEVLEHLPGKTQDEVQQHEKWYQKFLALEERKKESIQIWKTKKQQKREEIFKLKEKADNTPVLFHNKQEDNQKQKEEQRKKQKLAVEAWKKQKSIE-MSMKCASQLKEEEEKEKKHQKERQRQFKLKLLLESYTQQKKEQ-----EEFLRLEKEIREKAEKAEKRKNAADEISRFQERDLHKLELKILDRQAKEDEKSQKQRRLAKLKEKVENNVSRDPSRLYKPTKGW-------EERTKKIGPTGSGPLLHIPHRAIPTWRQ 523          
BLAST of Coiled-coil domain containing 112 vs. Ensembl Human
Match: CCDC112 (coiled-coil domain containing 112 [Source:HGNC Symbol;Acc:HGNC:28599])

HSP 1 Score: 117.087 bits (292), Expect = 6.773e-28
Identity = 111/465 (23.87%), Postives = 226/465 (48.60%), Query Frame = 1
Query:   94 LESNIESYLGNNRN---VSHDFLTKFLNEFRQNSKFRSSDCDKLKNRVINIRLKIEKFKLSIENIQPNEEFVSSIKGXXXXXXXXXXXXKREQKDSYENLLRSEVSLWQECIFMEKKINSWVSGDNDRE--VEPPKPQLVSDLINKANKEKNAVIALQKYLDETGGKTGGWSTLDHQTFLRIRLKYTGICQTAEVSYPRDEDIFYSDLMSLLAPKTVNDVKTHEMWYRKYQELVSEKKKAISEW---KQQKSKQMKTVEMEIDETPKLSVKIDWETQKKRLEN---QRQALDFWRAEKALEEHRLXXXXXXXXXXXXXXXXXXXXXXXXXMRQMVDEYKQRKQAEDGEKRELALRLWEMSREDKKRQIETHSARINERNTRMVEDKLIKQHQKQFEKER-KIQRLNKLSEQVAITARRDPSRLLKPTSGWINRLTDTDENCSAGGISSGIRITNVQHKAVPAWRR 1452
            +E +  S+  N ++   + H  L +  N+   +   R ++  K++ ++  I   ++K +  +++++P  +FV  ++ ++EEIE  I   K EQ+  YE L++ E +   E   + +KI++W  G+++ E        ++  D +  +   +  V+  +K+L +TGG+ G W   DHQ F+++R K+ G            +  F  +++  L  KT ++V+ HE WY+K+  L   KK++I  W   KQQK +++  ++ + D TP L      + QK++ E    Q+ A++ W+ +K++E                        +  K   Q+ +E ++ K+ +   +R+  L+L           +E+++ +  E+   +  +K I++  ++ EK +     +++  E+V     RDPSRL KPT GW       +E     G +    + ++ H+A+P WR+
Sbjct:    1 MEKDKHSHFYNQKSDFRIEHSMLEELENKLIHS---RKTERAKIQQQLAKIHNNVKKLQHQLKDVKPTPDFVEKLREMMEEIENAINTFKEEQRLIYEELIKEEKTTNNELSAISRKIDTWALGNSETEKAFRAISSKVPVDKVTPSTLPEE-VLDFEKFLQQTGGRQGAWDDYDHQNFVKVRNKHKG------------KPTFMEEVLEHLPGKTQDEVQQHEKWYQKFLALEERKKESIQIWKTKKQQKREEIFKLKEKADNTPVLFHNKQEDNQKQKEEQRKKQKLAVEAWKKQKSIE------------------------MSMKCASQLKEEEEKEKKHQKERQRQFKLKLL----------LESYTQQKKEQEEFLRLEKEIREKAEKAEKRKNAADEISRFQERVENNVSRDPSRLYKPTKGW-------EERTKKIGPTGSGPLLHIPHRAIPTWRQ 408          
BLAST of Coiled-coil domain containing 112 vs. Ensembl Xenopus
Match: pggt1b (protein geranylgeranyltransferase type I, beta subunit [Source:NCBI gene;Acc:493499])

HSP 1 Score: 112.464 bits (280), Expect = 1.403e-25
Identity = 124/494 (25.10%), Postives = 252/494 (51.01%), Query Frame = 1
Query:   13 NLQMNFDDKNPQEIIKEIYKLNVKYRVLESNIESYLGNNRNVSHDFLTKF--LNEFRQN-SKFRSSDCDKLKNRVINIRLKIEKFKLSIENIQPNEEFVSSIKGXXXXXXXXXXXXKREQKDSYENLLRSEVSLWQECIFMEKKINSWVSGDNDREVEPPKPQLVSDLINKANKEKNAVIALQKYLDETGGKTGGWSTLDHQTFLRIRLKYTGICQTAEVSYPRDEDIFYSDLMSLLAPKTVNDVKTHEMWYRKYQELVSEKKKAISEWKQQKS---KQMKTVEMEIDETPKLSVKIDWETQKKRLENQR----QALDFWRAEKALEEHRLXXXXXXXXXXXXXXXXXXXXXXXXXMRQMVDEY-KQRKQAEDGEKRELALRLWEMSREDKKRQIETHSA-----RINERNTRMVEDKLIKQHQKQFEKERKIQRLNKLSEQVAITARRDPSRLLKPTSGWINRLTDTDENCSAGGISSGIRITNVQHKAVPAW 1446
            N ++  D     E  +E+ K+  +   LE +    L + +N   DF  ++  L E+ +  +  R ++  K K ++  I   +++ +  + +++P  EFV  ++ ++EE++  I   K EQ+  YE L++ E +   E   +EKKI   ++   ++    P  +  ++ +      +  V+  +++L +TGG+ GGW   DHQ+FL++  K+ G            +  +  + ++ L  +T  DV+ HE WY+++  L  +KK+AI EWK +K     ++  ++++  E  + + +   E+QK++ E ++    Q L+ W+ +K ++    +I+ +  E+EE  +K+R++   + E++ +V+E+ + RK+ ED       L L +  +E+ +++     A     R  +R+ R +E+K  ++  K+  ++ K +RL KL E+V +   RDPSRL K T GW       +E C   G S    + ++ H+   A+
Sbjct:   28 NWKIKADQAKKAEYFRELEKIKGQIANLEKDKNGNLYSKKN---DFRAEYSVLEEYEEKLACSRRAEKLKAKQQLSKIHNHVKRLQRQLIDVKPTPEFVEKLRVMMEEVDNAICTFKEEQRIIYEELMKEEKTTSNELNVLEKKIEGSLNTAPEKTFRAPCGKTPAEKMTSCQLPEEVVV-FERFLQQTGGRLGGWDDFDHQSFLKVWTKHKG------------KATYLEEALAYLPSRTREDVQQHEAWYQEFLFLEEKKKEAIQEWKAKKQLEKGEIVKLQIKAKEIQQFNRQKQEESQKQKTEEEKRRKQQELEAWKRQKEIDA-AAQIQAKIKEEEEQLKKQRKERQRQLEVKLLVEEHIRIRKEKED------FLLLEKQMQEEMEQEERRKMAVFEICRFQDRDLRKLEEKAQERRAKEKSEDEKERRLAKLKEKVQVHVDRDPSRLCKLTKGW-------EERCKETGPSGSAPLQHIPHRLTIAF 491          
BLAST of Coiled-coil domain containing 112 vs. Ensembl Mouse
Match: Ccdc112 (coiled-coil domain containing 112 [Source:MGI Symbol;Acc:MGI:1918800])

HSP 1 Score: 139.428 bits (350), Expect = 3.031e-35
Identity = 138/489 (28.22%), Postives = 255/489 (52.15%), Query Frame = 1
Query:   49 EIIKEIYKLNVKYRVLESNIESYLGNNRNVSHDFLTKF--LNEFRQ---NSKFRSSDCDKLKNRVINIRLKIEKFKLSIENIQPNEEFVSSIKGXXXXXXXXXXXXKREQKDSYENLLRSEVSLWQECIFMEKKINSWVSGDND-----REVEPPKPQLVSDLINKANKEKNAVIALQKYLDETGGKTGGWSTLDHQTFLRIRLKYTGICQTAEVSYPRDEDIFYSDLMSLLAPKTVNDVKTHEMWYRKYQELVSEKKKAISEWKQQKSKQMKTV---EMEIDETPKLSVKIDWETQKKRLEN---QRQALDFWRAEKALEEHRLXXXXXXXXXXXXXXXXXXXXXXXXXMRQMVDEYKQRKQAEDGEKRELALRLWEMSRE-----DKKRQIETHSARINERNTRMVEDKLIKQHQKQFEKERKIQRLNKLSEQVAITARRDPSRLLKPTSGWINRLTDTDENCSAGGISSGIRITNVQHKAVPAWRR 1452
            E I+   K   +  V+E +  S+  N R    DF T++  L E      NS  R ++  K++ ++  I   ++K +  +++++P  +FV  ++ ++EEIE  I   K EQ+  YE L++ E +   E   + ++I SW  G+++     R +    P  V  +  +   E+  V+  +K+L +TGG+ GGW  LDHQ F+++R K+ G            +  F  +++  L  +T+++V+ HE WY+K+  L  +KK++I  WK +K ++ + +   + ++D  P  S     ++ K+R E    Q+ A++ W+  K+LE    K+  +  E+EE ERK++ +   + +++ +++ Y Q+++     ++E  LRL +  +E     +K++      AR  ER+   +E K++ +  K+ EK  K +RL KL E+V     RDPSRL KPT GW       +E     G S    + ++ H+A+P WR+
Sbjct:   69 EFIRTAEKFKNQVIVIEKDKHSHFYNQRG---DFRTEYNMLEELENKLINS--RKTERAKIQQQLAKIHNNVKKLQNQLKDVKPTPDFVEKLREMMEEIENAINTFKEEQRLIYEELIQEEKTTNNELSAVSRRIESWALGNSETEKAFRAISSKVP--VDRVTQRTLPEQ--VVEFEKFLQQTGGRQGGWDALDHQNFVKVRNKHKG------------KPTFMKEVVEHLPGRTLDEVQQHEKWYQKFLTLEEKKKESIQNWKTKKQQKKEEILKLKEKVDTVPLPSQSKAEDSPKQREEQRKKQKLAVEAWKKRKSLE-MSAKLASQLREEEEKERKQQRERQRQSKLKLLLESYTQQRR-----EQEEFLRLEQEIKEKAEKAEKRKTAADELARFQERDLHKLELKILDRQAKEEEKAEKQRRLTKLKEKVENNVSRDPSRLYKPTKGW-------EERTKKIGPSGSGPLLHIPHRAIPTWRQ 523          
BLAST of Coiled-coil domain containing 112 vs. Ensembl Mouse
Match: Ccdc112 (coiled-coil domain containing 112 [Source:MGI Symbol;Acc:MGI:1918800])

HSP 1 Score: 58.5362 bits (140), Expect = 2.285e-9
Identity = 33/102 (32.35%), Postives = 56/102 (54.90%), Query Frame = 1
Query:  352 KREQKDSYENLLRSEVSLWQECIFMEKKINSWVSGDND-----REVEPPKPQLVSDLINKANKEKNAVIALQKYLDETGGKTGGWSTLDHQTFLRIRLKYTG 642
            K EQ+  YE L++ E +   E   + ++I SW  G+++     R +    P  V  +  +   E+  V+  +K+L +TGG+ GGW  LDHQ F+++R K+ G
Sbjct:  116 KEEQRLIYEELIQEEKTTNNELSAVSRRIESWALGNSETEKAFRAISSKVP--VDRVTQRTLPEQ--VVEFEKFLQQTGGRQGGWDALDHQNFVKVRNKHKG 213          
BLAST of Coiled-coil domain containing 112 vs. Ensembl Mouse
Match: Ccdc112 (coiled-coil domain containing 112 [Source:MGI Symbol;Acc:MGI:1918800])

HSP 1 Score: 51.9878 bits (123), Expect = 3.912e-7
Identity = 66/258 (25.58%), Postives = 129/258 (50.00%), Query Frame = 1
Query:  697 DLMSLLAPKTVNDVKTHEMWYRKYQELVSEKKKAISEWKQQKSKQMKTV---EMEIDETPKLSVKIDWETQKKRLEN---QRQALDFWRAEKALEEHRLXXXXXXXXXXXXXXXXXXXXXXXXXMRQMVDEYKQRKQAEDGEKRELALRLWEMSREDKKRQIETHSARINERNTRMVEDKLIKQHQKQFEKERKIQRLNKLSEQVAITARRDPSRLLKPTSGWINRLTDTDENCSAGGISSGIRITNVQHKAVPAWRR 1452
            +++  L  +T+++V+ HE WY+K+  L  +KK++I  WK +K ++ + +   + ++D  P  S     ++ K+R E    Q+ A++ W+  K+L E   K+  +  E+EE ERK++ +   + +++ +++ Y Q+++     ++E  LRL        +++I+  + +  +R T   E                   L +  E+V     RDPSRL KPT GW       +E     G S    + ++ H+A+P WR+
Sbjct:    1 EVVEHLPGRTLDEVQQHEKWYQKFLTLEEKKKESIQNWKTKKQQKKEEILKLKEKVDTVPLPSQSKAEDSPKQREEQRKKQKLAVEAWKKRKSL-EMSAKLASQLREEEEKERKQQRERQRQSKLKLLLESYTQQRR-----EQEEFLRL--------EQEIKEKAEKAEKRKTAADE-------------------LARFQERVENNVSRDPSRLYKPTKGW-------EERTKKIGPSGSGPLLHIPHRAIPTWRQ 218          
BLAST of Coiled-coil domain containing 112 vs. UniProt/SwissProt
Match: sp|Q8NEF3|CC112_HUMAN (Coiled-coil domain-containing protein 112 OS=Homo sapiens OX=9606 GN=CCDC112 PE=1 SV=2)

HSP 1 Score: 140.584 bits (353), Expect = 2.956e-35
Identity = 127/469 (27.08%), Postives = 246/469 (52.45%), Query Frame = 1
Query:   94 LESNIESYLGNNRN---VSHDFLTKFLNEFRQNSKFRSSDCDKLKNRVINIRLKIEKFKLSIENIQPNEEFVSSIKGXXXXXXXXXXXXKREQKDSYENLLRSEVSLWQECIFMEKKINSWVSGDNDRE--VEPPKPQLVSDLINKANKEKNAVIALQKYLDETGGKTGGWSTLDHQTFLRIRLKYTGICQTAEVSYPRDEDIFYSDLMSLLAPKTVNDVKTHEMWYRKYQELVSEKKKAISEWK---QQKSKQMKTVEMEIDETPKLSVKIDWETQKKRLEN---QRQALDFWRAEKALEEHRLXXXXXXXXXXXXXXXXXXXXXXXXXMRQMVDEYKQRKQAEDGEKRELALRLWEMSRE-----DKKRQIETHSARINERNTRMVEDKLIKQHQKQFEKERKIQRLNKLSEQVAITARRDPSRLLKPTSGWINRLTDTDENCSAGGISSGIRITNVQHKAVPAWRR 1452
            +E +  S+  N ++   + H  L +  N+   +   R ++  K++ ++  I   ++K +  +++++P  +FV  ++ ++EEIE  I   K EQ+  YE L++ E +   E   + +KI++W  G+++ E        ++  D +  +   +  V+  +K+L +TGG+ G W   DHQ F+++R K+ G            +  F  +++  L  KT ++V+ HE WY+K+  L   KK++I  WK   QQK +++  ++ + D TP L      + QK++ E    Q+ A++ W+ +K++E   +K   +  E+EE E+K +++   + +++ +++ Y Q+K+ +     E  LRL +  RE     +K++      +R  ER+   +E K++ +  K+ EK +K +RL KL E+V     RDPSRL KPT GW       +E     G +    + ++ H+A+P WR+
Sbjct:    1 MEKDKHSHFYNQKSDFRIEHSMLEELENKLIHS---RKTERAKIQQQLAKIHNNVKKLQHQLKDVKPTPDFVEKLREMMEEIENAINTFKEEQRLIYEELIKEEKTTNNELSAISRKIDTWALGNSETEKAFRAISSKVPVDKVTPSTLPEE-VLDFEKFLQQTGGRQGAWDDYDHQNFVKVRNKHKG------------KPTFMEEVLEHLPGKTQDEVQQHEKWYQKFLALEERKKESIQIWKTKKQQKREEIFKLKEKADNTPVLFHNKQEDNQKQKEEQRKKQKLAVEAWKKQKSIE-MSMKCASQLKEEEEKEKKHQKERQRQFKLKLLLESYTQQKKEQ-----EEFLRLEKEIREKAEKAEKRKNAADEISRFQERDLHKLELKILDRQAKEDEKSQKQRRLAKLKEKVENNVSRDPSRLYKPTKGW-------EERTKKIGPTGSGPLLHIPHRAIPTWRQ 440          
BLAST of Coiled-coil domain containing 112 vs. UniProt/SwissProt
Match: sp|Q4R8R3|CC112_MACFA (Coiled-coil domain-containing protein 112 OS=Macaca fascicularis OX=9541 GN=CCDC112 PE=2 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 4.248e-34
Identity = 127/469 (27.08%), Postives = 247/469 (52.67%), Query Frame = 1
Query:   94 LESNIESYLGNNRN---VSHDFLTKFLNEFRQNSKFRSSDCDKLKNRVINIRLKIEKFKLSIENIQPNEEFVSSIKGXXXXXXXXXXXXKREQKDSYENLLRSEVSLWQECIFMEKKINSWVSGDNDRE--VEPPKPQLVSDLINKANKEKNAVIALQKYLDETGGKTGGWSTLDHQTFLRIRLKYTGICQTAEVSYPRDEDIFYSDLMSLLAPKTVNDVKTHEMWYRKYQELVSEKKKAISEWK---QQKSKQMKTVEMEIDETPKLSVKIDWETQKKRLEN---QRQALDFWRAEKALEEHRLXXXXXXXXXXXXXXXXXXXXXXXXXMRQMVDEYKQRKQAEDGEKRELALRLWEMSREDKKRQIETHSA-----RINERNTRMVEDKLIKQHQKQFEKERKIQRLNKLSEQVAITARRDPSRLLKPTSGWINRLTDTDENCSAGGISSGIRITNVQHKAVPAWRR 1452
            +E +  S+  N ++   + H  L +  N+   +   R ++  K++ ++  I   ++K +  +++++P  +FV  ++ ++EEIE  I   K EQ+  YE L++ E +   E   + +KI++W  G+++ E        ++  D +  +   +  V+  +K+L +TGG+ GGW   DHQ F+++R K+ G            +  F  +++  L  KT ++V+ HE WY+K+  L   KK++I  WK   QQK +++  +  + + TP L      + QK++ E    Q+ A++ W+ +K++E   +K      E+EE E+K++++   + +++ +++ Y Q+K+     ++E  LRL +  RE  ++  +  +A     R  ER+   +E K++ +  K+ EK +K +RL KL E+V     RDPSRL KPT GW       +E     G +    + ++ H+A+P WR+
Sbjct:    1 MEKDKHSHFYNQKSDFRIEHSMLEELENKLINS---RKTERAKIQQQLAKIHNNVKKLQHQLKDVKPTPDFVEKLREMMEEIENAINTFKEEQRLIYEELIKEEKTTNNELSAISRKIDTWALGNSETEKAFRAISSKVPVDKVTPSTLPEE-VLDFEKFLQQTGGRQGGWDDYDHQNFVKVRNKHKG------------KPTFMEEVLEHLPGKTQDEVQQHEKWYQKFLALEERKKESIQSWKTKKQQKREEIFKLNEKANNTPMLFHNKPEDNQKQKEEQRKKQKLAVEAWKKQKSIE-MSMKYASHLKEEEEKEKKRQKERQRQFKLKLLLESYTQQKK-----EQEEFLRLEKEKREKAEKAEKRKTAADGISRFQERDLHKLELKILDRQAKEDEKAQKQRRLAKLKEKVENNVSRDPSRLYKPTKGW-------EERTKKIGPTGSGPLLHIPHRAIPTWRQ 440          
BLAST of Coiled-coil domain containing 112 vs. UniProt/SwissProt
Match: sp|A0AUP1|CC112_MOUSE (Coiled-coil domain-containing protein 112 OS=Mus musculus OX=10090 GN=Ccdc112 PE=2 SV=2)

HSP 1 Score: 133.65 bits (335), Expect = 7.704e-33
Identity = 133/474 (28.06%), Postives = 248/474 (52.32%), Query Frame = 1
Query:   94 LESNIESYLGNNRNVSHDFLTKF--LNEFRQ---NSKFRSSDCDKLKNRVINIRLKIEKFKLSIENIQPNEEFVSSIKGXXXXXXXXXXXXKREQKDSYENLLRSEVSLWQECIFMEKKINSWVSGDND-----REVEPPKPQLVSDLINKANKEKNAVIALQKYLDETGGKTGGWSTLDHQTFLRIRLKYTGICQTAEVSYPRDEDIFYSDLMSLLAPKTVNDVKTHEMWYRKYQELVSEKKKAISEWKQQKSKQMKTV---EMEIDETPKLSVKIDWETQKKRLEN---QRQALDFWRAEKALEEHRLXXXXXXXXXXXXXXXXXXXXXXXXXMRQMVDEYKQRKQAEDGEKRELALRLWEMSRE-----DKKRQIETHSARINERNTRMVEDKLIKQHQKQFEKERKIQRLNKLSEQVAITARRDPSRLLKPTSGWINRLTDTDENCSAGGISSGIRITNVQHKAVPAWRR 1452
            +E +  S+  N R    DF T++  L E      NS  R ++  K++ ++  I   ++K +  +++++P  + V  ++ ++EEIE  I   K EQ+  YE L++ E +   E   + ++I SW  G+++     R +    P  V  +  +   E+  V+  +K+L +TGG+ GGW  LDHQ F+++R K+ G            +  F  +++  L  +T+++V+ HE WY+K+  L  +KK++I  WK +K ++ + +   + ++D  P  S     ++ K+R E    Q+ A++ W+  K+LE    K+  +  E+EE ERK++ +   + +++ +++ Y Q+++     ++E  LRL +  +E     +K++      AR  ER+   +E K++ +  K+ EK  K +RL KL E+V     RDPSRL KPT GW       +E     G S    + ++ H+A+P WR+
Sbjct:    1 MEKDKHSHFYNQRG---DFRTEYNMLEELENKLINS--RKTERAKIQQQLAKIHNNVKKLQNQLKDVKPTPDVVEKLREMMEEIENAINTFKEEQRLIYEELIQEEKTTNNELSAVSRRIESWALGNSETEKAFRAISSKVP--VDRVTQRTLPEQ--VVEFEKFLQQTGGRQGGWDALDHQNFVKVRNKHKG------------KPTFMKEVVEHLPGRTLDEVQQHEKWYQKFLTLEEKKKESIQNWKTKKQQKKEEILKLKEKVDTVPLPSQSKAEDSPKQREEQRKKQKLAVEAWKKRKSLE-MSAKLASQLREEEEKERKQQRERQRQSKLKLLLESYTQQRR-----EQEEFLRLEQEIKEKAEKAEKRKTAADELARFQERDLHKLELKILDRQAKEEEKAEKQRRLTKLKEKVENNVSRDPSRLYKPTKGW-------EERTKKIGPSGSGPLLHIPHRAIPTWRQ 440          
BLAST of Coiled-coil domain containing 112 vs. TrEMBL
Match: A0A1S3K0Q8 (coiled-coil domain-containing protein 112 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106177587 PE=4 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 1.511e-48
Identity = 158/506 (31.23%), Postives = 265/506 (52.37%), Query Frame = 1
Query:   10 HNLQMNFDDKNPQEIIKEIYKLNVKYRVLESNIESYLGNNR-----NVSH--DFLTKFLNEFRQNSKFRSSDCDKLKNRVINIRLKIEKFKLSIENIQPNEEFVSSIKGXXXXXXXXXXXXKREQKDSYENLLRSEVSLWQECIFMEKKINSW-----VSGDNDREVEPPKPQLVSDLINKANKEKNAVIALQKYLDETGGKTGGWSTLDHQTFLRIRLKYTGICQTAEVSYPRDEDIFYSDLMSLLAPKTVNDVKTHEMWYRKYQELVSEKKKAISEWKQQKSKQMKTVEMEIDETP---------KLSVKIDWETQKKRLENQRQALDFWRAEKALEEHRLXXXXXXXXXXXXXXXXXXXXXXXXXMRQMVDEYKQRKQAEDGEKRELALRLWEMSR-----EDKKRQIETHSARINERNTRMVEDKLIKQHQKQFEKERKIQRLNKLSEQVAITARRDPSRLLKPTSGWINRLTDTDENCSAGGISSGIRITNVQHKAVPAWR 1449
            H+ +   D     E+IKEI +LN K + +E    ++L + R     + SH  D   KF NE        +S+  KLK ++  IR  ++KF   +++++P  EFV  +K I+E+IE  I+  K EQ+  YE L+R E +  QE   +EK+  +W     V+ D  R   P       D+      E   V A +++L +TGG  GGW   DHQTF++ R K+ G            + +F  +L   L  KT + ++ HE WY++Y  L  +KK AI  W+ +K  + K V  + +E           KL  KI+ E      E++ + L+ W+ +K LE  + + E++  E    + ++  ++  ++++R MV EYKQ+K   D       L+L EM++     E K++Q+     R+ +RN ++ E+KL ++  K+   ++K +RL ++  QV +  +RDPSRLLKPT+GW+ R    ++N  + G   G ++ ++QH+AVP+WR
Sbjct:   20 HSSRGKGDHSKKMELIKEILQLNTKIKNMEREKSTHLYSKRSDFRKDFSHIEDADMKFTNEH-------ASEKVKLKQQLNKIRSMVKKFHHELQDVKPTPEFVEKLKIIMEDIEKTISAFKEEQRIHYEELMREEKATTQEIQALEKRFEAWSQAGPVNLDTPRSARPKPLASARDVTKDLPPE---VAAFERFLQQTGGHRGGWDEYDHQTFMKFRNKHKG------------KPLFIRELYPALPTKTEHQIREHENWYQEYSSLNEKKKDAIQSWRVKKEHEKKEVLAQAEEESESEEDERMLKLQEKIEKEK-----EDRFKKLNAWKVQKELERVQ-EEERKLREDLAKKAEEEREKERQEKLRAMVQEYKQQKNEVDD-----FLKLEEMAQREAEAEAKRKQLAKELPRLKQRNQKIFEEKLAREKAKEEADKKKKERLERIKSQVKVDVKRDPSRLLKPTAGWMER----EKNKGSDG---GGQVLSMQHRAVPSWR 485          
BLAST of Coiled-coil domain containing 112 vs. TrEMBL
Match: A0A1S3JIQ9 (coiled-coil domain-containing protein 112-like OS=Lingula unguis OX=7574 GN=LOC106173624 PE=4 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 1.047e-42
Identity = 149/491 (30.35%), Postives = 252/491 (51.32%), Query Frame = 1
Query:   10 HNLQMNFDDKNPQEIIKEIYKLNVKYRVLESNIESYLGNNRNVSHDFLTKFLNEFRQNSKF---RSSDCDKLKNRVINIRLKIEKFKLSIENIQPNEEFVSSIKGXXXXXXXXXXXXKREQKDSYENLLRSEVSLWQECIFMEKKINSW-----VSGDNDREVEPPKPQLVSDLINKANKEKNAVIALQKYLDETGGKTGGWSTLDHQTFLRIRLKYTGICQTAEVSYPRDEDIFYSDLMSLLAPKTVNDVKTHEMWYRKYQELVSEKKKAISEWKQQKSKQMKTVEMEIDETP---------KLSVKIDWETQKKRLENQRQALDFWRAEKALEEHRLXXXXXXXXXXXXXXXXXXXXXXXXXMRQMVDEYKQRKQAEDGEKRELALRLWEMSREDKKRQIETHSARINERNTRMVEDKLIKQHQKQFEKERKIQRLNKLSEQVAITARRDPSRLLKPTSGWINRLTDTDENCSAGGISSGIRITNVQHK 1431
            H+ +   D     E+IKEI +LN K + +E    ++L + R+   DF   F N    + KF    +S+  KLK ++  IR  ++KF   +++++P  EFV  +K I+E+IE  I+  K EQ+  YE L+R E +  QE   +EK+  +W     V+ D  R   P       D+      E   V A +++L +TGG  GGW   DHQTF++ R K+ G            + +F  +L   L  KT   V+ HE WY++Y  L  +KK AI  W+ +K  + K V  + +E           KL  KI+ E      E++ + L+ W+ +K LE  + + E++  E    + ++  ++  ++++R MV EYKQ+K   D   +   +   E   E K++Q+     R+ +RN + +E+KL ++  K+   ++K +RL ++  QV +  +RDPSRLLKPT+GW+ R  +        G + G ++ ++QH+
Sbjct:   20 HSSRGKGDHSKKMELIKEILQLNTKIKNMEREKSTHLYSKRS---DFRKDFSNLEDADMKFTNEHASEKVKLKQQLNKIRSMVKKFHHELQDVKPTPEFVEKLKIIMEDIEKTISAFKEEQRIHYEELMREEKATTQEIQALEKRFEAWSQAGPVNLDTPRSARPKPLASARDVTKDLPPE---VAAFERFLQQTGGHRGGWDEYDHQTFMKFRNKHKG------------KPLFIRELYPALPTKTEQQVREHENWYQEYSSLNEKKKDAIQSWRIKKEHEKKEVLAQAEEESESEEDERMLKLQEKIEKEK-----EDRFKKLNAWKVQKELERVQ-EEERKLREDLSKKAEEDREKERQEKLRAMVQEYKQQKNEVDDFLKLEEMAEREAEAEAKRKQLAKELPRLKQRNQKFLEEKLAREKAKEEADKKKKERLERIKSQVKVDVKRDPSRLLKPTAGWMEREKNK-------GPNGGGQVLSMQHR 479          
BLAST of Coiled-coil domain containing 112 vs. TrEMBL
Match: S4RAC6 (Coiled-coil domain containing 112 OS=Petromyzon marinus OX=7757 GN=CCDC112 PE=4 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 2.489e-38
Identity = 146/491 (29.74%), Postives = 250/491 (50.92%), Query Frame = 1
Query:   37 KNPQEIIKEIYKLNVKYRVLESNIESYLGNNRNVSHDFLTKFLNEFRQNSKFRSSDCDKLKNRVINIRLKIEKFKLSIENIQPNEEFVSSIKGXXXXXXXXXXXXKREQKDSYENLLRSEVSLWQECIFMEKKINSWVSGD--NDR------EVEPPKPQLVSDLINKANKEKNAVIALQKYLDETGGKTGGWSTLDHQTFLRIRLKYTGICQTAEVSYPRDEDIFYSDLMSLLAPKTVNDVKTHEMWYRKYQELVSEKKKAISEWK--QQKSKQMKTVEMEIDETPKLSVKIDWE---TQKKRLEN--QRQALDFWRAE----KALEEHRLXXXXXXXXXXXXXXXXXXXXXXXXXMRQMVDEYKQRK-QAEDGEKRELALRLWEMSREDKKRQIETHSARINERNTRMVEDKLIKQHQKQFEKERKIQRLNKLSEQVAITARRDPSRLLKPTSGWINRLTDTDENCSAGGISSGIRITNVQHKAVPAWR 1449
            ++ Q +  +I  L  + R+   + +S L ++  V  ++  K LN+       R S+  KL+ ++  ++  +  F+  ++++  N EFV+ +KG +EE+E  I+  K +Q++ YE+L++ E    QE   +EKKI SW  G   N R        + P  + + D +         V+A +K+L ++GG+ GGW   DHQ FL++R ++ G              +F  + ++ L  +T  DV+ HE WY+++ +L  EKK+AIS WK  +++ +  K  + E     + + K D E    QK + E   +R+ ++ W+A+    +A EE R        E+EE  R +  +   + E+R +  E+ +RK Q ++ ++R+  LR  +  REDK         R  ER+   VE KL+++  K+ E   + +RL KL +QV +   RDPSRLLK T GW+ R           G S G  +  + H+AVP WR
Sbjct:   19 RDGQSLQAQINALEKEKRIQFYSKKSELKHDLGVLEEYELKLLND-------RKSEELKLQQQLNKLKTSVLLFQKELKDVAQNSEFVNKLKGTMEEVERTISLFKEQQRELYEHLMKDEKMTSQEIGALEKKIESWSQGSLSNPRITKSALAAKVPLSKTIEDDLP------AEVVAFEKFLQQSGGRQGGWDDYDHQNFLKVRTRHKGNL------------LFIEEALNYLPGRTREDVEQHETWYKEFLDLEDEKKEAISRWKLCRERERAEKLAKQEKSSEGQEAEKKDQEEAWLQKLKQEQIQKREKINAWKAQQEKARADEEKR-----RQHEEEERARYRERETQRQAELRVLAREHARRKRQLKEQQRRDEELRE-QAEREDKACLAAQEIQRFQERDQEKVESKLLEKKAKEQEDIERDRRLAKLKQQVEVHVERDPSRLLKLTKGWLERTKHI-------GPSGGGPLLKIPHRAVPDWR 471          
BLAST of Coiled-coil domain containing 112 vs. TrEMBL
Match: R7TK18 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_190988 PE=4 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 5.262e-36
Identity = 142/489 (29.04%), Postives = 253/489 (51.74%), Query Frame = 1
Query:   49 EIIKEIYKLNVKYRVLESNIESYLGNNRN-VSHDFLTKFLNEF-RQNSKFRSSDCDKLKNRVINIRLKIEKFKLSIENIQPNEEFVSSIKGXXXXXXXXXXXXKREQKDSYENLLRSEVSLWQECIFMEKKINSWVS-----GDNDREVEPPKPQLVSDLINKANKEKNAVIALQKYLDETGGKTGGWSTLDHQTFLRIRLKYTGICQTAEVSYPRDEDIFYSDLMSLLAPKTVNDVKTHEMWYRKYQELVSEKKKAISEWKQQKSKQMKTVEMEIDETPKLSVKIDWETQKKRLENQR----QALDFWRAEKAL----EEHRLXXXXXXXXXXXXXXXXXXXXXXXXXMRQMVDEYKQRKQAEDGEKRELALRLWEMSREDKKRQIETHSARINERNTRMVEDKLIKQHQKQFEKERKIQ-----RLNKLSEQVAITARRDPSRLLKPTSGWINRLTDTDENCSAGGISSGIRITNVQHKAVPAWRRD 1455
            E+IKE++++ +    LE    + + N  + +  +F T  L E  R+  + R +     +  ++ I+ ++ KF+  ++ ++P  EFV  IK ++E+IE+ I   K  Q+  YE LLR E  +  E   +EK+I+ W S       N R   P K     D+      E   V A +++  +TGG+ GGW   DH  FL+ R            +  +++++F  +L S++  K  ++++ HEMW+R+Y+ L   KK+AI+EW+Q K  + +  E   +E  +   +++ E +++RL  +R      L+ W+ EK L    EE R+       E+   + K+  +   ++E++  V+E+K+ K AE+ E+R +      +  E+K++  +    ++ +R+     +K+  +   + E ERK +     RLN+L  QVA+ A RDPSRLL+PT+GW+ R  DTD   S        RI +   KA+P WR++
Sbjct:   12 ELIKELHRMKLNIDKLEREKSNQIYNKHSELYQEFAT--LQEIDRKFEQDRRTSGRNTEQTLVKIKSQVAKFRREVKEVKPTPEFVEKIKVLMEDIEVQINSFKDAQRLQYEELLRDEHIVNLEVTALEKRIDVWASMKPGSAHNTRSQHPTKLPSHRDVHRFLPPE---VTAFERFEAQTGGQRGGWDEYDHAMFLKYR------------NRSKNKNVFIEELASVIPTKDGDEIRHHEMWFREYEMLRQRKKEAIAEWRQHKEIEREEPESSDEEDKEQQRQME-ELKQRRLAEERALAKAELNKWKVEKELKRAEEEQRI-----LREQLRQKDKEEMERKRQEEVKARVEEFKEIKSAEERERRLVEELRRRVEMEEKQKVAKVIVGKLKDRDL----EKVYTKRNVRLEAERKAELDKQKRLNRLRNQVAVEAPRDPSRLLRPTAGWVERQKDTDSTPSG-------RILHAPKKAIPTWRQN 466          
BLAST of Coiled-coil domain containing 112 vs. TrEMBL
Match: A0A210PRC1 (Uncharacterized protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT15151 PE=4 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 9.495e-36
Identity = 145/482 (30.08%), Postives = 253/482 (52.49%), Query Frame = 1
Query:   49 EIIKEIYKLNVKYRVLESNIESYLGNNRNVSHDFLTKFLNEFRQNSKF---RSSDCDKLKNRVINIRLKIEKFKLSIENIQPNEEFVSSIKGXXXXXXXXXXXXKREQKDSYENLLRSEVSLWQECIFMEKKINSWVSGDND----REVEPPKPQLVSDLINKANKEKNAVIALQKYLDETGGKTGGWSTLDHQTFLRIRLKYTGICQTAEVSYPRDEDIFYSDLMSLLAPKTVNDVKTHEMWYRKYQELVSEKKKAISEWKQQKSKQMKTVEMEIDETPKLSVKIDWETQ---KKRLENQRQA----LDFWRAEKALEEHRLXXXXXXXXXXXXXXXXXXXXXXXXXMRQMVDEYKQRKQAEDGEKRELALRLWEMSREDKKRQIETHS-ARINERNTRMVEDKLIKQHQKQFEKERKIQRLNKLSEQVAITARRDPSRLLKPTSGWINRLTDTDENCSAGGISSGIRITNVQHKAVPAWR 1449
            +I KE+ KL V+   L+    ++L + RN   DF  +FL      +K    R ++  KLK ++  I   +++F   +++++P  EFV  +K I+EEIE  I   K +Q+  YE L+R E +  QE + +EKK   W    +D    R+V P  P   +  I K    +  V A +K+L++TGG  GGW   DHQTFL+ R +  G               F    +  +  +T  ++  HE WY+ Y ++   KK++I +WK +K ++ + +    D++     K + E Q   K+R+E+++      L+ W+ +K +E      EK+  E+ E  +K  + +  + EM+  V+EY+++++ ED   R +    WE  ++++++QI     +R  ER+ + + +KL K   K+ E+  K +RL +L  QV I   RDP+RLL+PT+GW +R  +        G S   ++ ++QH+A+P+WR
Sbjct:   31 DIFKELNKLRVQIVALDREKSTHLYSKRN---DFRQEFLPLQEMETKATESRKTEQIKLKQQLEKISHMVKRFHTELKDVKPTPEFVEKLKIIMEEIESTINAFKEQQRKQYEELMREERTTTQEILALEKKFEVWTQMGDDLPSARKVAPSAPLASARDITKDLPPE--VAAFEKFLEQTGGIRGGWDEYDHQTFLKFRHRNKG------------RPAFLQQCLISIPTRTEEEIMNHEEWYQTYLDMNETKKESIRKWKDRKQREKEDLLSVADDSLNNKKKREEEKQQAMKERMEDEKMGRFSKLNAWKVQKEIERAE-AEEKKLREQLEKSKKVGDFKKRQTEMKAQVEEYRKKREEEDEFVR-IQQEAWEQEQKERQKQISAREISRFRERDQKSMGEKLKKDKIKEEEQREKEKRLARLKSQVEIEVDRDPNRLLQPTAGWKSRTKEI-------GPSGSGQVMHMQHRAIPSWR 486          
BLAST of Coiled-coil domain containing 112 vs. Ensembl Cavefish
Match: CCDC112 (coiled-coil domain containing 112 [Source:HGNC Symbol;Acc:HGNC:28599])

HSP 1 Score: 99.7525 bits (247), Expect = 2.572e-22
Identity = 72/214 (33.64%), Postives = 117/214 (54.67%), Query Frame = 1
Query:  211 KLKNRVINIRLKIEKFKLSIENIQPNEEFVSSIKGXXXXXXXXXXXXKREQKDSYENLLRSEVSLWQECIFMEKKINSW-VSGDNDREVEPPKPQLVSD-----LINKANKEK--NAVIALQKYLDETGGKTGGWSTLDHQTFLRIRLKYTGICQTAEVSYPRDEDIFYSDLMSLLAPKTVNDVKTHEMWYRKYQELVSEKKKAISEWKQQKSK 828
            +++ ++  IR  + +F+  + +++P+ + +  +K ++ EIE  I  +K EQ   +E LL+ E   WQE    EKKI++W +SG  D E+    P + S       I+K  KE+    V AL+ +L +TGGK GGW   DHQ+FL++  K+ G     + SY R E  FY      L  KT   ++ HE WY +   L  +KK+AI +W+ +K +
Sbjct:   48 RVQQQLQKIRNSVYRFQGQLIDVKPSPDLIERLKDVMSEIESSINIMKEEQHQRFEELLKEERICWQEMYAFEKKIDAWSLSGKKDSEI----PAVASKARQNRCIDKKGKEELPTEVTALETFLQQTGGKLGGWDQYDHQSFLQVWTKHHG-----KPSY-RAEVKFY------LPGKTEEHIRLHEEWYLELCHLQEKKKEAIQKWRAEKQR 245          
BLAST of Coiled-coil domain containing 112 vs. Ensembl Sea Lamprey
Match: CCDC112 (coiled-coil domain containing 112 [Source:HGNC Symbol;Acc:HGNC:28599])

HSP 1 Score: 156.377 bits (394), Expect = 1.913e-42
Identity = 146/491 (29.74%), Postives = 250/491 (50.92%), Query Frame = 1
Query:   37 KNPQEIIKEIYKLNVKYRVLESNIESYLGNNRNVSHDFLTKFLNEFRQNSKFRSSDCDKLKNRVINIRLKIEKFKLSIENIQPNEEFVSSIKGXXXXXXXXXXXXKREQKDSYENLLRSEVSLWQECIFMEKKINSWVSGD--NDR------EVEPPKPQLVSDLINKANKEKNAVIALQKYLDETGGKTGGWSTLDHQTFLRIRLKYTGICQTAEVSYPRDEDIFYSDLMSLLAPKTVNDVKTHEMWYRKYQELVSEKKKAISEWK--QQKSKQMKTVEMEIDETPKLSVKIDWE---TQKKRLEN--QRQALDFWRAE----KALEEHRLXXXXXXXXXXXXXXXXXXXXXXXXXMRQMVDEYKQRK-QAEDGEKRELALRLWEMSREDKKRQIETHSARINERNTRMVEDKLIKQHQKQFEKERKIQRLNKLSEQVAITARRDPSRLLKPTSGWINRLTDTDENCSAGGISSGIRITNVQHKAVPAWR 1449
            ++ Q +  +I  L  + R+   + +S L ++  V  ++  K LN+       R S+  KL+ ++  ++  +  F+  ++++  N EFV+ +KG +EE+E  I+  K +Q++ YE+L++ E    QE   +EKKI SW  G   N R        + P  + + D +         V+A +K+L ++GG+ GGW   DHQ FL++R ++ G              +F  + ++ L  +T  DV+ HE WY+++ +L  EKK+AIS WK  +++ +  K  + E     + + K D E    QK + E   +R+ ++ W+A+    +A EE R        E+EE  R +  +   + E+R +  E+ +RK Q ++ ++R+  LR  +  REDK         R  ER+   VE KL+++  K+ E   + +RL KL +QV +   RDPSRLLK T GW+ R           G S G  +  + H+AVP WR
Sbjct:   19 RDGQSLQAQINALEKEKRIQFYSKKSELKHDLGVLEEYELKLLND-------RKSEELKLQQQLNKLKTSVLLFQKELKDVAQNSEFVNKLKGTMEEVERTISLFKEQQRELYEHLMKDEKMTSQEIGALEKKIESWSQGSLSNPRITKSALAAKVPLSKTIEDDLP------AEVVAFEKFLQQSGGRQGGWDDYDHQNFLKVRTRHKGNL------------LFIEEALNYLPGRTREDVEQHETWYKEFLDLEDEKKEAISRWKLCRERERAEKLAKQEKSSEGQEAEKKDQEEAWLQKLKQEQIQKREKINAWKAQQEKARADEEKR-----RQHEEEERARYRERETQRQAELRVLAREHARRKRQLKEQQRRDEELRE-QAEREDKACLAAQEIQRFQERDQEKVESKLLEKKAKEQEDIERDRRLAKLKQQVEVHVERDPSRLLKLTKGWLERTKHI-------GPSGGGPLLKIPHRAVPDWR 471          
BLAST of Coiled-coil domain containing 112 vs. Ensembl Nematostella
Match: EDO36619 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI52])

HSP 1 Score: 85.8853 bits (211), Expect = 3.564e-18
Identity = 63/214 (29.44%), Postives = 104/214 (48.60%), Query Frame = 1
Query:  193 RSSDCDKLKNRVINIRLKIEKFKLSIENIQPNEEFVSSIKGXXXXXXXXXXXXKREQKDSYENLLRSEVSLWQECIFMEKKINSWVSGDNDREVEPPKPQLVSDLINKANKE-KNAVIALQKYLDETGGKTGGWSTLDHQTFLRIRLKY---TGICQTAEVSYPRDEDIFYSDLMSLLAPKTVNDVKTHEMWYRKYQELVSEKKKAISEWKQQK 822
            R S+   L+ ++  IR  ++KF+  + +++ +  FV  +K ++E+IE  I   K +Q++ Y+ LL+ E +L +E    EKK  SW        + PP    V       +     AV A +++L +TGG  GGW   DH  FL+++ ++         AEVS P                + ++D++ H  WY +Y  L   KK AI EWK +K
Sbjct:   74 RKSERQNLRQQLGKIRSNVDKFQRELMDVKASPAFVQKLKEMMEDIEESIMHFKDQQREYYDTLLQDERTLIKELAATEKKFESWSP------LPPPITTAVGAKKGAVSASLPPAVAAFERFLLQTGGHQGGWDDYDHNMFLKLKAQHKTRDAFLNAAEVSIP---------------GQNLSDLRQHLDWYTEYLSLKESKKLAIQEWKHEK 266          
BLAST of Coiled-coil domain containing 112 vs. Ensembl Medaka
Match: CCDC112 (coiled-coil domain containing 112 [Source:NCBI gene;Acc:101168122])

HSP 1 Score: 87.4261 bits (215), Expect = 5.036e-18
Identity = 71/241 (29.46%), Postives = 119/241 (49.38%), Query Frame = 1
Query:  148 FLTKFLNEFRQNSKFRS-SDCDKLKNRVINIRLKIEKFKLSIENIQPNEEFVSSIKGXXXXXXXXXXXXKREQKDSYENLLRSEVSLWQECIFMEKKINSWVSGDNDREVEPPKPQLVSDLINKANKEKNA-VIALQKYLDETGGKTGGWSTLDHQTFLRIRLKYTGICQTAEVSYPRDEDIFYSDLMSLLAPKTVNDVKTHEMWYRKYQELVSEKKKAISEWKQQKSKQMKTVEMEIDET 864
            F T   N  +Q+    + S    L+ +++ I+  ++KF+  + +++P  E +  +K I+ ++E  I  LK EQ+  +E  L+ E+ +  E    EKKI +W       ++ P  P   +  I   N++  A V A + +L +TGG  GGW   DHQ FLRI  K+ G     + SY  +  +   D       KT  ++K HE W+ +   L  +KKKAI  WK  K ++ +  +   +ET
Sbjct:   52 FFTCVSNANQQHCAHEALSSGASLQKQLVKIQKDVQKFQHHLIDVKPTPELIERLKDIMSDVETSINHLKEEQRSCFEKYLKEEMIVRLEISAYEKKIENW---SLTVKLNPKLPSAPTTKIKLHNRDLPAEVRAPEDFLQKTGGPYGGWDQCDHQVFLRIWTKHRG-----QTSYRNEAKLHLPD-------KTAEEIKRHECWHLELLSLQEKKKKAIQLWKASKRQEHQIRKHSQEET 277          
BLAST of Coiled-coil domain containing 112 vs. Ensembl Medaka
Match: CCDC112 (coiled-coil domain containing 112 [Source:NCBI gene;Acc:101168122])

HSP 1 Score: 87.4261 bits (215), Expect = 6.146e-18
Identity = 68/227 (29.96%), Postives = 116/227 (51.10%), Query Frame = 1
Query:  187 KFRSSDCDKLKNRVINIRLKIEKFKLSIENIQPNEEFVSSIKGXXXXXXXXXXXXKREQKDSYENLLRSEVSLWQECIFMEKKINSWVSGDNDREVEPPKPQLVSDLINKANKEKNA-VIALQKYLDETGGKTGGWSTLDHQTFLRIRLKYTGICQTAEVSYPRDEDIFYSDLMSLLAPKTVNDVKTHEMWYRKYQELVSEKKKAISEWKQQKSKQMKTVEMEIDET 864
            K R+++   L+ +++ I+  ++KF+  + +++P  E +  +K I+ ++E  I  LK EQ+  +E  L+ E+ +  E    EKKI +W       ++ P  P   +  I   N++  A V A + +L +TGG  GGW   DHQ FLRI  K+ G     + SY  +  +   D       KT  ++K HE W+ +   L  +KKKAI  WK  K ++ +  +   +ET
Sbjct:   90 KERNAERASLQKQLVKIQKDVQKFQHHLIDVKPTPELIERLKDIMSDVETSINHLKEEQRSCFEKYLKEEMIVRLEISAYEKKIENW---SLTVKLNPKLPSAPTTKIKLHNRDLPAEVRAPEDFLQKTGGPYGGWDQCDHQVFLRIWTKHRG-----QTSYRNEAKLHLPD-------KTAEEIKRHECWHLELLSLQEKKKKAIQLWKASKRQEHQIRKHSQEET 301          
BLAST of Coiled-coil domain containing 112 vs. Planmine SMEST
Match: SMESG000011105.1 (SMESG000011105.1)

HSP 1 Score: 880.552 bits (2274), Expect = 0.000e+0
Identity = 472/478 (98.74%), Postives = 475/478 (99.37%), Query Frame = 1
Query:   22 MNFDDKNPQEIIKEIYKLNVKYRVLESNIESYLGNNRNVSHDFLTKFLNEFRQNSKFRSSDCDKLKNRVINIRLKIEKFKLSIENIQPNEEFVSSIKGXXXXXXXXXXXXKREQKDSYENLLRSEVSLWQECIFMEKKINSWVSGDNDREVEPPKPQLVSDLINKANKEKNAVIALQKYLDETGGKTGGWSTLDHQTFLRIRLKYTGICQTAEVSYPRDEDIFYSDLMSLLAPKTVNDVKTHEMWYRKYQELVSEKKKAISEWKQQKSKQMKTVEMEIDETPKLSVKIDWETQKKRLENQRQALDFWRAEKALEEHRLXXXXXXXXXXXXXXXXXXXXXXXXXMRQMVDEYKQRKQAEDGEKRELALRLWEMSREDKKRQIETHSARINERNTRMVEDKLIKQHQKQFEKERKIQRLNKLSEQVAITARRDPSRLLKPTSGWINRLTDTDENCSAGGISSGIRITNVQHKAVPAWRRD 1455
            MNFDDKNPQEIIKEIYKLNVKYRVLESNIESYLGNNRNVS+DFLTKFLNEFRQNSKFRSSDCDKLKNRVINIRLKIEKFKLSIENIQPNEEFVSSIKGIIEEIEMLITELKREQKDSYENLLRSEVSLWQECIFMEKKINSWVSGDNDREVEPPKPQLVSDLINKANKEKNAVIALQKYLDETGGKTGGWSTLDHQTFLRIRLKYTGICQTAEVSYPRDEDIFYSDLMSLLAPKTVNDVKTHEMWYRKYQELV EKKKAISEWKQQKSKQMKTVEM+IDETPKLSVKIDWETQKKRLENQRQALD WRAEKALEEHRLKIEKENTEKEEMERKKREQELERKEMRQMVDEYKQRKQAE+GEKRELALRLWEMSREDKKRQIETHSARINERNTRMVEDKLIKQHQKQFEKERKIQRLNKLSEQVAITARRDPSRLLKPTSGWINRLTDTDENCSAGG SSGIRITNVQHKAVPAWRRD
Sbjct:    1 MNFDDKNPQEIIKEIYKLNVKYRVLESNIESYLGNNRNVSNDFLTKFLNEFRQNSKFRSSDCDKLKNRVINIRLKIEKFKLSIENIQPNEEFVSSIKGIIEEIEMLITELKREQKDSYENLLRSEVSLWQECIFMEKKINSWVSGDNDREVEPPKPQLVSDLINKANKEKNAVIALQKYLDETGGKTGGWSTLDHQTFLRIRLKYTGICQTAEVSYPRDEDIFYSDLMSLLAPKTVNDVKTHEMWYRKYQELVFEKKKAISEWKQQKSKQMKTVEMKIDETPKLSVKIDWETQKKRLENQRQALDSWRAEKALEEHRLKIEKENTEKEEMERKKREQELERKEMRQMVDEYKQRKQAEEGEKRELALRLWEMSREDKKRQIETHSARINERNTRMVEDKLIKQHQKQFEKERKIQRLNKLSEQVAITARRDPSRLLKPTSGWINRLTDTDENCSAGGTSSGIRITNVQHKAVPAWRRD 478          
The following BLAST results are available for this feature:
BLAST of Coiled-coil domain containing 112 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CCDC1126.155e-3627.08coiled-coil domain containing 112 [Source:HGNC Sym... [more]
CCDC1126.155e-3627.08coiled-coil domain containing 112 [Source:HGNC Sym... [more]
CCDC1122.555e-3527.08coiled-coil domain containing 112 [Source:HGNC Sym... [more]
CCDC1126.773e-2823.87coiled-coil domain containing 112 [Source:HGNC Sym... [more]
back to top
BLAST of Coiled-coil domain containing 112 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain containing 112 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain containing 112 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain containing 112 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pggt1b1.403e-2525.10protein geranylgeranyltransferase type I, beta sub... [more]
back to top
BLAST of Coiled-coil domain containing 112 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Ccdc1123.031e-3528.22coiled-coil domain containing 112 [Source:MGI Symb... [more]
Ccdc1122.285e-932.35coiled-coil domain containing 112 [Source:MGI Symb... [more]
Ccdc1123.912e-725.58coiled-coil domain containing 112 [Source:MGI Symb... [more]
back to top
BLAST of Coiled-coil domain containing 112 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q8NEF3|CC112_HUMAN2.956e-3527.08Coiled-coil domain-containing protein 112 OS=Homo ... [more]
sp|Q4R8R3|CC112_MACFA4.248e-3427.08Coiled-coil domain-containing protein 112 OS=Macac... [more]
sp|A0AUP1|CC112_MOUSE7.704e-3328.06Coiled-coil domain-containing protein 112 OS=Mus m... [more]
back to top
BLAST of Coiled-coil domain containing 112 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3K0Q81.511e-4831.23coiled-coil domain-containing protein 112 isoform ... [more]
A0A1S3JIQ91.047e-4230.35coiled-coil domain-containing protein 112-like OS=... [more]
S4RAC62.489e-3829.74Coiled-coil domain containing 112 OS=Petromyzon ma... [more]
R7TK185.262e-3629.04Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A210PRC19.495e-3630.08Uncharacterized protein OS=Mizuhopecten yessoensis... [more]
back to top
BLAST of Coiled-coil domain containing 112 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CCDC1122.572e-2233.64coiled-coil domain containing 112 [Source:HGNC Sym... [more]
back to top
BLAST of Coiled-coil domain containing 112 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CCDC1121.913e-4229.74coiled-coil domain containing 112 [Source:HGNC Sym... [more]
back to top
BLAST of Coiled-coil domain containing 112 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain containing 112 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO366193.564e-1829.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Coiled-coil domain containing 112 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CCDC1125.036e-1829.46coiled-coil domain containing 112 [Source:NCBI gen... [more]
CCDC1126.146e-1829.96coiled-coil domain containing 112 [Source:NCBI gen... [more]
back to top
BLAST of Coiled-coil domain containing 112 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000011105.10.000e+098.74SMESG000011105.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016383 ID=SMED30016383|Name=Coiled-coil domain containing 112|organism=Schmidtea mediterranea sexual|type=transcript|length=1544bp
TGAAATTGGCACAACCTTCAAATGAATTTCGATGACAAAAATCCACAAGA
AATAATTAAAGAAATATATAAATTGAATGTCAAGTATCGAGTATTAGAAA
GCAATATTGAAAGTTATTTAGGTAACAATCGAAATGTTTCCCATGATTTT
CTAACTAAATTCCTAAATGAATTCAGACAAAATTCCAAATTTAGATCATC
CGATTGTGACAAATTAAAAAATCGCGTAATTAATATAAGATTGAAAATCG
AAAAATTCAAACTGTCAATTGAAAATATCCAACCAAATGAAGAATTCGTT
AGTTCCATTAAGGGTATTATTGAAGAAATTGAAATGCTTATTACTGAATT
GAAACGGGAACAAAAAGATAGTTATGAAAACCTATTGCGTTCTGAAGTGT
CATTGTGGCAAGAATGTATTTTTATGGAAAAGAAAATAAATTCATGGGTA
TCAGGAGATAATGATAGAGAAGTCGAGCCTCCAAAGCCTCAACTGGTGTC
AGATTTGATAAATAAGGCTAATAAAGAAAAAAATGCAGTAATTGCTCTCC
AAAAATATCTTGATGAAACAGGAGGAAAAACCGGTGGTTGGTCAACTCTA
GATCATCAAACATTTCTGAGAATCCGACTAAAATATACAGGAATCTGTCA
AACTGCAGAGGTTAGTTATCCTCGAGACGAAGACATCTTTTACAGTGATT
TAATGTCATTATTGGCTCCAAAAACAGTGAATGATGTGAAAACACATGAA
ATGTGGTATAGAAAGTATCAAGAGCTAGTATCCGAAAAGAAAAAGGCTAT
TTCAGAGTGGAAACAACAAAAATCAAAACAGATGAAAACTGTTGAAATGG
AAATAGATGAAACTCCTAAACTTTCGGTAAAAATTGACTGGGAAACACAG
AAAAAGCGTTTAGAAAATCAAAGACAAGCTCTCGATTTTTGGAGAGCCGA
AAAAGCTTTAGAAGAACATCGACTGAAAATTGAAAAAGAAAACACAGAAA
AGGAAGAAATGGAAAGAAAAAAGCGAGAACAAGAATTAGAACGAAAGGAA
ATGCGCCAAATGGTTGACGAGTATAAGCAGCGGAAACAGGCAGAAGATGG
CGAGAAACGCGAATTAGCCTTGAGATTATGGGAAATGTCCAGGGAAGATA
AAAAGCGGCAAATTGAAACTCATTCAGCTAGGATTAATGAGAGGAACACA
AGAATGGTGGAAGACAAACTAATCAAACAACATCAAAAACAATTTGAAAA
GGAACGGAAAATCCAGCGGCTTAATAAGTTATCAGAACAAGTGGCAATAA
CTGCCAGAAGGGATCCGTCGAGATTATTGAAACCGACTTCAGGGTGGATA
AATAGATTGACGGACACAGATGAGAACTGTTCAGCAGGAGGAATATCATC
TGGCATTCGAATCACTAATGTGCAACATAAGGCTGTCCCGGCCTGGAGAA
GGGATTTTATACAATAAATTATTTTTGTTATTATCCTCCATTGAGCTCTA
TTTGATATTATGTTAGTGTAAATATTATTCAATATATGTTGTGG
back to top

protein sequence of SMED30016383-orf-1

>SMED30016383-orf-1 ID=SMED30016383-orf-1|Name=SMED30016383-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=482bp
MNFDDKNPQEIIKEIYKLNVKYRVLESNIESYLGNNRNVSHDFLTKFLNE
FRQNSKFRSSDCDKLKNRVINIRLKIEKFKLSIENIQPNEEFVSSIKGII
EEIEMLITELKREQKDSYENLLRSEVSLWQECIFMEKKINSWVSGDNDRE
VEPPKPQLVSDLINKANKEKNAVIALQKYLDETGGKTGGWSTLDHQTFLR
IRLKYTGICQTAEVSYPRDEDIFYSDLMSLLAPKTVNDVKTHEMWYRKYQ
ELVSEKKKAISEWKQQKSKQMKTVEMEIDETPKLSVKIDWETQKKRLENQ
RQALDFWRAEKALEEHRLKIEKENTEKEEMERKKREQELERKEMRQMVDE
YKQRKQAEDGEKRELALRLWEMSREDKKRQIETHSARINERNTRMVEDKL
IKQHQKQFEKERKIQRLNKLSEQVAITARRDPSRLLKPTSGWINRLTDTD
ENCSAGGISSGIRITNVQHKAVPAWRRDFIQ*
back to top

protein sequence of SMED30016383-orf-2

>SMED30016383-orf-2 ID=SMED30016383-orf-2|Name=SMED30016383-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=104bp
PQHILNNIYTNIISNRAQWRIITKIIYCIKSLLQAGTALCCTLVIRMPDD
IPPAEQFSSVSVNLFIHPEVGFNNLDGSLLAVIATCSDNLLSRWIFRSFS
NCF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR039902CCDC148/CCDC112
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 96..120
NoneNo IPR availableCOILSCoilCoilcoord: 297..368
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 322..341
NoneNo IPR availablePANTHERPTHR21549:SF0COILED-COIL DOMAIN-CONTAINING PROTEIN 112coord: 8..477
IPR039902Coiled-coil domain-containing protein CCDC148/CCDC112PANTHERPTHR21549MUTATED IN BLADDER CANCER 1coord: 8..477