Endoribonuclease Dicer

Overview
NameEndoribonuclease Dicer
Smed IDSMED30016368
Length (bp)4352
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Endoribonuclease Dicer (SMED30016368) t-SNE clustered cells

Violin plots show distribution of expression levels for Endoribonuclease Dicer (SMED30016368) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Endoribonuclease Dicer (SMED30016368) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Endoribonuclease Dicer (SMED30016368) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016368

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30016368SMESG000073604.1 Contig1511newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30016368SMESG000073604.1 Contig1511newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30016368SMESG000073604.1 Contig1511newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30016368SMESG000073604.1 Contig1511uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30016368SMESG000073604.1 Contig1511uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30016368SMESG000073604.1 Contig1511uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30016368SMESG000078091.1 SMESG000078098.1 SMESG000078094.1 SMESG000078092.1 Contig1511newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30016368SMESG000078091.1 SMESG000078098.1 SMESG000078094.1 SMESG000078092.1 Contig1511newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30016368SMESG000078091.1 SMESG000078098.1 SMESG000078094.1 SMESG000078092.1 Contig1511newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30016368SMESG000078091.1 SMESG000078098.1 SMESG000078094.1 SMESG000078092.1 Contig1511uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30016368SMESG000078091.1 SMESG000078098.1 SMESG000078094.1 SMESG000078092.1 Contig1511uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30016368SMESG000078091.1 SMESG000078098.1 SMESG000078094.1 SMESG000078092.1 Contig1511uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30016368SMESG000073604.1 dd_Smed_v4_8502_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Endoribonuclease Dicer vs. Ensembl Human
Match: DICER1 (dicer 1, ribonuclease III [Source:HGNC Symbol;Acc:HGNC:17098])

HSP 1 Score: 217.624 bits (553), Expect = 3.091e-56
Identity = 270/1063 (25.40%), Postives = 493/1063 (46.38%), Query Frame = 2
Query:   47 RDYQIEIYNKAKNENVIIKLNTGSGKTFIASMLIKDY-LNVKSD-----KKIFFLVKNSSLVHQHTNSLKDYLFLKDEIGYFYGQMENSWVD-NWTXXXXXXXXXXXXXXVMTAKVFLDILNHNKYNLSQVCYLIFDEVHHLTKSDDYSQISEHVIRTTSDIKILGLTACLIKGVKHVKDIEFAVKQLEHKLNCKVITSMDNIARE-FCGNIKETIINYETESFPDLVAIFKSAIEKIESFIPVDGHHSNDNSGSLNAEQNNFKTL-KKYLSESFSVLSTLGLVPCKLITDMFIEDLHGAVNNDSMFFDEKTKLYLDEFLSCLKFINSNIESYISKS--DMLMCSEKCKKLINLILDLKS--------------KNED------------------------------FKNTISILIFINEKIHVLALNVLLGILPKINKAFDFINSNFIIGHSTSQ-YPKKLQMSV--TKQXXXXXXXXXXXXXXXXATNVIEEGLDVSHCNIVVKFDPPQDFRSYLQSKGRARAQNSQYIVF--THETQKTEAQIQKFNLINEELNKILKSRVIEDELNKDDSERNVTPSEDDKYDYVPY----GENGPRITLNSASSVLNRYLGKLRCNSISE--PKIIYTYFQDEFNFHHVSLLLPMPAPYLEEIKGLPCSNKRRAKQFVNLEACKILHKYDELDSSLLPYNR--------------FDNNLVIQESNDIEIIKYEKYTATKLSTKFQNLSIPANKLYLYSIKYTPSVFL--KLGINDISMF---DVSTYLGILLPNPIHQNKDFMKFPIYLVGGMTSVEIKFEYNLPVNSINY-SLLLKCHKILFNIYSERIRRFDKNIF-FDPSKAKSS---IILTILKDNK---IDFNKIKEIITNPI---VDNLIKNDQSSWV-------GSVIRPNYIT-NEFGAFVISKVCHDMNADSIFKND--MTYEKFLNKKYNIILSPNEKLSPLIKV------IRLTTIQSCVNKERRFLRNNRKLQRINESECY-----FVPSLTECISLSSSLWTQLCIFPTIHHRMNQILSIEDF 2884
            R YQ+E+   A + N I+ LNTGSGKTFIA +L K+    ++ D     K+  FLV +++ V Q  ++++ +  LK       G+  N  V+ +WTK++W+++ +K+++++MT  V L++L +   +LS +  L+FDE H       Y +I +      S  +ILGLTA ++ G    +++E  +++LE  L     T+ D +  + +     E +++     F D   +++  + ++E  +    +  ND + S+++++ +   + K+ LS+  +VL  LG      +  M + +L   + ++      K  L+ D FL   + I++  E + S +  D+   + K  KL+ ++   K               +N+D                              F N +  +IF+  +   + LN L+    K +    +I+SNFI GH   +  P+  QM     KQ E+L+ F+  + N+LIAT+++EEG+D+  CN+VV+FD P ++RSY+QSKGRARA  S YI+   T + +  E  ++ +  I     KIL+++  +   + D  E ++ P  DD   + PY     + GPR+T+N+A   +NRY  +L  +  +   PK       D     + +L LP+ +P    I G P S  R A++ V L  C+ LHK  ELD  L+P  +               + ++  +  +      Y K     L   +     P    YLY I    +  L  +L      ++   D +   GIL   PI Q      FP+Y   G  ++ I+ + +  + S+    L+ + H+ +F+     I R +K    F P+ A S+   + L ++ D+    IDF  +++I  +     + +     ++ +V        +VI P Y   ++   F ++ V  D+   S F +    T+ ++   KYN+ L+   +  PL+ V      + L T +  +N++ + L  +   +R  + E        VP L     + +SLW +    P+I +R++ +L+ E+ 
Sbjct:   45 RKYQVELLEAALDHNTIVCLNTGSGKTFIAVLLTKELSYQIRGDFSRNGKRTVFLVNSANQVAQQVSAVRTHSDLK------VGEYSNLEVNASWTKERWNQEFTKHQVLIMTCYVALNVLKNGYLSLSDINLLVFDECHLAILDHPYREIMKLCENCPSCPRILGLTASILNGKCDPEELEEKIQKLEKILKSNAETATDLVVLDRYTSQPCEIVVD--CGPFTDRSGLYERLLMELEEAL----NFINDCNISVHSKERDSTLISKQILSDCRAVLVVLGPWCADKVAGMMVRELQKYIKHEQEELHRKFLLFTDTFL---RKIHALCEEHFSPASLDLKFVTPKVIKLLEILRKYKPYERQQFESVEWYNNRNQDNYVSWSDSEDDDEDEEIEEKEKPETNFPSPFTNILCGIIFVERRYTAVVLNRLIKEAGKQDPELAYISSNFITGHGIGKNQPRNKQMEAEFRKQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLVVRFDLPTEYRSYVQSKGRARAPISNYIMLADTDKIKSFEEDLKTYKAI----EKILRNKCSK---SVDTGETDIDPVMDDDDVFPPYVLRPDDGGPRVTINTAIGHINRYCARLPSDPFTHLAPKCRTRELPD--GTFYSTLYLPINSPLRASIVGPPMSCVRLAERVVALICCEKLHKIGELDDHLMPVGKETVKYEEELDLHDEEETSVPGRPGSTKRRQCYPKAIPECLRDSYPR---PDQPCYLYVIGMVLTTPLPDELNFRRRKLYPPEDTTRCFGILTAKPIPQ---IPHFPVYTRSGEVTISIELKKSGFMLSLQMLELITRLHQYIFS----HILRLEKPALEFKPTDADSAYCVLPLNVVNDSSTLDIDFKFMEDIEKSEARIGIPSTKYTKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQ--PLLDVDHTSSRLNLLTPRH-LNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLHCLLTAEEL 1070          

HSP 2 Score: 122.479 bits (306), Expect = 3.850e-27
Identity = 84/269 (31.23%), Postives = 135/269 (50.19%), Query Frame = 2
Query: 3281 NFVVK---NSDESVEVNNSREFI--------LIKNKNLADCCEAIIGSILTNYGIDYSIQYLQWLNLPLVP-------------------------------------------DNELNADIEISPKLAFQNISMDTDIPQSIN---DLEKILNYHFKNKGYIVQAITHPSSIANRKFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYLNYFDSKMFHILPKVVE-ELLNNQLQCEHSYK 3913
            +FVV     S+E+  V+  ++ I         I +K++ADC EA++G  LT+ G   +  +L  L L ++P                                           D+E    ++I P+  F +   D  +   I+   + EK +NY FKNK Y++QA TH S   N    CYQRLEFLGD+++D+L+T ++  + ++ +PG +T+LRSALVNN  FA L+VK+ +HKY      ++FH++   V+ +L  N++Q   S K
Sbjct: 1522 DFVVGFWNPSEENCGVDTGKQSISYDLHTEQCIADKSIADCVEALLGCYLTSCGERAAQLFLCSLGLKVLPVIKRTDREKALCPTRENFNSQQKNLSVSCAAASVASSRSSVLKDSEYGC-LKIPPRCMFDHPDADKTLNHLISGFENFEKKINYRFKNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVQFQLEKNEMQGMDSEK 1789          

HSP 3 Score: 73.559 bits (179), Expect = 3.050e-12
Identity = 40/88 (45.45%), Postives = 56/88 (63.64%), Query Frame = 2
Query: 3047 NDRTNLEQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVVKNSDES 3310
            +D  NLE+ E+LGDSFLK   + YLF    D  +EG+L+  RS+ +SN NL+ L  +KGL      + F+P  N+LPP +VV N D+S
Sbjct: 1307 SDGFNLERLEMLGDSFLKHAITTYLFCTYPDA-HEGRLSYMRSKKVSNCNLYRLGKKKGLPSRMVVSIFDPPVNWLPPGYVV-NQDKS 1392          
BLAST of Endoribonuclease Dicer vs. Ensembl Human
Match: DICER1 (dicer 1, ribonuclease III [Source:HGNC Symbol;Acc:HGNC:17098])

HSP 1 Score: 216.468 bits (550), Expect = 7.918e-56
Identity = 272/1068 (25.47%), Postives = 491/1068 (45.97%), Query Frame = 2
Query:   47 RDYQIEIYNKAKNENVIIKLNTGSGKTFIASMLIKDY-LNVKSD-----KKIFFLVKNSSLVHQHTNSLKDYLFLKDEIGYFYGQMENSWVD-NWTXXXXXXXXXXXXXXVMTAKVFLDILNHNKYNLSQVCYLIFDEVHHLTKSDDYSQISEHVIRTTSDIKILGLTACLIKGVKHVKDIEFAVKQLEHKLNCKVITSMDNIARE-FCGNIKETIINYETESFPDLVAIFKSAIEKIESFIPVDGHHSNDNSGSLNAEQNNFKTL-KKYLSESFSVLSTLGLVPCKLITDMFIEDLHGAVNNDSMFFDEKTKLYLDEFLSCLKFINSNIESYISKS--DMLMCSEKCKKLINLILDLKS--------------KNED------------------------------FKNTISILIFINEKIHVLALNVLLGILPKINKAFDFINSNFIIGHSTSQ-YPKKLQMSV--TKQXXXXXXXXXXXXXXXXATNVIEEGLDVSHCNIVVKFDPPQDFRSYLQSKGRARAQNSQYIVF--THETQKTEAQIQKFNLINEELNKILKSRVIEDELNKDDSERNVTPSEDDKYDYVPY----GENGPRITLNSASSVLNRYLGKLRCNSISE--PKIIYTYFQDEFNFHHVSLLLPMPAPYLEEIKGLPCSNKRRAKQFVNLEACKILHKYDELDSSLLPYNR--------------FDNNLVIQESNDIEIIKYEKYTATKLSTKFQNLSIPANKLYLYSIKYTPSVFL--KLGINDISMF---DVSTYLGILLPNPIHQNKDFMKFPIYLVGGMTSVEIKFEYNLPVNSINY-SLLLKCHKILFNIYSERIRRFDKNIF-FDPSKAKSS---IILTILKDNK---IDFNKIKEIITN---------------PIVDNLIKNDQSSWVGSVIRPNYIT-NEFGAFVISKVCHDMNADSIFKND--MTYEKFLNKKYNIILSPNEKLSPLIKV------IRLTTIQSCVNKERRFLRNNRKLQRINESECY-----FVPSLTECISLSSSLWTQLCIFPTIHHRMNQILSIEDF 2884
            R YQ+E+   A + N I+ LNTGSGKTFIA +L K+    ++ D     K+  FLV +++ V Q  ++++ +  LK       G+  N  V+ +WTK++W+++ +K+++++MT  V L++L +   +LS +  L+FDE H       Y +I +      S  +ILGLTA ++ G    +++E  +++LE  L     T+ D +  + +     E +++     F D   +++  + ++E  +    +  ND + S+++++ +   + K+ LS+  +VL  LG      +  M + +L   + ++      K  L+ D FL   + I++  E + S +  D+   + K  KL+ ++   K               +N+D                              F N +  +IF+  +   + LN L+    K +    +I+SNFI GH   +  P+  QM     KQ E+L+ F+  + N+LIAT+++EEG+D+  CN+VV+FD P ++RSY+QSKGRARA  S YI+   T + +  E  ++ +  I     KIL+++  +   + D  E ++ P  DD   + PY     + GPR+T+N+A   +NRY  +L  +  +   PK       D     + +L LP+ +P    I G P S  R A++ V L  C+ LHK  ELD  L+P  +               + ++  +  +      Y K     L   +     P    YLY I    +  L  +L      ++   D +   GIL   PI Q      FP+Y   G  ++ I+ + +  + S+    L+ + H+ +F+     I R +K    F P+ A S+   + L ++ D+    IDF  +++I  +               P V  L       +  +VI P Y   ++   F ++ V  D+   S F +    T+ ++   KYN+ L+   +  PL+ V      + L T +  +N++ + L  +   +R  + E        VP L     + +SLW +    P+I +R++ +L+ E+ 
Sbjct:   45 RKYQVELLEAALDHNTIVCLNTGSGKTFIAVLLTKELSYQIRGDFSRNGKRTVFLVNSANQVAQQVSAVRTHSDLK------VGEYSNLEVNASWTKERWNQEFTKHQVLIMTCYVALNVLKNGYLSLSDINLLVFDECHLAILDHPYREIMKLCENCPSCPRILGLTASILNGKCDPEELEEKIQKLEKILKSNAETATDLVVLDRYTSQPCEIVVD--CGPFTDRSGLYERLLMELEEAL----NFINDCNISVHSKERDSTLISKQILSDCRAVLVVLGPWCADKVAGMMVRELQKYIKHEQEELHRKFLLFTDTFL---RKIHALCEEHFSPASLDLKFVTPKVIKLLEILRKYKPYERQQFESVEWYNNRNQDNYVSWSDSEDDDEDEEIEEKEKPETNFPSPFTNILCGIIFVERRYTAVVLNRLIKEAGKQDPELAYISSNFITGHGIGKNQPRNKQMEAEFRKQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLVVRFDLPTEYRSYVQSKGRARAPISNYIMLADTDKIKSFEEDLKTYKAI----EKILRNKCSK---SVDTGETDIDPVMDDDDVFPPYVLRPDDGGPRVTINTAIGHINRYCARLPSDPFTHLAPKCRTRELPD--GTFYSTLYLPINSPLRASIVGPPMSCVRLAERVVALICCEKLHKIGELDDHLMPVGKETVKYEEELDLHDEEETSVPGRPGSTKRRQCYPKAIPECLRDSYPR---PDQPCYLYVIGMVLTTPLPDELNFRRRKLYPPEDTTRCFGILTAKPIPQ---IPHFPVYTRSGEVTISIELKKSGFMLSLQMLELITRLHQYIFS----HILRLEKPALEFKPTDADSAYCVLPLNVVNDSSTLDIDFKFMEDIEKSEARIGIPSTKYTKETPFVFKL-----EDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQ--PLLDVDHTSSRLNLLTPRH-LNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLHCLLTAEEL 1070          

HSP 2 Score: 122.094 bits (305), Expect = 9.366e-39
Identity = 82/263 (31.18%), Postives = 133/263 (50.57%), Query Frame = 2
Query: 3281 NFVVK---NSDESVEVNNSREFI--------LIKNKNLADCCEAIIGSILTNYGIDYSIQYLQWLNLPLVP-------------------------------------------DNELNADIEISPKLAFQNISMDTDIPQSIN---DLEKILNYHFKNKGYIVQAITHPSSIANRKFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYLNYFDSKMFHILPKVVE-ELLNNQLQ 3895
            +FVV     S+E+  V+  ++ I         I +K++ADC EA++G  LT+ G   +  +L  L L ++P                                           D+E    ++I P+  F +   D  +   I+   + EK +NY FKNK Y++QA TH S   N    CYQRLEFLGD+++D+L+T ++  + ++ +PG +T+LRSALVNN  FA L+VK+ +HKY      ++FH++   V+ +L  N++Q
Sbjct: 1522 DFVVGFWNPSEENCGVDTGKQSISYDLHTEQCIADKSIADCVEALLGCYLTSCGERAAQLFLCSLGLKVLPVIKRTDREKALCPTRENFNSQQKNLSVSCAAASVASSRSSVLKDSEYGC-LKIPPRCMFDHPDADKTLNHLISGFENFEKKINYRFKNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVQFQLEKNEMQ 1783          

HSP 3 Score: 60.8474 bits (146), Expect = 9.366e-39
Identity = 28/60 (46.67%), Postives = 39/60 (65.00%), Query Frame = 3
Query: 3933 VVKVLGDIFESIAGAIFVDSNYDLKAVWTVYKVFMEEPLKKFFNNIPRNKISMLHEKYPQ 4112
            V K +GDIFES+AGAI++DS   L+ VW VY   M   ++KF  N+PR+ +  L E  P+
Sbjct: 1804 VPKAMGDIFESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRSPVRELLEMEPE 1863          

HSP 4 Score: 73.559 bits (179), Expect = 2.903e-12
Identity = 40/88 (45.45%), Postives = 56/88 (63.64%), Query Frame = 2
Query: 3047 NDRTNLEQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVVKNSDES 3310
            +D  NLE+ E+LGDSFLK   + YLF    D  +EG+L+  RS+ +SN NL+ L  +KGL      + F+P  N+LPP +VV N D+S
Sbjct: 1307 SDGFNLERLEMLGDSFLKHAITTYLFCTYPDA-HEGRLSYMRSKKVSNCNLYRLGKKKGLPSRMVVSIFDPPVNWLPPGYVV-NQDKS 1392          
BLAST of Endoribonuclease Dicer vs. Ensembl Human
Match: DICER1 (dicer 1, ribonuclease III [Source:HGNC Symbol;Acc:HGNC:17098])

HSP 1 Score: 216.468 bits (550), Expect = 7.918e-56
Identity = 272/1068 (25.47%), Postives = 491/1068 (45.97%), Query Frame = 2
Query:   47 RDYQIEIYNKAKNENVIIKLNTGSGKTFIASMLIKDY-LNVKSD-----KKIFFLVKNSSLVHQHTNSLKDYLFLKDEIGYFYGQMENSWVD-NWTXXXXXXXXXXXXXXVMTAKVFLDILNHNKYNLSQVCYLIFDEVHHLTKSDDYSQISEHVIRTTSDIKILGLTACLIKGVKHVKDIEFAVKQLEHKLNCKVITSMDNIARE-FCGNIKETIINYETESFPDLVAIFKSAIEKIESFIPVDGHHSNDNSGSLNAEQNNFKTL-KKYLSESFSVLSTLGLVPCKLITDMFIEDLHGAVNNDSMFFDEKTKLYLDEFLSCLKFINSNIESYISKS--DMLMCSEKCKKLINLILDLKS--------------KNED------------------------------FKNTISILIFINEKIHVLALNVLLGILPKINKAFDFINSNFIIGHSTSQ-YPKKLQMSV--TKQXXXXXXXXXXXXXXXXATNVIEEGLDVSHCNIVVKFDPPQDFRSYLQSKGRARAQNSQYIVF--THETQKTEAQIQKFNLINEELNKILKSRVIEDELNKDDSERNVTPSEDDKYDYVPY----GENGPRITLNSASSVLNRYLGKLRCNSISE--PKIIYTYFQDEFNFHHVSLLLPMPAPYLEEIKGLPCSNKRRAKQFVNLEACKILHKYDELDSSLLPYNR--------------FDNNLVIQESNDIEIIKYEKYTATKLSTKFQNLSIPANKLYLYSIKYTPSVFL--KLGINDISMF---DVSTYLGILLPNPIHQNKDFMKFPIYLVGGMTSVEIKFEYNLPVNSINY-SLLLKCHKILFNIYSERIRRFDKNIF-FDPSKAKSS---IILTILKDNK---IDFNKIKEIITN---------------PIVDNLIKNDQSSWVGSVIRPNYIT-NEFGAFVISKVCHDMNADSIFKND--MTYEKFLNKKYNIILSPNEKLSPLIKV------IRLTTIQSCVNKERRFLRNNRKLQRINESECY-----FVPSLTECISLSSSLWTQLCIFPTIHHRMNQILSIEDF 2884
            R YQ+E+   A + N I+ LNTGSGKTFIA +L K+    ++ D     K+  FLV +++ V Q  ++++ +  LK       G+  N  V+ +WTK++W+++ +K+++++MT  V L++L +   +LS +  L+FDE H       Y +I +      S  +ILGLTA ++ G    +++E  +++LE  L     T+ D +  + +     E +++     F D   +++  + ++E  +    +  ND + S+++++ +   + K+ LS+  +VL  LG      +  M + +L   + ++      K  L+ D FL   + I++  E + S +  D+   + K  KL+ ++   K               +N+D                              F N +  +IF+  +   + LN L+    K +    +I+SNFI GH   +  P+  QM     KQ E+L+ F+  + N+LIAT+++EEG+D+  CN+VV+FD P ++RSY+QSKGRARA  S YI+   T + +  E  ++ +  I     KIL+++  +   + D  E ++ P  DD   + PY     + GPR+T+N+A   +NRY  +L  +  +   PK       D     + +L LP+ +P    I G P S  R A++ V L  C+ LHK  ELD  L+P  +               + ++  +  +      Y K     L   +     P    YLY I    +  L  +L      ++   D +   GIL   PI Q      FP+Y   G  ++ I+ + +  + S+    L+ + H+ +F+     I R +K    F P+ A S+   + L ++ D+    IDF  +++I  +               P V  L       +  +VI P Y   ++   F ++ V  D+   S F +    T+ ++   KYN+ L+   +  PL+ V      + L T +  +N++ + L  +   +R  + E        VP L     + +SLW +    P+I +R++ +L+ E+ 
Sbjct:   45 RKYQVELLEAALDHNTIVCLNTGSGKTFIAVLLTKELSYQIRGDFSRNGKRTVFLVNSANQVAQQVSAVRTHSDLK------VGEYSNLEVNASWTKERWNQEFTKHQVLIMTCYVALNVLKNGYLSLSDINLLVFDECHLAILDHPYREIMKLCENCPSCPRILGLTASILNGKCDPEELEEKIQKLEKILKSNAETATDLVVLDRYTSQPCEIVVD--CGPFTDRSGLYERLLMELEEAL----NFINDCNISVHSKERDSTLISKQILSDCRAVLVVLGPWCADKVAGMMVRELQKYIKHEQEELHRKFLLFTDTFL---RKIHALCEEHFSPASLDLKFVTPKVIKLLEILRKYKPYERQQFESVEWYNNRNQDNYVSWSDSEDDDEDEEIEEKEKPETNFPSPFTNILCGIIFVERRYTAVVLNRLIKEAGKQDPELAYISSNFITGHGIGKNQPRNKQMEAEFRKQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLVVRFDLPTEYRSYVQSKGRARAPISNYIMLADTDKIKSFEEDLKTYKAI----EKILRNKCSK---SVDTGETDIDPVMDDDDVFPPYVLRPDDGGPRVTINTAIGHINRYCARLPSDPFTHLAPKCRTRELPD--GTFYSTLYLPINSPLRASIVGPPMSCVRLAERVVALICCEKLHKIGELDDHLMPVGKETVKYEEELDLHDEEETSVPGRPGSTKRRQCYPKAIPECLRDSYPR---PDQPCYLYVIGMVLTTPLPDELNFRRRKLYPPEDTTRCFGILTAKPIPQ---IPHFPVYTRSGEVTISIELKKSGFMLSLQMLELITRLHQYIFS----HILRLEKPALEFKPTDADSAYCVLPLNVVNDSSTLDIDFKFMEDIEKSEARIGIPSTKYTKETPFVFKL-----EDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQ--PLLDVDHTSSRLNLLTPRH-LNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLHCLLTAEEL 1070          

HSP 2 Score: 122.094 bits (305), Expect = 9.366e-39
Identity = 82/263 (31.18%), Postives = 133/263 (50.57%), Query Frame = 2
Query: 3281 NFVVK---NSDESVEVNNSREFI--------LIKNKNLADCCEAIIGSILTNYGIDYSIQYLQWLNLPLVP-------------------------------------------DNELNADIEISPKLAFQNISMDTDIPQSIN---DLEKILNYHFKNKGYIVQAITHPSSIANRKFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYLNYFDSKMFHILPKVVE-ELLNNQLQ 3895
            +FVV     S+E+  V+  ++ I         I +K++ADC EA++G  LT+ G   +  +L  L L ++P                                           D+E    ++I P+  F +   D  +   I+   + EK +NY FKNK Y++QA TH S   N    CYQRLEFLGD+++D+L+T ++  + ++ +PG +T+LRSALVNN  FA L+VK+ +HKY      ++FH++   V+ +L  N++Q
Sbjct: 1522 DFVVGFWNPSEENCGVDTGKQSISYDLHTEQCIADKSIADCVEALLGCYLTSCGERAAQLFLCSLGLKVLPVIKRTDREKALCPTRENFNSQQKNLSVSCAAASVASSRSSVLKDSEYGC-LKIPPRCMFDHPDADKTLNHLISGFENFEKKINYRFKNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVQFQLEKNEMQ 1783          

HSP 3 Score: 60.8474 bits (146), Expect = 9.366e-39
Identity = 28/60 (46.67%), Postives = 39/60 (65.00%), Query Frame = 3
Query: 3933 VVKVLGDIFESIAGAIFVDSNYDLKAVWTVYKVFMEEPLKKFFNNIPRNKISMLHEKYPQ 4112
            V K +GDIFES+AGAI++DS   L+ VW VY   M   ++KF  N+PR+ +  L E  P+
Sbjct: 1804 VPKAMGDIFESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRSPVRELLEMEPE 1863          

HSP 4 Score: 73.559 bits (179), Expect = 2.903e-12
Identity = 40/88 (45.45%), Postives = 56/88 (63.64%), Query Frame = 2
Query: 3047 NDRTNLEQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVVKNSDES 3310
            +D  NLE+ E+LGDSFLK   + YLF    D  +EG+L+  RS+ +SN NL+ L  +KGL      + F+P  N+LPP +VV N D+S
Sbjct: 1307 SDGFNLERLEMLGDSFLKHAITTYLFCTYPDA-HEGRLSYMRSKKVSNCNLYRLGKKKGLPSRMVVSIFDPPVNWLPPGYVV-NQDKS 1392          
BLAST of Endoribonuclease Dicer vs. Ensembl Human
Match: DICER1 (dicer 1, ribonuclease III [Source:HGNC Symbol;Acc:HGNC:17098])

HSP 1 Score: 216.468 bits (550), Expect = 7.918e-56
Identity = 272/1068 (25.47%), Postives = 491/1068 (45.97%), Query Frame = 2
Query:   47 RDYQIEIYNKAKNENVIIKLNTGSGKTFIASMLIKDY-LNVKSD-----KKIFFLVKNSSLVHQHTNSLKDYLFLKDEIGYFYGQMENSWVD-NWTXXXXXXXXXXXXXXVMTAKVFLDILNHNKYNLSQVCYLIFDEVHHLTKSDDYSQISEHVIRTTSDIKILGLTACLIKGVKHVKDIEFAVKQLEHKLNCKVITSMDNIARE-FCGNIKETIINYETESFPDLVAIFKSAIEKIESFIPVDGHHSNDNSGSLNAEQNNFKTL-KKYLSESFSVLSTLGLVPCKLITDMFIEDLHGAVNNDSMFFDEKTKLYLDEFLSCLKFINSNIESYISKS--DMLMCSEKCKKLINLILDLKS--------------KNED------------------------------FKNTISILIFINEKIHVLALNVLLGILPKINKAFDFINSNFIIGHSTSQ-YPKKLQMSV--TKQXXXXXXXXXXXXXXXXATNVIEEGLDVSHCNIVVKFDPPQDFRSYLQSKGRARAQNSQYIVF--THETQKTEAQIQKFNLINEELNKILKSRVIEDELNKDDSERNVTPSEDDKYDYVPY----GENGPRITLNSASSVLNRYLGKLRCNSISE--PKIIYTYFQDEFNFHHVSLLLPMPAPYLEEIKGLPCSNKRRAKQFVNLEACKILHKYDELDSSLLPYNR--------------FDNNLVIQESNDIEIIKYEKYTATKLSTKFQNLSIPANKLYLYSIKYTPSVFL--KLGINDISMF---DVSTYLGILLPNPIHQNKDFMKFPIYLVGGMTSVEIKFEYNLPVNSINY-SLLLKCHKILFNIYSERIRRFDKNIF-FDPSKAKSS---IILTILKDNK---IDFNKIKEIITN---------------PIVDNLIKNDQSSWVGSVIRPNYIT-NEFGAFVISKVCHDMNADSIFKND--MTYEKFLNKKYNIILSPNEKLSPLIKV------IRLTTIQSCVNKERRFLRNNRKLQRINESECY-----FVPSLTECISLSSSLWTQLCIFPTIHHRMNQILSIEDF 2884
            R YQ+E+   A + N I+ LNTGSGKTFIA +L K+    ++ D     K+  FLV +++ V Q  ++++ +  LK       G+  N  V+ +WTK++W+++ +K+++++MT  V L++L +   +LS +  L+FDE H       Y +I +      S  +ILGLTA ++ G    +++E  +++LE  L     T+ D +  + +     E +++     F D   +++  + ++E  +    +  ND + S+++++ +   + K+ LS+  +VL  LG      +  M + +L   + ++      K  L+ D FL   + I++  E + S +  D+   + K  KL+ ++   K               +N+D                              F N +  +IF+  +   + LN L+    K +    +I+SNFI GH   +  P+  QM     KQ E+L+ F+  + N+LIAT+++EEG+D+  CN+VV+FD P ++RSY+QSKGRARA  S YI+   T + +  E  ++ +  I     KIL+++  +   + D  E ++ P  DD   + PY     + GPR+T+N+A   +NRY  +L  +  +   PK       D     + +L LP+ +P    I G P S  R A++ V L  C+ LHK  ELD  L+P  +               + ++  +  +      Y K     L   +     P    YLY I    +  L  +L      ++   D +   GIL   PI Q      FP+Y   G  ++ I+ + +  + S+    L+ + H+ +F+     I R +K    F P+ A S+   + L ++ D+    IDF  +++I  +               P V  L       +  +VI P Y   ++   F ++ V  D+   S F +    T+ ++   KYN+ L+   +  PL+ V      + L T +  +N++ + L  +   +R  + E        VP L     + +SLW +    P+I +R++ +L+ E+ 
Sbjct:   45 RKYQVELLEAALDHNTIVCLNTGSGKTFIAVLLTKELSYQIRGDFSRNGKRTVFLVNSANQVAQQVSAVRTHSDLK------VGEYSNLEVNASWTKERWNQEFTKHQVLIMTCYVALNVLKNGYLSLSDINLLVFDECHLAILDHPYREIMKLCENCPSCPRILGLTASILNGKCDPEELEEKIQKLEKILKSNAETATDLVVLDRYTSQPCEIVVD--CGPFTDRSGLYERLLMELEEAL----NFINDCNISVHSKERDSTLISKQILSDCRAVLVVLGPWCADKVAGMMVRELQKYIKHEQEELHRKFLLFTDTFL---RKIHALCEEHFSPASLDLKFVTPKVIKLLEILRKYKPYERQQFESVEWYNNRNQDNYVSWSDSEDDDEDEEIEEKEKPETNFPSPFTNILCGIIFVERRYTAVVLNRLIKEAGKQDPELAYISSNFITGHGIGKNQPRNKQMEAEFRKQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLVVRFDLPTEYRSYVQSKGRARAPISNYIMLADTDKIKSFEEDLKTYKAI----EKILRNKCSK---SVDTGETDIDPVMDDDDVFPPYVLRPDDGGPRVTINTAIGHINRYCARLPSDPFTHLAPKCRTRELPD--GTFYSTLYLPINSPLRASIVGPPMSCVRLAERVVALICCEKLHKIGELDDHLMPVGKETVKYEEELDLHDEEETSVPGRPGSTKRRQCYPKAIPECLRDSYPR---PDQPCYLYVIGMVLTTPLPDELNFRRRKLYPPEDTTRCFGILTAKPIPQ---IPHFPVYTRSGEVTISIELKKSGFMLSLQMLELITRLHQYIFS----HILRLEKPALEFKPTDADSAYCVLPLNVVNDSSTLDIDFKFMEDIEKSEARIGIPSTKYTKETPFVFKL-----EDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQ--PLLDVDHTSSRLNLLTPRH-LNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLHCLLTAEEL 1070          

HSP 2 Score: 122.094 bits (305), Expect = 9.366e-39
Identity = 82/263 (31.18%), Postives = 133/263 (50.57%), Query Frame = 2
Query: 3281 NFVVK---NSDESVEVNNSREFI--------LIKNKNLADCCEAIIGSILTNYGIDYSIQYLQWLNLPLVP-------------------------------------------DNELNADIEISPKLAFQNISMDTDIPQSIN---DLEKILNYHFKNKGYIVQAITHPSSIANRKFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYLNYFDSKMFHILPKVVE-ELLNNQLQ 3895
            +FVV     S+E+  V+  ++ I         I +K++ADC EA++G  LT+ G   +  +L  L L ++P                                           D+E    ++I P+  F +   D  +   I+   + EK +NY FKNK Y++QA TH S   N    CYQRLEFLGD+++D+L+T ++  + ++ +PG +T+LRSALVNN  FA L+VK+ +HKY      ++FH++   V+ +L  N++Q
Sbjct: 1522 DFVVGFWNPSEENCGVDTGKQSISYDLHTEQCIADKSIADCVEALLGCYLTSCGERAAQLFLCSLGLKVLPVIKRTDREKALCPTRENFNSQQKNLSVSCAAASVASSRSSVLKDSEYGC-LKIPPRCMFDHPDADKTLNHLISGFENFEKKINYRFKNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVQFQLEKNEMQ 1783          

HSP 3 Score: 60.8474 bits (146), Expect = 9.366e-39
Identity = 28/60 (46.67%), Postives = 39/60 (65.00%), Query Frame = 3
Query: 3933 VVKVLGDIFESIAGAIFVDSNYDLKAVWTVYKVFMEEPLKKFFNNIPRNKISMLHEKYPQ 4112
            V K +GDIFES+AGAI++DS   L+ VW VY   M   ++KF  N+PR+ +  L E  P+
Sbjct: 1804 VPKAMGDIFESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRSPVRELLEMEPE 1863          

HSP 4 Score: 73.559 bits (179), Expect = 2.903e-12
Identity = 40/88 (45.45%), Postives = 56/88 (63.64%), Query Frame = 2
Query: 3047 NDRTNLEQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVVKNSDES 3310
            +D  NLE+ E+LGDSFLK   + YLF    D  +EG+L+  RS+ +SN NL+ L  +KGL      + F+P  N+LPP +VV N D+S
Sbjct: 1307 SDGFNLERLEMLGDSFLKHAITTYLFCTYPDA-HEGRLSYMRSKKVSNCNLYRLGKKKGLPSRMVVSIFDPPVNWLPPGYVV-NQDKS 1392          
BLAST of Endoribonuclease Dicer vs. Ensembl Human
Match: DICER1 (dicer 1, ribonuclease III [Source:HGNC Symbol;Acc:HGNC:17098])

HSP 1 Score: 216.468 bits (550), Expect = 7.918e-56
Identity = 272/1068 (25.47%), Postives = 491/1068 (45.97%), Query Frame = 2
Query:   47 RDYQIEIYNKAKNENVIIKLNTGSGKTFIASMLIKDY-LNVKSD-----KKIFFLVKNSSLVHQHTNSLKDYLFLKDEIGYFYGQMENSWVD-NWTXXXXXXXXXXXXXXVMTAKVFLDILNHNKYNLSQVCYLIFDEVHHLTKSDDYSQISEHVIRTTSDIKILGLTACLIKGVKHVKDIEFAVKQLEHKLNCKVITSMDNIARE-FCGNIKETIINYETESFPDLVAIFKSAIEKIESFIPVDGHHSNDNSGSLNAEQNNFKTL-KKYLSESFSVLSTLGLVPCKLITDMFIEDLHGAVNNDSMFFDEKTKLYLDEFLSCLKFINSNIESYISKS--DMLMCSEKCKKLINLILDLKS--------------KNED------------------------------FKNTISILIFINEKIHVLALNVLLGILPKINKAFDFINSNFIIGHSTSQ-YPKKLQMSV--TKQXXXXXXXXXXXXXXXXATNVIEEGLDVSHCNIVVKFDPPQDFRSYLQSKGRARAQNSQYIVF--THETQKTEAQIQKFNLINEELNKILKSRVIEDELNKDDSERNVTPSEDDKYDYVPY----GENGPRITLNSASSVLNRYLGKLRCNSISE--PKIIYTYFQDEFNFHHVSLLLPMPAPYLEEIKGLPCSNKRRAKQFVNLEACKILHKYDELDSSLLPYNR--------------FDNNLVIQESNDIEIIKYEKYTATKLSTKFQNLSIPANKLYLYSIKYTPSVFL--KLGINDISMF---DVSTYLGILLPNPIHQNKDFMKFPIYLVGGMTSVEIKFEYNLPVNSINY-SLLLKCHKILFNIYSERIRRFDKNIF-FDPSKAKSS---IILTILKDNK---IDFNKIKEIITN---------------PIVDNLIKNDQSSWVGSVIRPNYIT-NEFGAFVISKVCHDMNADSIFKND--MTYEKFLNKKYNIILSPNEKLSPLIKV------IRLTTIQSCVNKERRFLRNNRKLQRINESECY-----FVPSLTECISLSSSLWTQLCIFPTIHHRMNQILSIEDF 2884
            R YQ+E+   A + N I+ LNTGSGKTFIA +L K+    ++ D     K+  FLV +++ V Q  ++++ +  LK       G+  N  V+ +WTK++W+++ +K+++++MT  V L++L +   +LS +  L+FDE H       Y +I +      S  +ILGLTA ++ G    +++E  +++LE  L     T+ D +  + +     E +++     F D   +++  + ++E  +    +  ND + S+++++ +   + K+ LS+  +VL  LG      +  M + +L   + ++      K  L+ D FL   + I++  E + S +  D+   + K  KL+ ++   K               +N+D                              F N +  +IF+  +   + LN L+    K +    +I+SNFI GH   +  P+  QM     KQ E+L+ F+  + N+LIAT+++EEG+D+  CN+VV+FD P ++RSY+QSKGRARA  S YI+   T + +  E  ++ +  I     KIL+++  +   + D  E ++ P  DD   + PY     + GPR+T+N+A   +NRY  +L  +  +   PK       D     + +L LP+ +P    I G P S  R A++ V L  C+ LHK  ELD  L+P  +               + ++  +  +      Y K     L   +     P    YLY I    +  L  +L      ++   D +   GIL   PI Q      FP+Y   G  ++ I+ + +  + S+    L+ + H+ +F+     I R +K    F P+ A S+   + L ++ D+    IDF  +++I  +               P V  L       +  +VI P Y   ++   F ++ V  D+   S F +    T+ ++   KYN+ L+   +  PL+ V      + L T +  +N++ + L  +   +R  + E        VP L     + +SLW +    P+I +R++ +L+ E+ 
Sbjct:   45 RKYQVELLEAALDHNTIVCLNTGSGKTFIAVLLTKELSYQIRGDFSRNGKRTVFLVNSANQVAQQVSAVRTHSDLK------VGEYSNLEVNASWTKERWNQEFTKHQVLIMTCYVALNVLKNGYLSLSDINLLVFDECHLAILDHPYREIMKLCENCPSCPRILGLTASILNGKCDPEELEEKIQKLEKILKSNAETATDLVVLDRYTSQPCEIVVD--CGPFTDRSGLYERLLMELEEAL----NFINDCNISVHSKERDSTLISKQILSDCRAVLVVLGPWCADKVAGMMVRELQKYIKHEQEELHRKFLLFTDTFL---RKIHALCEEHFSPASLDLKFVTPKVIKLLEILRKYKPYERQQFESVEWYNNRNQDNYVSWSDSEDDDEDEEIEEKEKPETNFPSPFTNILCGIIFVERRYTAVVLNRLIKEAGKQDPELAYISSNFITGHGIGKNQPRNKQMEAEFRKQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLVVRFDLPTEYRSYVQSKGRARAPISNYIMLADTDKIKSFEEDLKTYKAI----EKILRNKCSK---SVDTGETDIDPVMDDDDVFPPYVLRPDDGGPRVTINTAIGHINRYCARLPSDPFTHLAPKCRTRELPD--GTFYSTLYLPINSPLRASIVGPPMSCVRLAERVVALICCEKLHKIGELDDHLMPVGKETVKYEEELDLHDEEETSVPGRPGSTKRRQCYPKAIPECLRDSYPR---PDQPCYLYVIGMVLTTPLPDELNFRRRKLYPPEDTTRCFGILTAKPIPQ---IPHFPVYTRSGEVTISIELKKSGFMLSLQMLELITRLHQYIFS----HILRLEKPALEFKPTDADSAYCVLPLNVVNDSSTLDIDFKFMEDIEKSEARIGIPSTKYTKETPFVFKL-----EDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQ--PLLDVDHTSSRLNLLTPRH-LNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLHCLLTAEEL 1070          

HSP 2 Score: 122.094 bits (305), Expect = 9.366e-39
Identity = 82/263 (31.18%), Postives = 133/263 (50.57%), Query Frame = 2
Query: 3281 NFVVK---NSDESVEVNNSREFI--------LIKNKNLADCCEAIIGSILTNYGIDYSIQYLQWLNLPLVP-------------------------------------------DNELNADIEISPKLAFQNISMDTDIPQSIN---DLEKILNYHFKNKGYIVQAITHPSSIANRKFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYLNYFDSKMFHILPKVVE-ELLNNQLQ 3895
            +FVV     S+E+  V+  ++ I         I +K++ADC EA++G  LT+ G   +  +L  L L ++P                                           D+E    ++I P+  F +   D  +   I+   + EK +NY FKNK Y++QA TH S   N    CYQRLEFLGD+++D+L+T ++  + ++ +PG +T+LRSALVNN  FA L+VK+ +HKY      ++FH++   V+ +L  N++Q
Sbjct: 1522 DFVVGFWNPSEENCGVDTGKQSISYDLHTEQCIADKSIADCVEALLGCYLTSCGERAAQLFLCSLGLKVLPVIKRTDREKALCPTRENFNSQQKNLSVSCAAASVASSRSSVLKDSEYGC-LKIPPRCMFDHPDADKTLNHLISGFENFEKKINYRFKNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVQFQLEKNEMQ 1783          

HSP 3 Score: 60.8474 bits (146), Expect = 9.366e-39
Identity = 28/60 (46.67%), Postives = 39/60 (65.00%), Query Frame = 3
Query: 3933 VVKVLGDIFESIAGAIFVDSNYDLKAVWTVYKVFMEEPLKKFFNNIPRNKISMLHEKYPQ 4112
            V K +GDIFES+AGAI++DS   L+ VW VY   M   ++KF  N+PR+ +  L E  P+
Sbjct: 1804 VPKAMGDIFESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRSPVRELLEMEPE 1863          

HSP 4 Score: 73.559 bits (179), Expect = 2.903e-12
Identity = 40/88 (45.45%), Postives = 56/88 (63.64%), Query Frame = 2
Query: 3047 NDRTNLEQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVVKNSDES 3310
            +D  NLE+ E+LGDSFLK   + YLF    D  +EG+L+  RS+ +SN NL+ L  +KGL      + F+P  N+LPP +VV N D+S
Sbjct: 1307 SDGFNLERLEMLGDSFLKHAITTYLFCTYPDA-HEGRLSYMRSKKVSNCNLYRLGKKKGLPSRMVVSIFDPPVNWLPPGYVV-NQDKS 1392          
BLAST of Endoribonuclease Dicer vs. Ensembl Celegans
Match: dcr-1 (Endoribonuclease dcr-1 Death-promoting deoxyribonuclease [Source:UniProtKB/Swiss-Prot;Acc:P34529])

HSP 1 Score: 189.119 bits (479), Expect = 6.052e-48
Identity = 186/685 (27.15%), Postives = 334/685 (48.76%), Query Frame = 2
Query:   47 RDYQIEIYNKAKNENVIIKLNTGSGKTFIASMLIKDY-------LNVKSDKKIFFLVKNSSLVHQHTNSLKDYLFLKDEIGYFYGQMENSWVDNWTXXXXXXXXXXXXXXVMTAKVFLDILNHNKYNLSQVCYLIFDEVHH-LTKSDDYSQI--SEHVIRTTSDI-KILGLTACLIKGVKHVKDIEFAVKQLEHKLNCKVITSMDNIA-REFCGNIKETII-------------NYET--ESFPDLVAIFKSAIEKIESFIPVDGHHSNDNSGSLNAEQNNFKTLKKYLSESFSVLSTLGLVPCKLITDMFIEDLHGAVNNDSMFFDEKTKLYLDEFLSCLKFINSNIESYISKSDMLMCSEK--CKKLINLILDLKSKNEDFKNT---------ISILIFINEKIHVLALNVLLGILPKINKAFDFINSNFIIGHSTSQYPKKLQMSVTK-QXXXXXXXXXXXXXXXXATNVIEEGLDVSHCNIVVKFDPPQDFRSYLQSKGRARAQNSQYIVFTHE--TQKTEAQIQKFNLINEELNKIL--KSRVIEDELNKDDSERNVTPSEDDKYDYVPYGENGPRITLNSASSVLNRYLGKLRCNSISEPKIIYTYF----------QDEFNFHHVSLLLPMPAPYLEEIK-GLPCSNKRRAKQFVNLEACKILHKYDELDSSLLPYNR 1939
            RDYQ+E+ +KA  +N I++L TGSGKTFIA +L+K+Y       L+ +  K+ FF+V+  +LV Q    ++ +   K  +G  +GQ  +   D  +K++  + + ++ ++V+TA+  LD++ H    +  +C LIFDE HH L     Y  I     +++    + ++LGLTA LIK     + +   +K+LE  ++  + T+ D ++  ++     E +I             N++T  E F + VA   +  E    F P             + + +  + +K  L  + +V   LG         ++ ++L   +   S    +KT  +L+   + +  I   +E  + K   +        +++I L   L++ N +F+           +S +IF++++    +L +++  +      F F+N ++++G S           + K Q E+L+ F   + N LIAT+V+EEG+DV  CN+V+KFD P D RSY+QSKGRAR   S+Y++   E  T   ++ ++ F    +++ KIL  + R + + + +DDS+R      D + +     + G  + +++A +++NRY  KL       P  I+T            ++    +   LLLP+ +P    I    P  NK+ A+  V LEAC+ LH   ELD +LLP  R
Sbjct:   14 RDYQVELLDKATKKNTIVQLGTGSGKTFIAVLLLKEYGVQLFAPLD-QGGKRAFFVVEKVNLVEQQAIHIEVHTSFK--VGQVHGQTSSGLWD--SKEQCDQFMKRHHVVVITAQCLLDLIRHAYLKIEDMCVLIFDECHHALGSQHPYRSIMVDYKLLKKDKPVPRVLGLTASLIKAKVAPEKLMEQLKKLESAMDSVIETASDLVSLSKYGAKPYEVVIICKDFEIGCLGIPNFDTVIEIFDETVAFVNTTTE----FHP-------------DLDLDPRRPIKDSLKTTRAVFRQLGPWAAWRTAQVWEKELGKIIK--SQVLPDKTLRFLNMAKTSMITIKRLLEPEMKKIKSIEALRPYVPQRVIRLFEILETFNPEFQKERMKLEKAEHLSAIIFVDQRYIAYSLLLMMRHIKSWEPKFKFVNPDYVVGASGRNLASSDSQGLHKRQTEVLRRFHRNEINCLIATSVLEEGVDVKQCNLVIKFDRPLDMRSYVQSKGRARRAGSRYVITVEEKDTAACDSDLKDF----QQIEKILLSRHRTVNNPI-EDDSDRFEEFDVDSQMEPYVVEKTGATLKMSTAIALINRYCSKL-------PSDIFTRLVPHNQIIPIEENGVTKYCAELLLPINSPIKHAIVLKNPMPNKKTAQMAVALEACRQLHLEGELDDNLLPKGR 662          

HSP 2 Score: 157.532 bits (397), Expect = 1.565e-46
Identity = 116/366 (31.69%), Postives = 179/366 (48.91%), Query Frame = 2
Query: 3014 NIFPCFM-----AKTCNDRTNLEQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPP------NFVVKNSDESVEVNNSREFILIK-------------------NKNLADCCEAI-------IG---------SILTNYGI-DYSI---------------------QYLQWLNLPLVPDNELNADIEISPKLAFQNISMDTDIPQSIN------------DLEKILNYHFKNKGYIVQAITHPSSIANRKFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYLNYFDSKMFHILPKVVE 3871
             + PC +          D  +LE+FE +GDSFLKF T+ YL+H   D  +EGKL+  RS+ +SN NL+ L  + G+ +      F+   ++LPP      +F   N+D++ E +N  E IL                     +K+  D  E I       +G         ++LT   I D SI                     + + W+ L ++  ++  +D+  SP L F  I   T+   S+N             LE+ + Y FK + Y+VQA TH S I NR   CYQRLEFLGD+V+D+++T Y+  ++++ +PG +T+LRSALVNN  FA L+VKF F K+       ++H++ K V+
Sbjct: 1391 GVSPCLLLTALTTSNAADGMSLERFETIGDSFLKFATTDYLYHTLLD-QHEGKLSFARSKEVSNCNLYRLGKKLGIPQLIVANKFDAHDSWLPPCYIPTCDFKAPNTDDAEEKDNEIERILDGQVIEEKPENKTGWDIGGDVSKSTTDGIETITFPKQARVGNDDISPLPYNLLTQQHISDKSIADAVEALIGVHLLTLGPNPTLKVMNWMGLKVIQKDQ-KSDVP-SPLLRF--IDTPTNPNASLNFLNNLWQQFQFTQLEEKIGYRFKERAYLVQAFTHASYINNRVTGCYQRLEFLGDAVLDYMITRYLFEDSRQYSPGVLTDLRSALVNNTIFASLAVKFEFQKHFIAMCPGLYHMIEKFVK 1751          

HSP 3 Score: 50.447 bits (119), Expect = 1.565e-46
Identity = 35/104 (33.65%), Postives = 50/104 (48.08%), Query Frame = 3
Query: 3933 VVKVLGDIFESIAGAIFVDSNYDLKAVWTVYKVFMEEPLKKFFNNIPRNKISMLHEKYPQMKCTFENQEF---SNLIKLTAILPNGSVIEKYERNKILCKLSLA 4235
            V K +GDIFES+AGAI++DS  +L   W V    M   ++    N PR+ I  L E + Q K  F   E    S  +++T  + N        RN  + K + A
Sbjct: 1785 VPKAMGDIFESVAGAIYLDSGRNLDTTWQVIFHMMRGTIELCCANPPRSPIRELME-FEQSKVRFSKMERILESGKVRVTVEVVNNMRFTGMGRNYRIAKATAA 1887          
BLAST of Endoribonuclease Dicer vs. Ensembl Celegans
Match: dcr-1 (Endoribonuclease dcr-1 Death-promoting deoxyribonuclease [Source:UniProtKB/Swiss-Prot;Acc:P34529])

HSP 1 Score: 189.119 bits (479), Expect = 6.052e-48
Identity = 186/685 (27.15%), Postives = 334/685 (48.76%), Query Frame = 2
Query:   47 RDYQIEIYNKAKNENVIIKLNTGSGKTFIASMLIKDY-------LNVKSDKKIFFLVKNSSLVHQHTNSLKDYLFLKDEIGYFYGQMENSWVDNWTXXXXXXXXXXXXXXVMTAKVFLDILNHNKYNLSQVCYLIFDEVHH-LTKSDDYSQI--SEHVIRTTSDI-KILGLTACLIKGVKHVKDIEFAVKQLEHKLNCKVITSMDNIA-REFCGNIKETII-------------NYET--ESFPDLVAIFKSAIEKIESFIPVDGHHSNDNSGSLNAEQNNFKTLKKYLSESFSVLSTLGLVPCKLITDMFIEDLHGAVNNDSMFFDEKTKLYLDEFLSCLKFINSNIESYISKSDMLMCSEK--CKKLINLILDLKSKNEDFKNT---------ISILIFINEKIHVLALNVLLGILPKINKAFDFINSNFIIGHSTSQYPKKLQMSVTK-QXXXXXXXXXXXXXXXXATNVIEEGLDVSHCNIVVKFDPPQDFRSYLQSKGRARAQNSQYIVFTHE--TQKTEAQIQKFNLINEELNKIL--KSRVIEDELNKDDSERNVTPSEDDKYDYVPYGENGPRITLNSASSVLNRYLGKLRCNSISEPKIIYTYF----------QDEFNFHHVSLLLPMPAPYLEEIK-GLPCSNKRRAKQFVNLEACKILHKYDELDSSLLPYNR 1939
            RDYQ+E+ +KA  +N I++L TGSGKTFIA +L+K+Y       L+ +  K+ FF+V+  +LV Q    ++ +   K  +G  +GQ  +   D  +K++  + + ++ ++V+TA+  LD++ H    +  +C LIFDE HH L     Y  I     +++    + ++LGLTA LIK     + +   +K+LE  ++  + T+ D ++  ++     E +I             N++T  E F + VA   +  E    F P             + + +  + +K  L  + +V   LG         ++ ++L   +   S    +KT  +L+   + +  I   +E  + K   +        +++I L   L++ N +F+           +S +IF++++    +L +++  +      F F+N ++++G S           + K Q E+L+ F   + N LIAT+V+EEG+DV  CN+V+KFD P D RSY+QSKGRAR   S+Y++   E  T   ++ ++ F    +++ KIL  + R + + + +DDS+R      D + +     + G  + +++A +++NRY  KL       P  I+T            ++    +   LLLP+ +P    I    P  NK+ A+  V LEAC+ LH   ELD +LLP  R
Sbjct:   14 RDYQVELLDKATKKNTIVQLGTGSGKTFIAVLLLKEYGVQLFAPLD-QGGKRAFFVVEKVNLVEQQAIHIEVHTSFK--VGQVHGQTSSGLWD--SKEQCDQFMKRHHVVVITAQCLLDLIRHAYLKIEDMCVLIFDECHHALGSQHPYRSIMVDYKLLKKDKPVPRVLGLTASLIKAKVAPEKLMEQLKKLESAMDSVIETASDLVSLSKYGAKPYEVVIICKDFEIGCLGIPNFDTVIEIFDETVAFVNTTTE----FHP-------------DLDLDPRRPIKDSLKTTRAVFRQLGPWAAWRTAQVWEKELGKIIK--SQVLPDKTLRFLNMAKTSMITIKRLLEPEMKKIKSIEALRPYVPQRVIRLFEILETFNPEFQKERMKLEKAEHLSAIIFVDQRYIAYSLLLMMRHIKSWEPKFKFVNPDYVVGASGRNLASSDSQGLHKRQTEVLRRFHRNEINCLIATSVLEEGVDVKQCNLVIKFDRPLDMRSYVQSKGRARRAGSRYVITVEEKDTAACDSDLKDF----QQIEKILLSRHRTVNNPI-EDDSDRFEEFDVDSQMEPYVVEKTGATLKMSTAIALINRYCSKL-------PSDIFTRLVPHNQIIPIEENGVTKYCAELLLPINSPIKHAIVLKNPMPNKKTAQMAVALEACRQLHLEGELDDNLLPKGR 662          

HSP 2 Score: 157.532 bits (397), Expect = 1.565e-46
Identity = 116/366 (31.69%), Postives = 179/366 (48.91%), Query Frame = 2
Query: 3014 NIFPCFM-----AKTCNDRTNLEQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPP------NFVVKNSDESVEVNNSREFILIK-------------------NKNLADCCEAI-------IG---------SILTNYGI-DYSI---------------------QYLQWLNLPLVPDNELNADIEISPKLAFQNISMDTDIPQSIN------------DLEKILNYHFKNKGYIVQAITHPSSIANRKFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYLNYFDSKMFHILPKVVE 3871
             + PC +          D  +LE+FE +GDSFLKF T+ YL+H   D  +EGKL+  RS+ +SN NL+ L  + G+ +      F+   ++LPP      +F   N+D++ E +N  E IL                     +K+  D  E I       +G         ++LT   I D SI                     + + W+ L ++  ++  +D+  SP L F  I   T+   S+N             LE+ + Y FK + Y+VQA TH S I NR   CYQRLEFLGD+V+D+++T Y+  ++++ +PG +T+LRSALVNN  FA L+VKF F K+       ++H++ K V+
Sbjct: 1391 GVSPCLLLTALTTSNAADGMSLERFETIGDSFLKFATTDYLYHTLLD-QHEGKLSFARSKEVSNCNLYRLGKKLGIPQLIVANKFDAHDSWLPPCYIPTCDFKAPNTDDAEEKDNEIERILDGQVIEEKPENKTGWDIGGDVSKSTTDGIETITFPKQARVGNDDISPLPYNLLTQQHISDKSIADAVEALIGVHLLTLGPNPTLKVMNWMGLKVIQKDQ-KSDVP-SPLLRF--IDTPTNPNASLNFLNNLWQQFQFTQLEEKIGYRFKERAYLVQAFTHASYINNRVTGCYQRLEFLGDAVLDYMITRYLFEDSRQYSPGVLTDLRSALVNNTIFASLAVKFEFQKHFIAMCPGLYHMIEKFVK 1751          

HSP 3 Score: 50.447 bits (119), Expect = 1.565e-46
Identity = 35/104 (33.65%), Postives = 50/104 (48.08%), Query Frame = 3
Query: 3933 VVKVLGDIFESIAGAIFVDSNYDLKAVWTVYKVFMEEPLKKFFNNIPRNKISMLHEKYPQMKCTFENQEF---SNLIKLTAILPNGSVIEKYERNKILCKLSLA 4235
            V K +GDIFES+AGAI++DS  +L   W V    M   ++    N PR+ I  L E + Q K  F   E    S  +++T  + N        RN  + K + A
Sbjct: 1785 VPKAMGDIFESVAGAIYLDSGRNLDTTWQVIFHMMRGTIELCCANPPRSPIRELME-FEQSKVRFSKMERILESGKVRVTVEVVNNMRFTGMGRNYRIAKATAA 1887          
BLAST of Endoribonuclease Dicer vs. Ensembl Celegans
Match: drsh-1 (Ribonuclease 3 [Source:UniProtKB/Swiss-Prot;Acc:O01326])

HSP 1 Score: 62.003 bits (149), Expect = 3.536e-9
Identity = 65/266 (24.44%), Postives = 122/266 (45.86%), Query Frame = 2
Query: 3065 EQFEILGDSFLKFITSKYLF-----HFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVVKNSDESVEVNNSREFILIKNKNLADCCEAIIGSILTNYGI---DYSIQYLQWLNLPLVPD--NELNA-DIEISPKLAFQNISMDTDIPQSINDLEKILNYHFKNKGYIVQAITHPSSIANRKFSCY--QRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYL 3823
            E+ E LGD+ ++ I S +L+     HF      EG L   R+ L+ N+NL  LA    +D+   Y++                     ++ N  EF       LA+  EA++ +I  + G+   D       + + P++ +  + +N  +++       +++S  T    + + LE+ L   F N   + +A T   +I N   +    QRLE+LGDSV+  +V+ ++       + G ++ LR++LV+N T A +    GF +++
Sbjct:  691 ERLEYLGDAVVELIVSHHLYFMLTHHF------EGGLATYRTALVQNRNLATLAKNCRIDEMLQYSH-------------------GADLINVAEF----KHALANAFEAVMAAIYLDGGLAPCDVIFSKAMYGHQPVLKEKWDHINEHELKREDPQGDRDLSFITPTLSTFHALEERLGIQFNNIRLLAKAFTR-RNIPNNDLTKGHNQRLEWLGDSVLQLIVSDFLYRRFPYHHEGHMSLLRTSLVSNQTQAVVCDDLGFTEFV 926          
BLAST of Endoribonuclease Dicer vs. Ensembl Celegans
Match: drsh-1 (Ribonuclease 3 [Source:UniProtKB/Swiss-Prot;Acc:O01326])

HSP 1 Score: 62.003 bits (149), Expect = 3.653e-9
Identity = 65/266 (24.44%), Postives = 122/266 (45.86%), Query Frame = 2
Query: 3065 EQFEILGDSFLKFITSKYLF-----HFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVVKNSDESVEVNNSREFILIKNKNLADCCEAIIGSILTNYGI---DYSIQYLQWLNLPLVPD--NELNA-DIEISPKLAFQNISMDTDIPQSINDLEKILNYHFKNKGYIVQAITHPSSIANRKFSCY--QRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYL 3823
            E+ E LGD+ ++ I S +L+     HF      EG L   R+ L+ N+NL  LA    +D+   Y++                     ++ N  EF       LA+  EA++ +I  + G+   D       + + P++ +  + +N  +++       +++S  T    + + LE+ L   F N   + +A T   +I N   +    QRLE+LGDSV+  +V+ ++       + G ++ LR++LV+N T A +    GF +++
Sbjct:  689 ERLEYLGDAVVELIVSHHLYFMLTHHF------EGGLATYRTALVQNRNLATLAKNCRIDEMLQYSH-------------------GADLINVAEF----KHALANAFEAVMAAIYLDGGLAPCDVIFSKAMYGHQPVLKEKWDHINEHELKREDPQGDRDLSFITPTLSTFHALEERLGIQFNNIRLLAKAFTR-RNIPNNDLTKGHNQRLEWLGDSVLQLIVSDFLYRRFPYHHEGHMSLLRTSLVSNQTQAVVCDDLGFTEFV 924          
BLAST of Endoribonuclease Dicer vs. Ensembl Celegans
Match: drh-1 (Dicer Related Helicase [Source:UniProtKB/TrEMBL;Acc:V6CIX1])

HSP 1 Score: 53.1434 bits (126), Expect = 1.678e-6
Identity = 52/195 (26.67%), Postives = 92/195 (47.18%), Query Frame = 2
Query:   47 RDYQIEIYNKA-KNENVIIKLNTGSGKTFIASMLIKDYLNVKSDK----KIFFLVKNSSLVHQHTNSLKDYLFLKDEIGYFYGQMENSWVDNWTXXXXXXXXXXXXXXVMTAKVFLDILNHNK-----------YNLSQVCYLIFDEVHHLTKSDDYSQISE--HVIRTTSDI-------KILGLTACLIKGVKH 556
            R+YQ E+   A + +N I+   TGSGKT IA+ +IK++   +S +    K  F+  NS +++Q   S+  YL   D +  ++ Q+    +           I    +IV T ++ +++ N ++           + LS    + FDE H+  K+  YS I    H ++   ++       +I+GLTA L  G K+
Sbjct:   36 RNYQEELCQVALQGKNTIVTAPTGSGKTVIAANIIKEHFESRSSEGKRFKALFMTPNSMILNQQAASISSYL---DHV--YHTQI----IQGSDNVPTRNVIQSKDLIVATPQMIVNLCNEHRNSLDDESRLDQFFLSTFTIIFFDECHNTVKNSPYSNIMREYHYLKNMGNMPEGHSLPQIIGLTASLGTGDKN 221          
BLAST of Endoribonuclease Dicer vs. Ensembl Fly
Match: Dcr-1 (gene:FBgn0039016 transcript:FBtr0084324)

HSP 1 Score: 125.561 bits (314), Expect = 4.164e-41
Identity = 68/203 (33.50%), Postives = 113/203 (55.67%), Query Frame = 2
Query: 3344 IKNKNLADCCEAIIGSILTNYGIDYSIQYLQWLNLPLVP----------------DNELNAD----------IEISPKLAFQ-NISMDTD-IPQSINDLEKILNYHFKNKGYIVQAITHPSSIANRKFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYLNYFDSKMFHILPKVV 3868
            I +K++ADC EA+IG+ L   G   ++ ++ WL + ++P                  + NA+             SP L F  N + + D +     + E+ L Y F+++ Y++QA+TH S   NR   CYQRLEFLGD+V+D+L+T ++  + ++ +PG +T+LRSALVNN  FA L+V+ GFHK+  +    +  ++ + V
Sbjct: 1898 IPDKSIADCVEALIGAYLIECGPRGALLFMAWLGVRVLPITRQLDGGNQEQRIPGSTKPNAENVVTVYGAWPTPRSPLLHFAPNATEELDQLLSGFEEFEESLGYKFRDRSYLLQAMTHASYTPNRLTDCYQRLEFLGDAVLDYLITRHLYEDPRQHSPGALTDLRSALVNNTIFASLAVRHGFHKFFRHLSPGLNDVIDRFV 2100          

HSP 2 Score: 64.6994 bits (156), Expect = 4.164e-41
Identity = 30/60 (50.00%), Postives = 40/60 (66.67%), Query Frame = 3
Query: 3933 VVKVLGDIFESIAGAIFVDSNYDLKAVWTVYKVFMEEPLKKFFNNIPRNKISMLHEKYPQ 4112
            V K LGD+FESIAGAIF+DSN  L  VW VY   M   +++F N++P++ I  L E  P+
Sbjct: 2130 VPKALGDVFESIAGAIFLDSNMSLDVVWHVYSNMMSPEIEQFSNSVPKSPIRELLELEPE 2189          

HSP 3 Score: 71.633 bits (174), Expect = 6.245e-12
Identity = 36/92 (39.13%), Postives = 53/92 (57.61%), Query Frame = 2
Query: 3017 IFPCFMAKTCNDRTNLEQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVV 3292
            I         ND  NLE+ E +GDSFLK+  + YL+  + +  +EGKL+  RS+ ++N NL+ L  +K L +Y   T F P  N+LPP + V
Sbjct: 1726 ILQALTMSNANDGINLERLETIGDSFLKYAITTYLY-ITYENVHEGKLSHLRSKQVANLNLYRLGRRKRLGEYMIATKFEPHDNWLPPCYYV 1816          

HSP 4 Score: 71.2478 bits (173), Expect = 8.972e-12
Identity = 45/134 (33.58%), Postives = 78/134 (58.21%), Query Frame = 2
Query: 1103 DFKNTISILIFINEKIHVLALNVLLGILPKINKAFDFINSNFI---IGHSTSQYPKKLQMSVTKQXXXXXXXXXXXXXXXXATNVIEEGLDVSHCNIVVKFDPPQDFRSYLQSKGRARAQNSQYIVFTHETQKT 1495
            D  +T+  LI+ N+      L  LL  + + +    F+   +    +   T++ PK+ ++   +Q E+LK F+    N+LI T+V+EEG+DV  CN+VV++DPP  +RSY+Q KGRARA  + +++    + K+
Sbjct:  488 DGSDTLCALIYCNQNHTARVLFELLAEISRRDPDLKFLRCQYTTDRVADPTTE-PKEAELEHRRQEEVLKRFRMHDCNVLIGTSVLEEGIDVPKCNLVVRWDPPTTYRSYVQCKGRARAAPAYHVILVAPSYKS 620          

HSP 5 Score: 58.5362 bits (140), Expect = 6.545e-8
Identity = 99/474 (20.89%), Postives = 186/474 (39.24%), Query Frame = 2
Query: 1625 YDYVPYGENGPRITLNSASSVLNRYLGKLRCNSISEPKIIYTYFQDE---FNFHHVSLLLPMPAPYLEEIKGLPCSNKRRAKQFVNLEACKILHKYDELDSSLLPYNR----------------FDNNLVIQESNDIE--IIKYEKYTATKLSTKFQNL-SIPANKLYLYSIKYT-----PSVFLKLGINDISMFDVSTYLGILLPNPIHQNKDFMKFPIYLVGGMTSVEIKFEYNLPVNSINYSLLLKCHKILFNIYSERIRRFDKNI-FFDPSKAKSSI-ILTILK----DNKIDFNKIKEIITN--------PIVDNLIKN-DQSSWVGSVIRPNYI-TNEFGAFVISKVCHDMNADSIFKND--MTYEKFLNKKYNIILSPNEKLSPLIKVIRLTT-----IQSCVNKERRFL----RNNRKLQRIN-ESECYFVPSLTECISLSSSLWTQLCIFPTIHHRMNQILSIED 2881
            Y   P+   G  + L SA +++N+Y  +L  ++ ++   ++   ++E         +L LP+ +P   +I GLP   +  A++   L+AC  LH+  ELD  L P  +                 ++  ++Q S++      K  +Y   +++++F +   +     YLY I+ T     P      G       D     GIL    I +      F I+   G   V ++         I  S  + C     N     + R  K +  FDP   ++ + I+  +K       ID+  ++ I  N        P  +   +  D   +  +V+ P Y   ++   F ++++C  ++  S F  D   T++ +   KY + +    +  PL+ V   +          VN++   L       ++ +R N E +   VP L       +SLW      P I +R+N +L  +D
Sbjct:  808 YRPKPHLLTGASVDLGSAIALVNKYCARLPSDTFTKLTALWRCTRNERAGVTLFQYTLRLPINSPLKHDIVGLPMPTQTLARRLAALQACVELHRIGELDDQLQPIGKEGFRALEPDWECFELEPEDEQIVQLSDEPRPGTTKRRQYYYKRIASEFCDCRPVAGAPCYLYFIQLTLQCPIPEEQNTRGRKIYPPEDAQQGFGILTTKRIPK---LSAFSIFTRSGEVKVSLELAKE---RVILTSEQIVCINGFLNYTFTNVLRLQKFLMLFDPDSTENCVFIVPTVKAPAGGKHIDWQFLELIQANGNTMPRAVPDEERQAQPFDPQRFQDAVVMPWYRNQDQPQYFYVAEICPHLSPLSCFPGDNYRTFKHYYLVKYGLTIQNTSQ--PLLDVDHTSARLNFLTPRYVNRKGVALPTSSEETKRAKRENLEQKQILVPELCTVHPFPASLWRTAVCLPCILYRINGLLLADD 1273          
BLAST of Endoribonuclease Dicer vs. Ensembl Fly
Match: Dcr-2 (gene:FBgn0034246 transcript:FBtr0340217)

HSP 1 Score: 134.42 bits (337), Expect = 3.994e-31
Identity = 165/689 (23.95%), Postives = 304/689 (44.12%), Query Frame = 2
Query:   38 MKTRDYQIEIYNKAKNENVIIKLNTGSGKTFIASMLIKDYLN------VKSDKKIFFLVKNSSLVHQHTNSLKDYLFLKDEIGYFYGQMENSWVDNWTXXXXXXXXXXXXXXVMTAKVFLDILNHNKYNLSQVCYLIFDEVHHLTKSDDYSQISE--HVIRTTSDIKILGLTACLIKGVKHVKDIEFAVKQLEHKLNCKVITSMDNIARE----FCGNIKETIINY-ETESFPDLVAIFKSAIEKIESFIPVD----GHHSNDNSGSLNAEQNNFKT--LKKYLSESFSVLSTLGLVPCK-----LITDMFIEDLHGA------VNNDSMFFDEKTKLYLDEFLSCLKFI----NSNIESYISKSDMLMCSEKCKKLINLILDLKSKNEDFKNTISILIFINEKIHVLAL-NVLLGILPKINKAFDFINSNFIIGHST------SQYPKKLQMSVTKQXXXXXXXXXXXXXXXXATNVIEEGLDVSHCNIVVKFDPPQDFRSYLQSKGRARAQNSQYIVFT--HETQKTEAQIQKFNLINEELNKILKSRVIEDELNKDDSE-RNVTPSEDDKYDYVPY-GENGPRITLNSASSVLNRYLGKLRCNSISEPKIIYTYF----QDEFNF---------HHVSLLLPMPAPYLEEIKGLPCSNKRRAKQFVNLEACKILHKYDELDSSLLP 1930
            +K R YQ+ + +     N I+ L TGSGKTF+A +++K +            K+  F+     L  Q   +++     K  +G++ G+     VD+WT+  WS +I K +++V TA+VFLD++      LS +  +I DE HH T    + +      +   T   +++GLT  LIKG   + ++   +K+LE      +IT  D    E    +     E ++++   E    +  +  + IEK   ++ +D    G      S SL   ++  K   +K+  ++    +   G+         LI +  I+           ++  ++   EK +  L + L  + +     N N E  I    M   + K ++ + + L +   ++D K+ I  L+F+  +     +  +LL  +    +  + +   F++G +       S   +K Q S  +Q                 ++V+EEG+DV  CN V   DP + F  Y+QSKGRAR   +++++FT   E +KT  QI ++   + ++ + LK RV+E    K + E   +     D  D  P+  ENG  +  N+A ++L+RY   +  ++      +  +F    +DE +          H +S+ +P+     + I   P  N + AK     +ACK+L+   EL+   +P
Sbjct:    6 IKPRGYQLRLVDHLTKSNGIVYLPTGSGKTFVAILVLKRFSQDFDKPIESGGKRALFMCNTVELARQQAMAVRRCTNFK--VGFYVGE---QGVDDWTRGMWSDEIKKNQVLVGTAQVFLDMVTQTYVALSSLSVVIIDECHHGTGHHPFREFMRLFTIANQTKLPRVVGLTGVLIKG-NEITNVATKLKELEITYRGNIITVSDTKEMENVMLYATKPTEVMVSFPHQEQVLTVTRLISAEIEKF--YVSLDLMNIGVQPIRRSKSLQCLRDPSKKSFVKQLFNDFLYQMKEYGIYAASIAIISLIVEFDIKRRQAETLSVKLMHRTALTLCEKIRHLLVQKLQDMTYDDDDDNVNTEEVI----MNFSTPKVQRFL-MSLKVSFADKDPKD-ICCLVFVERRYTCKCIYGLLLNYIQSTPELRNVLTPQFMVGRNNISPDFESVLERKWQKSAIQQFRDGNANLMI------CSSVLEEGIDVQACNHVFILDPVKTFNMYVQSKGRARTTEAKFVLFTADKEREKTIQQIYQYRKAHNDIAEYLKDRVLE----KTEPELYEIKGHFQDDID--PFTNENGAVLLPNNALAILHRYCQTIPTDAFG---FVIPWFHVLQEDERDRIFGVSAKGKHVISINMPVNCMLRDTIYSDPMDNVKTAKISAAFKACKVLYSLGELNERFVP 665          

HSP 2 Score: 129.413 bits (324), Expect = 1.533e-29
Identity = 76/197 (38.58%), Postives = 117/197 (59.39%), Query Frame = 2
Query: 3296 NSDESVEVNNSREFILIKNKNLADCCEAIIGSILTNYGIDYSIQYLQWLNLPLV----PDNELNADIEISPKLAFQNISMDTDIPQSIND--LEKILNYHFKNKGYIVQAITHPSSIANRKFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYLNYFDSKMFHILPKVV 3868
             +D S EVN     + I NK +AD  EA++G I+ NYG+ ++ + L++  +       P  +L  ++E+  K    N++        IN   LEK L Y FK++ Y++QA+THPS   NR    YQ LEF+GD+++DFL++ YI  NN K+NPG +T+LRSALVNN T A + V+   H ++   ++K+  I+ K V
Sbjct: 1344 GADFSSEVNFCVGLVTIPNKVIADTLEALLGVIVKNYGLQHAFKMLEYFKICRADIDKPLTQL-LNLELGGKKMRANVNTTEIDGFLINHYYLEKNLGYTFKDRRYLLQALTHPSYPTNRITGSYQELEFIGDAILDFLISAYIFENNTKMNPGALTDLRSALVNNTTLACICVRHRLHFFILAENAKLSEIISKFV 1539          
BLAST of Endoribonuclease Dicer vs. Ensembl Fly
Match: Dcr-2 (gene:FBgn0034246 transcript:FBtr0086904)

HSP 1 Score: 134.42 bits (337), Expect = 4.385e-31
Identity = 165/689 (23.95%), Postives = 304/689 (44.12%), Query Frame = 2
Query:   38 MKTRDYQIEIYNKAKNENVIIKLNTGSGKTFIASMLIKDYLN------VKSDKKIFFLVKNSSLVHQHTNSLKDYLFLKDEIGYFYGQMENSWVDNWTXXXXXXXXXXXXXXVMTAKVFLDILNHNKYNLSQVCYLIFDEVHHLTKSDDYSQISE--HVIRTTSDIKILGLTACLIKGVKHVKDIEFAVKQLEHKLNCKVITSMDNIARE----FCGNIKETIINY-ETESFPDLVAIFKSAIEKIESFIPVD----GHHSNDNSGSLNAEQNNFKT--LKKYLSESFSVLSTLGLVPCK-----LITDMFIEDLHGA------VNNDSMFFDEKTKLYLDEFLSCLKFI----NSNIESYISKSDMLMCSEKCKKLINLILDLKSKNEDFKNTISILIFINEKIHVLAL-NVLLGILPKINKAFDFINSNFIIGHST------SQYPKKLQMSVTKQXXXXXXXXXXXXXXXXATNVIEEGLDVSHCNIVVKFDPPQDFRSYLQSKGRARAQNSQYIVFT--HETQKTEAQIQKFNLINEELNKILKSRVIEDELNKDDSE-RNVTPSEDDKYDYVPY-GENGPRITLNSASSVLNRYLGKLRCNSISEPKIIYTYF----QDEFNF---------HHVSLLLPMPAPYLEEIKGLPCSNKRRAKQFVNLEACKILHKYDELDSSLLP 1930
            +K R YQ+ + +     N I+ L TGSGKTF+A +++K +            K+  F+     L  Q   +++     K  +G++ G+     VD+WT+  WS +I K +++V TA+VFLD++      LS +  +I DE HH T    + +      +   T   +++GLT  LIKG   + ++   +K+LE      +IT  D    E    +     E ++++   E    +  +  + IEK   ++ +D    G      S SL   ++  K   +K+  ++    +   G+         LI +  I+           ++  ++   EK +  L + L  + +     N N E  I    M   + K ++ + + L +   ++D K+ I  L+F+  +     +  +LL  +    +  + +   F++G +       S   +K Q S  +Q                 ++V+EEG+DV  CN V   DP + F  Y+QSKGRAR   +++++FT   E +KT  QI ++   + ++ + LK RV+E    K + E   +     D  D  P+  ENG  +  N+A ++L+RY   +  ++      +  +F    +DE +          H +S+ +P+     + I   P  N + AK     +ACK+L+   EL+   +P
Sbjct:    6 IKPRGYQLRLVDHLTKSNGIVYLPTGSGKTFVAILVLKRFSQDFDKPIESGGKRALFMCNTVELARQQAMAVRRCTNFK--VGFYVGE---QGVDDWTRGMWSDEIKKNQVLVGTAQVFLDMVTQTYVALSSLSVVIIDECHHGTGHHPFREFMRLFTIANQTKLPRVVGLTGVLIKG-NEITNVATKLKELEITYRGNIITVSDTKEMENVMLYATKPTEVMVSFPHQEQVLTVTRLISAEIEKF--YVSLDLMNIGVQPIRRSKSLQCLRDPSKKSFVKQLFNDFLYQMKEYGIYAASIAIISLIVEFDIKRRQAETLSVKLMHRTALTLCEKIRHLLVQKLQDMTYDDDDDNVNTEEVI----MNFSTPKVQRFL-MSLKVSFADKDPKD-ICCLVFVERRYTCKCIYGLLLNYIQSTPELRNVLTPQFMVGRNNISPDFESVLERKWQKSAIQQFRDGNANLMI------CSSVLEEGIDVQACNHVFILDPVKTFNMYVQSKGRARTTEAKFVLFTADKEREKTIQQIYQYRKAHNDIAEYLKDRVLE----KTEPELYEIKGHFQDDID--PFTNENGAVLLPNNALAILHRYCQTIPTDAFG---FVIPWFHVLQEDERDRIFGVSAKGKHVISINMPVNCMLRDTIYSDPMDNVKTAKISAAFKACKVLYSLGELNERFVP 665          

HSP 2 Score: 129.413 bits (324), Expect = 1.521e-29
Identity = 76/197 (38.58%), Postives = 117/197 (59.39%), Query Frame = 2
Query: 3296 NSDESVEVNNSREFILIKNKNLADCCEAIIGSILTNYGIDYSIQYLQWLNLPLV----PDNELNADIEISPKLAFQNISMDTDIPQSIND--LEKILNYHFKNKGYIVQAITHPSSIANRKFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYLNYFDSKMFHILPKVV 3868
             +D S EVN     + I NK +AD  EA++G I+ NYG+ ++ + L++  +       P  +L  ++E+  K    N++        IN   LEK L Y FK++ Y++QA+THPS   NR    YQ LEF+GD+++DFL++ YI  NN K+NPG +T+LRSALVNN T A + V+   H ++   ++K+  I+ K V
Sbjct: 1345 GADFSSEVNFCVGLVTIPNKVIADTLEALLGVIVKNYGLQHAFKMLEYFKICRADIDKPLTQL-LNLELGGKKMRANVNTTEIDGFLINHYYLEKNLGYTFKDRRYLLQALTHPSYPTNRITGSYQELEFIGDAILDFLISAYIFENNTKMNPGALTDLRSALVNNTTLACICVRHRLHFFILAENAKLSEIISKFV 1540          
BLAST of Endoribonuclease Dicer vs. Ensembl Fly
Match: drosha (gene:FBgn0026722 transcript:FBtr0088850)

HSP 1 Score: 69.3218 bits (168), Expect = 3.078e-11
Identity = 71/284 (25.00%), Postives = 128/284 (45.07%), Query Frame = 2
Query: 3038 KTCNDRTNLEQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVVKNSD--ESVEVNNSREFILIKNKNLADCCEAIIGSILTNYGIDYSIQYLQ-------------WLNLPLVPDNELNADIEISPKLAFQNISMDTDIPQSINDLEKILNYHFKNKGYIVQAITHPS-SIANRKFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYLNYFDSK 3841
            +T ++ T+ E+ E LGD+ ++F++S +LF F      EG L   R+ ++ N++L  LA +  L+++  Y +                SD    +E+ ++          +A+C EA++G++L + GI  + +                W NLP  P  E          L  ++      + + +   E  +   FK+   + +A T  S    +      QRLEFLGD+V+  + + Y+  +  + + G ++ LRS+LVNN T A +    G  KY  Y + K
Sbjct:  824 ETVSNITHNERLEFLGDAVVEFLSSIHLF-FMFPELEEGGLATYRAAIVQNQHLALLAKKLQLEEFMLYAH---------------GSDLCHELELRHA----------MANCFEALMGALLLDGGIKVADEVFTDALFRQDEKLLSIWKNLPEHPLQEQEP-------LGDRSCIDSYRVLKELTKFEDSIGIKFKHIRLLARAFTDRSIGFTHLTLGSNQRLEFLGDTVLQLICSEYLYRHFPEHHEGHLSLLRSSLVNNRTQAVVCDDLGMPKYAVYANPK 1074          
BLAST of Endoribonuclease Dicer vs. Ensembl Zebrafish
Match: dicer1 (dicer 1, ribonuclease type III [Source:NCBI gene;Acc:324724])

HSP 1 Score: 222.631 bits (566), Expect = 5.062e-58
Identity = 270/1067 (25.30%), Postives = 476/1067 (44.61%), Query Frame = 2
Query:   47 RDYQIEIYNKAKNENVIIKLNTGSGKTFIASMLIKDY---LNVKSDKKIFFLVKNSSLVHQHTNSLKDYLFLKDEIGYFYGQMENSWVDN-WTXXXXXXXXXXXXXXVMTAKVFLDILNHNKYNLSQVCYLIFDEVHHLTKSDDYSQISEHVIRTTSDIKILGLTACLIKGVKHVKDIEFAVKQLEHKLNCKVITSMDNIARE-FCGNIKETIINYETESFPDLVAIFKSAIEKIESFIPVDGHHSNDNSGSLNAEQNNFKTL-KKYLSESFSVLSTLGLVPCKLITDMFIEDLHGAVNNDSMFFDEKTKLYLDEFLSCLKFINSNIESYISKS--DMLMCSEKCKKLINLILDLKS--------------KNED------------------------------FKNTISILIFINEKIHVLALNVLLGILPKINKAFDFINSNFIIGHSTSQ-YPKKLQMSV--TKQXXXXXXXXXXXXXXXXATNVIEEGLDVSHCNIVVKFDPPQDFRSYLQSKGRARAQNSQYIVF--THETQKTEAQIQKFNLINEEL-NKILKSRVIED-ELNKDDSERNVTPSEDDKYDYVPYGEN-GPRITLNSASSVLNRYLGKLRCNSISEPKIIYTYFQDEFNFHHVSLLLPMPAPYLEEIKGLPCSNKRRAKQFVNLEACKILHKYDELDSSLLPYNRFDNNLVIQESNDIEIIKYE-----------KYTATKLSTKFQNLS-------------IPANKLYLYSIKYTPSVFL--KLGINDISMF---DVSTYLGILLPNPIHQNKDFMKFPIYLVGGMTSVEIKFE-YNLPVNSINYSLLLKCHKILFNIYSERIRRFDKNIF-FDPSKAKSS---IILTILKD-NKIDFN-KIKEIITNPIVDNLIKNDQ-----------SSWVGSVIRPNYIT-NEFGAFVISKVCHDMNADSIFKND--MTYEKFLNKKYNIILSPNEKLSPLIKV------IRLTTIQSCVNKERRFLRNNRKLQRINESECY-----FVPSLTECISLSSSLWTQLCIFPTIHHRMNQILSIEDF 2884
            R YQ+E+   A   N I+ LNTGSGKTFIA +LIK+    +  ++ K+  FLV  +S V Q  ++++ +  L  ++G +  +   SW +  W ++    ++      VMT  +FL +L +    LS++  L+FDE H       Y +I +      S  +ILGLTA ++ G     D+E  ++ LE  L     T+ D +  + +    +E +++     + D   + +  + +++  +    +  ND + S++ E  +   + K+ L++  +VL+ LG         + + +L   + ++    + K  L+ D   + L+ I++  E + S +  D+   + K  +L+ ++ + K               +N+D                              F N +  +IF+  +   + LN L+    K +    +I+SNFI GHS  +  P+  QM V   KQ E+L+ F+  + N+LIAT+++EEG+D+  CN+VV+FD P ++RSY+QSKGRARA  S YI+   +  T+  +  ++ +  I + L NK  KS    D EL     + NV P       YV   E+ GPR+T+N+A   +NRY  +L  +  +         +     +  +L LP+ +P    + G   +  R A++ V L  C+ LHK  ELD  L+P  +             E +KYE                  STK +  S             +P    YLY I    +  L  +L      ++   D +   GIL   PI +      FP+Y   G  ++ I+ +     +++    L+ + H+ +F+     I R +K    F P +A S+   + L I++D N +D + K  E I        I N Q             +  +VI P Y   ++   F ++ V  D+   S F +    T+ ++   KYN+ LS   +  PL+ V      + L T +  +N++ + L  +   +R  + E        VP L     + +SLW +    P+I +R++ +L+ E+ 
Sbjct:   35 RKYQVELLEAALEHNTIVCLNTGSGKTFIAVLLIKELSHQIRGENGKRTVFLVNAASSVAQQASTVRTHSDL--QVGDYMSEDMTSWPEEMWNREMIENQVL-----VMTCHIFLHVLKNGVLPLSKINLLVFDECHLAITGHPYREIMKICEGCPSCPRILGLTASILNGKCDPCDLEEKIQNLEKILQSNAETATDLVVLDRYASQPREEVLD--CGQYQDQSGLSERLLNELDEAL----NFLNDCNLSVHREDRDPTFISKQVLNDCRAVLTVLGPWCADKAAGIMVRELQKYIKHEQEELNRKFLLFTD---TILRKIHALCEEHFSPASLDLKFVTPKVIRLLEILHEYKPFERQQFESVEWYNNRNQDNYVSWSDSEDDDEDEEAEAKEKTEANFPSPFTNILCGIIFVERRYTAVVLNRLIKEAGKQDPELAYISSNFITGHSIGKNQPRNKQMEVEFRKQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLVVRFDLPTEYRSYVQSKGRARAPVSNYIMLADSERTKTFQEDLKTYKAIEKILRNKCSKSAECNDFELEPVTDDDNVLPP------YVLRSEDGGPRVTMNTAIGHVNRYCARLPSDPFTHLAPKCKTVEMNTGGYRSTLFLPINSPLRVPVTGPVMNCARLAEKAVALLCCEKLHKIGELDDHLMPVGK-------------ETVKYEEELDLHDEEETSVPGRPGSTKRRQCSPKAIPECLRGCYPVPEQPCYLYVIGMVLTTPLPDELNFRRRKLYPPEDTTRCFGILTAKPIPR---IPHFPVYTRSGEVTISIELQKSGFSLSAEQLELITRLHQYIFS----HILRLEKPALEFKPVEADSAYCVLPLNIVEDSNTLDLDFKFMEDIEKSEARIGIPNTQYTKQNPFIFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLSNVNQ--PLLDVDHTSSRLNLLTPRH-LNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLHCLLTAEEL 1056          

HSP 2 Score: 131.724 bits (330), Expect = 1.130e-41
Identity = 71/197 (36.04%), Postives = 120/197 (60.91%), Query Frame = 2
Query: 3344 IKNKNLADCCEAIIGSILTNYGIDYSIQYLQWLNLPLVPDNELNAD---------IEISPKLAFQNISMDTDIPQSIN---DLEKILNYHFKNKGYIVQAITHPSSIANRKFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYLNYFDSKMFHILPKVVE-ELLNNQLQ 3895
            I +K++ADC EA++G  LT+ G   +  +L  L L ++P  + ++          ++I P+  F++   +  +   I+   + E  +NY FKNK Y++QA TH S   N    CYQRLEFLGD+++D+L+T ++  + ++ +PG +T+LRSALVNN  FA L+VK+ +HKY      ++FH++   V+ +L  N++Q
Sbjct: 1530 IADKSIADCVEALLGCYLTSCGERAAQLFLCSLGLKVLPPEKQSSGGSAELQYGWLKIPPRCMFEHPDAERTLNHLISGFLNFESKINYTFKNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVQFQLEKNEMQ 1726          

HSP 3 Score: 60.4622 bits (145), Expect = 1.130e-41
Identity = 28/60 (46.67%), Postives = 39/60 (65.00%), Query Frame = 3
Query: 3933 VVKVLGDIFESIAGAIFVDSNYDLKAVWTVYKVFMEEPLKKFFNNIPRNKISMLHEKYPQ 4112
            V K +GDIFES+AGAI++DS   L+ VW VY   M   ++KF  N+PR+ +  L E  P+
Sbjct: 1747 VPKAMGDIFESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRSPVRELLEMEPE 1806          

HSP 4 Score: 76.2554 bits (186), Expect = 3.072e-13
Identity = 44/107 (41.12%), Postives = 63/107 (58.88%), Query Frame = 2
Query: 3047 NDRTNLEQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVVKNSDESVEVNNSREFILIKNKNLAD 3367
            +D  NLE+ E+LGDSFLK   + YLF    D  +EG+L+  RS+ +SN NL+ L  +KGL      + F+P  N+LPP +VV     S +  +S E     NK+LA+
Sbjct: 1289 SDGFNLERLEMLGDSFLKHAITTYLFCTYPDA-HEGRLSYMRSKKVSNCNLYRLGKKKGLPSRMVVSIFDPPVNWLPPGYVVNQDKSSTDKWDSDE-----NKDLAN 1389          
BLAST of Endoribonuclease Dicer vs. Ensembl Zebrafish
Match: dicer1 (dicer 1, ribonuclease type III [Source:NCBI gene;Acc:324724])

HSP 1 Score: 221.476 bits (563), Expect = 1.376e-57
Identity = 269/1067 (25.21%), Postives = 475/1067 (44.52%), Query Frame = 2
Query:   47 RDYQIEIYNKAKNENVIIKLNTGSGKTFIASMLIKDY---LNVKSDKKIFFLVKNSSLVHQHTNSLKDYLFLKDEIGYFYGQMENSWVDN-WTXXXXXXXXXXXXXXVMTAKVFLDILNHNKYNLSQVCYLIFDEVHHLTKSDDYSQISEHVIRTTSDIKILGLTACLIKGVKHVKDIEFAVKQLEHKLNCKVITSMDNIARE-FCGNIKETIINYETESFPDLVAIFKSAIEKIESFIPVDGHHSNDNSGSLNAEQNNFKTL-KKYLSESFSVLSTLGLVPCKLITDMFIEDLHGAVNNDSMFFDEKTKLYLDEFLSCLKFINSNIESYISKS--DMLMCSEKCKKLINLILDLKS--------------KNED------------------------------FKNTISILIFINEKIHVLALNVLLGILPKINKAFDFINSNFIIGHSTSQ-YPKKLQMSV--TKQXXXXXXXXXXXXXXXXATNVIEEGLDVSHCNIVVKFDPPQDFRSYLQSKGRARAQNSQYIVF--THETQKTEAQIQKFNLINEEL-NKILKSRVIED-ELNKDDSERNVTPSEDDKYDYVPYGEN-GPRITLNSASSVLNRYLGKLRCNSISEPKIIYTYFQDEFNFHHVSLLLPMPAPYLEEIKGLPCSNKRRAKQFVNLEACKILHKYDELDSSLLPYNRFDNNLVIQESNDIEIIKYE-----------KYTATKLSTKFQNL-------------SIPANKLYLYSIKYTPSVFL--KLGINDISMF---DVSTYLGILLPNPIHQNKDFMKFPIYLVGGMTSVEIKFE-YNLPVNSINYSLLLKCHKILFNIYSERIRRFDKNIF-FDPSKAKSS---IILTILKD-NKIDFN-KIKEIITNPIVDNLIKNDQ-----------SSWVGSVIRPNYIT-NEFGAFVISKVCHDMNADSIFKND--MTYEKFLNKKYNIILSPNEKLSPLIKV------IRLTTIQSCVNKERRFLRNNRKLQRINESECY-----FVPSLTECISLSSSLWTQLCIFPTIHHRMNQILSIEDF 2884
            R YQ+E+   A   N I+ LNTGSGKTFIA +LIK+    +  ++ K+  FLV  +S V Q  ++++ +  L  ++G +  +   SW +  W ++    ++      VMT  +FL +L +    LS++  L+FDE H       Y +I +      S  +ILGLTA ++ G     D+E  ++ LE  L     T+ D +  + +    +E +++     + D   + +  + +++  +    +  ND + S++ E  +   + K+ L++  +VL+ LG         + + +L   + ++    + K  L+ D   + L+ I++  E + S +  D+   + K  +L+ ++ + K               +N+D                              F N +  +IF+  +   + LN L+    K +    +I+SNFI GHS  +  P+  QM V   KQ E+L+ F+  + N+LIAT+++EEG+D+  CN+VV+FD P ++RSY+QSKGRARA  S YI+   +  T+  +  ++ +  I + L NK  KS    D EL     + NV P       YV   E+ GPR+T+N+A   +NRY  +L  +  +         +     +  +L LP+ +P    + G   +  R A++ V L  C+ LHK  ELD  L+P  +             E +KYE                  STK +                +P    YLY I    +  L  +L      ++   D +   GIL   PI +      FP+Y   G  ++ I+ +     +++    L+ + H+ +F+     I R +K    F P +A S+   + L I++D N +D + K  E I        I N Q             +  +VI P Y   ++   F ++ V  D+   S F +    T+ ++   KYN+ LS   +  PL+ V      + L T +  +N++ + L  +   +R  + E        VP L     + +SLW +    P+I +R++ +L+ E+ 
Sbjct:   35 RKYQVELLEAALEHNTIVCLNTGSGKTFIAVLLIKELSHQIRGENGKRTVFLVNAASSVAQQASTVRTHSDL--QVGDYMSEDMTSWPEEMWNREMIENQVL-----VMTCHIFLHVLKNGVLPLSKINLLVFDECHLAITGHPYREIMKICEGCPSCPRILGLTASILNGKCDPCDLEEKIQNLEKILQSNAETATDLVVLDRYASQPREEVLD--CGQYQDQSGLSERLLNELDEAL----NFLNDCNLSVHREDRDPTFISKQVLNDCRAVLTVLGPWCADKAAGIMVRELQKYIKHEQEELNRKFLLFTD---TILRKIHALCEEHFSPASLDLKFVTPKVIRLLEILHEYKPFERQQFESVEWYNNRNQDNYVSWSDSEDDDEDEEAEAKEKTEANFPSPFTNILCGIIFVERRYTAVVLNRLIKEAGKQDPELAYISSNFITGHSIGKNQPRNKQMEVEFRKQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLVVRFDLPTEYRSYVQSKGRARAPVSNYIMLADSERTKTFQEDLKTYKAIEKILRNKCSKSAECNDFELEPVTDDDNVLPP------YVLRSEDGGPRVTMNTAIGHVNRYCARLPSDPFTHLAPKCKTVEMNTGGYRSTLFLPINSPLRVPVTGPVMNCARLAEKAVALLCCEKLHKIGELDDHLMPVGK-------------ETVKYEEELDLHDEEETSVPGRPGSTKRRQCYPKAIPECLRGCYPVPEQPCYLYVIGMVLTTPLPDELNFRRRKLYPPEDTTRCFGILTAKPIPR---IPHFPVYTRSGEVTISIELQKSGFSLSAEQLELITRLHQYIFS----HILRLEKPALEFKPVEADSAYCVLPLNIVEDSNTLDLDFKFMEDIEKSEARIGIPNTQYTKQNPFIFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLSNVNQ--PLLDVDHTSSRLNLLTPRH-LNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLHCLLTAEEL 1056          

HSP 2 Score: 131.724 bits (330), Expect = 1.084e-41
Identity = 71/197 (36.04%), Postives = 120/197 (60.91%), Query Frame = 2
Query: 3344 IKNKNLADCCEAIIGSILTNYGIDYSIQYLQWLNLPLVPDNELNAD---------IEISPKLAFQNISMDTDIPQSIN---DLEKILNYHFKNKGYIVQAITHPSSIANRKFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYLNYFDSKMFHILPKVVE-ELLNNQLQ 3895
            I +K++ADC EA++G  LT+ G   +  +L  L L ++P  + ++          ++I P+  F++   +  +   I+   + E  +NY FKNK Y++QA TH S   N    CYQRLEFLGD+++D+L+T ++  + ++ +PG +T+LRSALVNN  FA L+VK+ +HKY      ++FH++   V+ +L  N++Q
Sbjct: 1530 IADKSIADCVEALLGCYLTSCGERAAQLFLCSLGLKVLPPEKQSSGGSAELQYGWLKIPPRCMFEHPDAERTLNHLISGFLNFESKINYTFKNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVQFQLEKNEMQ 1726          

HSP 3 Score: 60.4622 bits (145), Expect = 1.084e-41
Identity = 28/60 (46.67%), Postives = 39/60 (65.00%), Query Frame = 3
Query: 3933 VVKVLGDIFESIAGAIFVDSNYDLKAVWTVYKVFMEEPLKKFFNNIPRNKISMLHEKYPQ 4112
            V K +GDIFES+AGAI++DS   L+ VW VY   M   ++KF  N+PR+ +  L E  P+
Sbjct: 1747 VPKAMGDIFESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRSPVRELLEMEPE 1806          

HSP 4 Score: 76.2554 bits (186), Expect = 2.945e-13
Identity = 44/107 (41.12%), Postives = 63/107 (58.88%), Query Frame = 2
Query: 3047 NDRTNLEQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVVKNSDESVEVNNSREFILIKNKNLAD 3367
            +D  NLE+ E+LGDSFLK   + YLF    D  +EG+L+  RS+ +SN NL+ L  +KGL      + F+P  N+LPP +VV     S +  +S E     NK+LA+
Sbjct: 1289 SDGFNLERLEMLGDSFLKHAITTYLFCTYPDA-HEGRLSYMRSKKVSNCNLYRLGKKKGLPSRMVVSIFDPPVNWLPPGYVVNQDKSSTDKWDSDE-----NKDLAN 1389          
BLAST of Endoribonuclease Dicer vs. Ensembl Zebrafish
Match: dicer1 (dicer 1, ribonuclease type III [Source:NCBI gene;Acc:324724])

HSP 1 Score: 211.075 bits (536), Expect = 2.259e-54
Identity = 233/897 (25.98%), Postives = 408/897 (45.48%), Query Frame = 2
Query:   47 RDYQIEIYNKAKNENVIIKLNTGSGKTFIASMLIKDY---LNVKSDKKIFFLVKNSSLVHQHTNSLKDYLFLKDEIGYFYGQMENSWVDN-WTXXXXXXXXXXXXXXVMTAKVFLDILNHNKYNLSQVCYLIFDEVHHLTKSDDYSQISEHVIRTTSDIKILGLTACLIKGVKHVKDIEFAVKQLEHKLNCKVITSMDNIARE-FCGNIKETIIN---YETESFPDLVAIFKSAIEKIESFIPVDGHHSNDNSGSLNAEQNNFKTL-KKYLSESFSVLSTLGLVPCKLITDMFIEDLHGAVNNDSMFFDEKTKLYLDEFLSCLKFINSNIESYISKS--DMLMCSEKCKKLINLILDLKS--------------KNED------------------------------FKNTISILIFINEKIHVLALNVLLGILPKINKAFDFINSNFIIGHSTSQ-YPKKLQMSV--TKQXXXXXXXXXXXXXXXXATNVIEEGLDVSHCNIVVKFDPPQDFRSYLQSKGRARAQNSQYIVF--THETQKTEAQIQKFNLINEEL-NKILKSRVIED-ELNKDDSERNVTPSEDDKYDYVPYGEN-GPRITLNSASSVLNRYLGKLRCNSISEPKIIYTYFQDEFNFHHVSLLLPMPAPYLEEIKGLPCSNKRRAKQFVNLEACKILHKYDELDSSLLPYNRFDNNLVIQESNDIEIIKYE-----------KYTATKLSTKFQNLS-------------IPANKLYLYSIKYTPSVFL--KLGINDISMF---DVSTYLGILLPNPIHQNKDFMKFPIYLVGGMTSVEIKFE-YNLPVNSINYSLLLKCHKILFNIYSERIRRFDKNIF-FDPSKAKSS---IILTILKDN---KIDFNKIKEI 2437
            R YQ+E+   A   N I+ LNTGSGKTFIA +LIK+    +  ++ K+  FLV  +S V Q  ++++ +  L  ++G +  +   SW +  W ++    ++      VMT  +FL +L +    LS++  L+FDE H       Y +I +      S  +ILGLTA ++ G     D+E  ++ LE  L     T+ D +  + +    +E +++   Y+ +S   L     + +++  +F+       ND + S++ E  +   + K+ L++  +VL+ LG         + + +L   + ++    + K  L+ D   + L+ I++  E + S +  D+   + K  +L+ ++ + K               +N+D                              F N +  +IF+  +   + LN L+    K +    +I+SNFI GHS  +  P+  QM V   KQ E+L+ F+  + N+LIAT+++EEG+D+  CN+VV+FD P ++RSY+QSKGRARA  S YI+   +  T+  +  ++ +  I + L NK  KS    D EL     + NV P       YV   E+ GPR+T+N+A   +NRY  +L  +  +         +     +  +L LP+ +P    + G   +  R A++ V L  C+ LHK  ELD  L+P  +             E +KYE                  STK +  S             +P    YLY I    +  L  +L      ++   D +   GIL   PI +      FP+Y   G  ++ I+ +     +++    L+ + H+ +F+     I R +K    F P +A S+   + L I++D+    +DF  +++I
Sbjct:   35 RKYQVELLEAALEHNTIVCLNTGSGKTFIAVLLIKELSHQIRGENGKRTVFLVNAASSVAQQASTVRTHSDL--QVGDYMSEDMTSWPEEMWNREMIENQVL-----VMTCHIFLHVLKNGVLPLSKINLLVFDECHLAITGHPYREIMKICEGCPSCPRILGLTASILNGKCDPCDLEEKIQNLEKILQSNAETATDLVVLDRYASQPREEVLDCGQYQDQS--GLSERLLNELDEALNFL-------NDCNLSVHREDRDPTFISKQVLNDCRAVLTVLGPWCADKAAGIMVRELQKYIKHEQEELNRKFLLFTD---TILRKIHALCEEHFSPASLDLKFVTPKVIRLLEILHEYKPFERQQFESVEWYNNRNQDNYVSWSDSEDDDEDEEAEAKEKTEANFPSPFTNILCGIIFVERRYTAVVLNRLIKEAGKQDPELAYISSNFITGHSIGKNQPRNKQMEVEFRKQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLVVRFDLPTEYRSYVQSKGRARAPVSNYIMLADSERTKTFQEDLKTYKAIEKILRNKCSKSAECNDFELEPVTDDDNVLPP------YVLRSEDGGPRVTMNTAIGHVNRYCARLPSDPFTHLAPKCKTVEMNTGGYRSTLFLPINSPLRVPVTGPVMNCARLAEKAVALLCCEKLHKIGELDDHLMPVGK-------------ETVKYEEELDLHDEEETSVPGRPGSTKRRQCSPKAIPECLRGCYPVPEQPCYLYVIGMVLTTPLPDELNFRRRKLYPPEDTTRCFGILTAKPIPR---IPHFPVYTRSGEVTISIELQKSGFSLSAEQLELITRLHQYIFS----HILRLEKPALEFKPVEADSAYCVLPLNIVEDSNTLDLDFKFMEDI 886          

HSP 2 Score: 131.724 bits (330), Expect = 1.139e-41
Identity = 71/197 (36.04%), Postives = 120/197 (60.91%), Query Frame = 2
Query: 3344 IKNKNLADCCEAIIGSILTNYGIDYSIQYLQWLNLPLVPDNELNAD---------IEISPKLAFQNISMDTDIPQSIN---DLEKILNYHFKNKGYIVQAITHPSSIANRKFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYLNYFDSKMFHILPKVVE-ELLNNQLQ 3895
            I +K++ADC EA++G  LT+ G   +  +L  L L ++P  + ++          ++I P+  F++   +  +   I+   + E  +NY FKNK Y++QA TH S   N    CYQRLEFLGD+++D+L+T ++  + ++ +PG +T+LRSALVNN  FA L+VK+ +HKY      ++FH++   V+ +L  N++Q
Sbjct: 1570 IADKSIADCVEALLGCYLTSCGERAAQLFLCSLGLKVLPPEKQSSGGSAELQYGWLKIPPRCMFEHPDAERTLNHLISGFLNFESKINYTFKNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVQFQLEKNEMQ 1766          

HSP 3 Score: 60.4622 bits (145), Expect = 1.139e-41
Identity = 28/60 (46.67%), Postives = 39/60 (65.00%), Query Frame = 3
Query: 3933 VVKVLGDIFESIAGAIFVDSNYDLKAVWTVYKVFMEEPLKKFFNNIPRNKISMLHEKYPQ 4112
            V K +GDIFES+AGAI++DS   L+ VW VY   M   ++KF  N+PR+ +  L E  P+
Sbjct: 1787 VPKAMGDIFESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRSPVRELLEMEPE 1846          

HSP 4 Score: 76.2554 bits (186), Expect = 2.933e-13
Identity = 44/107 (41.12%), Postives = 63/107 (58.88%), Query Frame = 2
Query: 3047 NDRTNLEQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVVKNSDESVEVNNSREFILIKNKNLAD 3367
            +D  NLE+ E+LGDSFLK   + YLF    D  +EG+L+  RS+ +SN NL+ L  +KGL      + F+P  N+LPP +VV     S +  +S E     NK+LA+
Sbjct: 1329 SDGFNLERLEMLGDSFLKHAITTYLFCTYPDA-HEGRLSYMRSKKVSNCNLYRLGKKKGLPSRMVVSIFDPPVNWLPPGYVVNQDKSSTDKWDSDE-----NKDLAN 1429          
BLAST of Endoribonuclease Dicer vs. Ensembl Zebrafish
Match: drosha (drosha ribonuclease III [Source:ZFIN;Acc:ZDB-GENE-070209-23])

HSP 1 Score: 82.8037 bits (203), Expect = 2.486e-15
Identity = 66/265 (24.91%), Postives = 121/265 (45.66%), Query Frame = 2
Query: 3065 EQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVVKNSDESVEVNNSREFILIKNKNLADCCEAIIGSILTNYGIDYSIQYLQ------------WLNLPLVPDNELNADIEISPKLAFQNISMDTDIPQSINDLEKILNYHFKNKGYIVQAITHPSSIANR-KFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKY 3820
            E+ E LGD+ ++F+TS +L+H     + EG L   R+ ++ N++L  LA +  LD++  Y +         P+               RE  L     +A+C EA+IG++    G++ +                 WLN P  P       +++   L  + +   + + Q + + E  +   F +   + +A T  +   N       QR+EFLGDS++  + T Y+ ++    + G +T LRS+LVNN T A ++ + G  ++
Sbjct:  886 ERLEFLGDAVVEFLTSVHLYHLFPSLE-EGGLATYRTAIVQNQHLAMLAKKLELDRFMLYAHG--------PDLC-------------RESDL--RHAMANCFEALIGAVYLEGGLEEAKDLFGRLLFNTEDMREVWLNYPPHP-------LQVQEPLTDRQLIESSPVLQKLTNFEDAIGVLFTHVRLLARAFTLRTVGFNHLTLGHNQRMEFLGDSIMQLVATEYLFIHFPDHHEGHLTLLRSSLVNNRTQAKVAEELGMQEF 1119          
BLAST of Endoribonuclease Dicer vs. Ensembl Zebrafish
Match: drosha (drosha ribonuclease III [Source:ZFIN;Acc:ZDB-GENE-070209-23])

HSP 1 Score: 82.8037 bits (203), Expect = 2.486e-15
Identity = 66/265 (24.91%), Postives = 121/265 (45.66%), Query Frame = 2
Query: 3065 EQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVVKNSDESVEVNNSREFILIKNKNLADCCEAIIGSILTNYGIDYSIQYLQ------------WLNLPLVPDNELNADIEISPKLAFQNISMDTDIPQSINDLEKILNYHFKNKGYIVQAITHPSSIANR-KFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKY 3820
            E+ E LGD+ ++F+TS +L+H     + EG L   R+ ++ N++L  LA +  LD++  Y +         P+               RE  L     +A+C EA+IG++    G++ +                 WLN P  P       +++   L  + +   + + Q + + E  +   F +   + +A T  +   N       QR+EFLGDS++  + T Y+ ++    + G +T LRS+LVNN T A ++ + G  ++
Sbjct:  886 ERLEFLGDAVVEFLTSVHLYHLFPSLE-EGGLATYRTAIVQNQHLAMLAKKLELDRFMLYAHG--------PDLC-------------RESDL--RHAMANCFEALIGAVYLEGGLEEAKDLFGRLLFNTEDMREVWLNYPPHP-------LQVQEPLTDRQLIESSPVLQKLTNFEDAIGVLFTHVRLLARAFTLRTVGFNHLTLGHNQRMEFLGDSIMQLVATEYLFIHFPDHHEGHLTLLRSSLVNNRTQAKVAEELGMQEF 1119          
BLAST of Endoribonuclease Dicer vs. Ensembl Xenopus
Match: cox6b1 (cytochrome c oxidase subunit VIb polypeptide 1 (ubiquitous) [Source:Xenbase;Acc:XB-GENE-5945264])

HSP 1 Score: 220.705 bits (561), Expect = 2.627e-57
Identity = 267/1063 (25.12%), Postives = 473/1063 (44.50%), Query Frame = 2
Query:   47 RDYQIEIYNKAKNENVIIKLNTGSGKTFIASMLIKDY-LNVKSD-----KKIFFLVKNSSLVHQHTNSLKDYLFLKDEIGYFYGQMENSWVDNWTXXXXXXXXXXXXXXVMTAKVFLDILNHNKYNLSQVCYLIFDEVHHLTKSDDYSQISEHVIRTTSDIKILGLTACLIKGVKHVKDIEFAVKQLEHKLNCKVITSMDNIAREFCGNIKETIINYETESFPDLVAIFKSAIEKIESFIPVDGHHSNDNSGSLNAEQNNFKTLKKYLSESFSVLSTLGLVPCKLITDMFIEDLHGAVNNDSMFFDEKTKLYLDEFLSCLKFINSNIESYISKS--DMLMCSEKCKKLINLILDLKS--------------KNED-------------------------------FKNTISILIFINEKIHVLALNVLLGILPKINKAFDFINSNFIIGHSTSQ-YPKKLQMSV--TKQXXXXXXXXXXXXXXXXATNVIEEGLDVSHCNIVVKFDPPQDFRSYLQSKGRARAQNSQYIVF--THETQKTEAQIQKFNLINEELNKILKSRVIED-ELNKDDSERNVTPSEDDKYDYVPY----GENGPRITLNSASSVLNRYLGKLRCNSISE--PKIIYTYFQDEFNFHHVSLLLPMPAPYLEEIKGLPCSNKRRAKQFVNLEACKILHKYDELDSSLLPYNR--------------FDNNLVIQESNDIEIIKYEKYTATKLSTKFQNLSIPANKLYLYSIKYTPSVFL--KLGINDISMF---DVSTYLGILLPNPIHQNKDFMKFPIYLVGGMTSVEIKF-EYNLPVNSINYSLLLKCHKILFNIYSERIRRFDKNIF-FDPSKAKSS---IILTILKDNK---IDFNKIKEIITNPIVDNLIKNDQSS-----------WVGSVIRPNYIT-NEFGAFVISKVCHDMNADSIFKND--MTYEKFLNKKYNIILSPNEKLSPLIKV------IRLTTIQSCVNKERRFLRNNRKLQRINESECY-----FVPSLTECISLSSSLWTQLCIFPTIHHRMNQILSIEDF 2884
            R YQ+E+   A + N I+ LN+GSGKTFIA +L K+    ++ D     K+  FLV +   V Q  ++++ +  LK  +G +  Q +      W K++W  +   ++++VMT  +FL++L     +LS +  L+FDE H   +   Y +I +         +ILGLTA ++ G    +D+E  +++LE  L     T+ D +  +   +    I+  +   + D   +++  + +++  +       + N  + + E+++    K+ LS+  +VL  LG      +  M + +L   + ++      K  L+ D   + L+ I++  E + S +  DM   + K  KL+ ++   K               +N+D                               F N +  +IF+  +   + LN L+    K +    +I+SNFI GH   +  P+  QM V   KQ E+L+ F+  + N+LIAT+++EEG+D+  CN+VV+FD P ++RSY+QSKGRARA  S YI+   + + +  E  ++ +  I     KIL+++  +  +    +SE    P  DD   + PY     +  PR+T+N+A   +NRY  +L  +  +   PK     F D    +  +L LP+ +P    I G P +  R A + V L  CK LH+  ELD  L+P  +               + ++  +  +      Y K     L   +     P    YLY I    +  L  +L      ++   D +   GIL   PI Q      FP+Y   G  ++ I+  +    +N     L+ + H+ +F+     I R +K    F P+ A  +   + L ++ D+    IDF K  E I        I N Q S           +  +VI P Y   ++   F ++ V  D+   S F +    T+ ++   KYN+ L+   +  PL+ V      + L T +  +N++ + L  +   +R  + E        VP L     + +SLW +    P+I +R++ +L+ E+ 
Sbjct:   35 RKYQVELLEAALDHNTIVCLNSGSGKTFIAVLLSKELSYQIRGDFSKNTKRTVFLVNSEKQVSQQVSAVRTHTDLK--VGEYSDQEKTQC---WAKERWYLEFETHQVLVMTCHIFLNVLKSGNVSLSNINLLVFDECHLAIQDHPYREIMKICESCQPCPRILGLTASILNGKCDPRDLEEKIQKLEEILRSNAETATDLVVLDRYASQPCEIV-LDCGPYIDKSGLYQRLLNELDEAL---NFLIDCNISTHSKERDSTLISKQILSDCQTVLLVLGPWCADKVAGMMVRELQKYIKHEQEELHRKFLLFTD---TILRKIHALCEEHFSPASLDMKFVTPKVIKLLEILRKYKPYERQQFESVEWYNNRNQDNYVSWSDSEDDDDEDEEIEEKEKTETSFPSPFTNILCGIIFVERRYTAVVLNRLIKEAGKQDPELAYISSNFITGHGIGKNQPRNKQMEVEFRKQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLVVRFDLPSEYRSYVQSKGRARAPISNYIMLADSDKIKAFEEDLKTYKAI----EKILRNKCSKSIDCGNTESE----PIVDDDEIFPPYVLRQDDGSPRVTINTAIGHINRYCARLPSDPFTHLAPKCKTREFPD--GLYRSTLYLPINSPLRAPIVGPPMNCGRLADRAVALICCKKLHEIGELDDHLMPVGKETVKYEEELDLHDEEETSVPGRPGSTKRRQCYPKAIPECLRNSYPK---PGQPCYLYVIGMVLTTPLPDELNFRRRKLYPPEDTTRCFGILTAKPIPQ---IPHFPVYTRSGEVTISIELKKSGFTLNLEQLELITRLHQYIFS----HILRLEKPALEFKPTVADCAYCVLPLNVVNDSGTLDIDF-KFVEDIEKSEARTGIPNTQYSAESPFIFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQ--PLLDVDHTSSRLNLLTPRH-LNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAIHPVPASLWRKAVCLPSILYRLHCLLTAEEL 1061          

HSP 2 Score: 134.42 bits (337), Expect = 1.715e-42
Identity = 74/200 (37.00%), Postives = 122/200 (61.00%), Query Frame = 2
Query: 3344 IKNKNLADCCEAIIGSILTNYGIDYSIQYLQWLNLPLVPD-NELNADI-----------EISPKLAFQNISMDTDIPQSIN---DLEKILNYHFKNKGYIVQAITHPSSIANRKFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYLNYFDSKMFHILPKVVE-ELLNNQLQ 3895
            I +K++ADC EA++G  LT+ G   +  +L  L L ++P+  + N D+           +I P+  F++   +  +   I+   + EK +NY FKNK Y++QA TH S   N    CYQRLEFLGD+++D+L+T ++  + ++ +PG +T+LRSALVNN  FA L+VK+ +HKY      ++FH++   V+ +L  N++Q
Sbjct: 1503 IADKSIADCVEALLGCYLTSCGERAAQLFLCSLGLKVLPEVRKTNTDLSSCKGIDYGYLKIPPRCMFEHPDAEKTLDHLISGFENFEKKINYPFKNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFKAISPELFHVIDDFVQFQLEKNEMQ 1702          

HSP 3 Score: 61.2326 bits (147), Expect = 1.715e-42
Identity = 28/60 (46.67%), Postives = 40/60 (66.67%), Query Frame = 3
Query: 3933 VVKVLGDIFESIAGAIFVDSNYDLKAVWTVYKVFMEEPLKKFFNNIPRNKISMLHEKYPQ 4112
            V K +GDIFES+AGAI++DS   L+ VW VY   M+  ++KF  N+PR+ +  L E  P+
Sbjct: 1723 VPKAMGDIFESLAGAIYMDSGMSLETVWHVYYPMMQPLIEKFSANVPRSPVRELLEMEPE 1782          

HSP 4 Score: 71.633 bits (174), Expect = 1.058e-11
Identity = 39/90 (43.33%), Postives = 56/90 (62.22%), Query Frame = 2
Query: 3047 NDRTNLEQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVV---KNSDE 3307
            +D  NLE+ E+LGDSFLK   + YLF    D  +EG+L+  RS+ +SN NL+ L  +KG       + F+P  N+LPP ++V   KNSD+
Sbjct: 1262 SDGFNLERLEMLGDSFLKHAITTYLFCTYPDA-HEGRLSYMRSKKVSNCNLYRLGKKKGSPSRMVVSIFDPPVNWLPPGYIVNQDKNSDK 1350          
BLAST of Endoribonuclease Dicer vs. Ensembl Xenopus
Match: cox6b1 (cytochrome c oxidase subunit VIb polypeptide 1 (ubiquitous) [Source:Xenbase;Acc:XB-GENE-5945264])

HSP 1 Score: 220.705 bits (561), Expect = 3.064e-57
Identity = 267/1063 (25.12%), Postives = 473/1063 (44.50%), Query Frame = 2
Query:   47 RDYQIEIYNKAKNENVIIKLNTGSGKTFIASMLIKDY-LNVKSD-----KKIFFLVKNSSLVHQHTNSLKDYLFLKDEIGYFYGQMENSWVDNWTXXXXXXXXXXXXXXVMTAKVFLDILNHNKYNLSQVCYLIFDEVHHLTKSDDYSQISEHVIRTTSDIKILGLTACLIKGVKHVKDIEFAVKQLEHKLNCKVITSMDNIAREFCGNIKETIINYETESFPDLVAIFKSAIEKIESFIPVDGHHSNDNSGSLNAEQNNFKTLKKYLSESFSVLSTLGLVPCKLITDMFIEDLHGAVNNDSMFFDEKTKLYLDEFLSCLKFINSNIESYISKS--DMLMCSEKCKKLINLILDLKS--------------KNED-------------------------------FKNTISILIFINEKIHVLALNVLLGILPKINKAFDFINSNFIIGHSTSQ-YPKKLQMSV--TKQXXXXXXXXXXXXXXXXATNVIEEGLDVSHCNIVVKFDPPQDFRSYLQSKGRARAQNSQYIVF--THETQKTEAQIQKFNLINEELNKILKSRVIED-ELNKDDSERNVTPSEDDKYDYVPY----GENGPRITLNSASSVLNRYLGKLRCNSISE--PKIIYTYFQDEFNFHHVSLLLPMPAPYLEEIKGLPCSNKRRAKQFVNLEACKILHKYDELDSSLLPYNR--------------FDNNLVIQESNDIEIIKYEKYTATKLSTKFQNLSIPANKLYLYSIKYTPSVFL--KLGINDISMF---DVSTYLGILLPNPIHQNKDFMKFPIYLVGGMTSVEIKF-EYNLPVNSINYSLLLKCHKILFNIYSERIRRFDKNIF-FDPSKAKSS---IILTILKDNK---IDFNKIKEIITNPIVDNLIKNDQSS-----------WVGSVIRPNYIT-NEFGAFVISKVCHDMNADSIFKND--MTYEKFLNKKYNIILSPNEKLSPLIKV------IRLTTIQSCVNKERRFLRNNRKLQRINESECY-----FVPSLTECISLSSSLWTQLCIFPTIHHRMNQILSIEDF 2884
            R YQ+E+   A + N I+ LN+GSGKTFIA +L K+    ++ D     K+  FLV +   V Q  ++++ +  LK  +G +  Q +      W K++W  +   ++++VMT  +FL++L     +LS +  L+FDE H   +   Y +I +         +ILGLTA ++ G    +D+E  +++LE  L     T+ D +  +   +    I+  +   + D   +++  + +++  +       + N  + + E+++    K+ LS+  +VL  LG      +  M + +L   + ++      K  L+ D   + L+ I++  E + S +  DM   + K  KL+ ++   K               +N+D                               F N +  +IF+  +   + LN L+    K +    +I+SNFI GH   +  P+  QM V   KQ E+L+ F+  + N+LIAT+++EEG+D+  CN+VV+FD P ++RSY+QSKGRARA  S YI+   + + +  E  ++ +  I     KIL+++  +  +    +SE    P  DD   + PY     +  PR+T+N+A   +NRY  +L  +  +   PK     F D    +  +L LP+ +P    I G P +  R A + V L  CK LH+  ELD  L+P  +               + ++  +  +      Y K     L   +     P    YLY I    +  L  +L      ++   D +   GIL   PI Q      FP+Y   G  ++ I+  +    +N     L+ + H+ +F+     I R +K    F P+ A  +   + L ++ D+    IDF K  E I        I N Q S           +  +VI P Y   ++   F ++ V  D+   S F +    T+ ++   KYN+ L+   +  PL+ V      + L T +  +N++ + L  +   +R  + E        VP L     + +SLW +    P+I +R++ +L+ E+ 
Sbjct:   35 RKYQVELLEAALDHNTIVCLNSGSGKTFIAVLLSKELSYQIRGDFSKNTKRTVFLVNSEKQVSQQVSAVRTHTDLK--VGEYSDQEKTQC---WAKERWYLEFETHQVLVMTCHIFLNVLKSGNVSLSNINLLVFDECHLAIQDHPYREIMKICESCQPCPRILGLTASILNGKCDPRDLEEKIQKLEEILRSNAETATDLVVLDRYASQPCEIV-LDCGPYIDKSGLYQRLLNELDEAL---NFLIDCNISTHSKERDSTLISKQILSDCQTVLLVLGPWCADKVAGMMVRELQKYIKHEQEELHRKFLLFTD---TILRKIHALCEEHFSPASLDMKFVTPKVIKLLEILRKYKPYERQQFESVEWYNNRNQDNYVSWSDSEDDDDEDEEIEEKEKTETSFPSPFTNILCGIIFVERRYTAVVLNRLIKEAGKQDPELAYISSNFITGHGIGKNQPRNKQMEVEFRKQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLVVRFDLPSEYRSYVQSKGRARAPISNYIMLADSDKIKAFEEDLKTYKAI----EKILRNKCSKSIDCGNTESE----PIVDDDEIFPPYVLRQDDGSPRVTINTAIGHINRYCARLPSDPFTHLAPKCKTREFPD--GLYRSTLYLPINSPLRAPIVGPPMNCGRLADRAVALICCKKLHEIGELDDHLMPVGKETVKYEEELDLHDEEETSVPGRPGSTKRRQCYPKAIPECLRNSYPK---PGQPCYLYVIGMVLTTPLPDELNFRRRKLYPPEDTTRCFGILTAKPIPQ---IPHFPVYTRSGEVTISIELKKSGFTLNLEQLELITRLHQYIFS----HILRLEKPALEFKPTVADCAYCVLPLNVVNDSGTLDIDF-KFVEDIEKSEARTGIPNTQYSAESPFIFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQ--PLLDVDHTSSRLNLLTPRH-LNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAIHPVPASLWRKAVCLPSILYRLHCLLTAEEL 1061          

HSP 2 Score: 123.635 bits (309), Expect = 3.043e-39
Identity = 74/227 (32.60%), Postives = 121/227 (53.30%), Query Frame = 2
Query: 3344 IKNKNLADCCEAIIGSILTNYGIDYSIQYLQWLNLPLVPD----------------------------NELNADI-----------EISPKLAFQNISMDTDIPQSIN---DLEKILNYHFKNKGYIVQAITHPSSIANRKFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYLNYFDSKMFHILPKVVE-ELLNNQLQ 3895
            I +K++ADC EA++G  LT+ G   +  +L  L L ++P+                               N D+           +I P+  F++   +  +   I+   + EK +NY FKNK Y++QA TH S   N    CYQRLEFLGD+++D+L+T ++  + ++ +PG +T+LRSALVNN  FA L+VK+ +HKY      ++FH++   V+ +L  N++Q
Sbjct: 1519 IADKSIADCVEALLGCYLTSCGERAAQLFLCSLGLKVLPEVRKLVTNTNVISASSSYQNSTRDNCTLTARTNTDLSSCKGIDYGYLKIPPRCMFEHPDAEKTLDHLISGFENFEKKINYPFKNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFKAISPELFHVIDDFVQFQLEKNEMQ 1745          

HSP 3 Score: 61.2326 bits (147), Expect = 3.043e-39
Identity = 28/60 (46.67%), Postives = 40/60 (66.67%), Query Frame = 3
Query: 3933 VVKVLGDIFESIAGAIFVDSNYDLKAVWTVYKVFMEEPLKKFFNNIPRNKISMLHEKYPQ 4112
            V K +GDIFES+AGAI++DS   L+ VW VY   M+  ++KF  N+PR+ +  L E  P+
Sbjct: 1766 VPKAMGDIFESLAGAIYMDSGMSLETVWHVYYPMMQPLIEKFSANVPRSPVRELLEMEPE 1825          

HSP 4 Score: 71.633 bits (174), Expect = 1.128e-11
Identity = 39/90 (43.33%), Postives = 56/90 (62.22%), Query Frame = 2
Query: 3047 NDRTNLEQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVV---KNSDE 3307
            +D  NLE+ E+LGDSFLK   + YLF    D  +EG+L+  RS+ +SN NL+ L  +KG       + F+P  N+LPP ++V   KNSD+
Sbjct: 1281 SDGFNLERLEMLGDSFLKHAITTYLFCTYPDA-HEGRLSYMRSKKVSNCNLYRLGKKKGSPSRMVVSIFDPPVNWLPPGYIVNQDKNSDK 1369          
BLAST of Endoribonuclease Dicer vs. Ensembl Xenopus
Match: cox6b1 (cytochrome c oxidase subunit VIb polypeptide 1 (ubiquitous) [Source:Xenbase;Acc:XB-GENE-5945264])

HSP 1 Score: 220.705 bits (561), Expect = 3.226e-57
Identity = 267/1063 (25.12%), Postives = 473/1063 (44.50%), Query Frame = 2
Query:   47 RDYQIEIYNKAKNENVIIKLNTGSGKTFIASMLIKDY-LNVKSD-----KKIFFLVKNSSLVHQHTNSLKDYLFLKDEIGYFYGQMENSWVDNWTXXXXXXXXXXXXXXVMTAKVFLDILNHNKYNLSQVCYLIFDEVHHLTKSDDYSQISEHVIRTTSDIKILGLTACLIKGVKHVKDIEFAVKQLEHKLNCKVITSMDNIAREFCGNIKETIINYETESFPDLVAIFKSAIEKIESFIPVDGHHSNDNSGSLNAEQNNFKTLKKYLSESFSVLSTLGLVPCKLITDMFIEDLHGAVNNDSMFFDEKTKLYLDEFLSCLKFINSNIESYISKS--DMLMCSEKCKKLINLILDLKS--------------KNED-------------------------------FKNTISILIFINEKIHVLALNVLLGILPKINKAFDFINSNFIIGHSTSQ-YPKKLQMSV--TKQXXXXXXXXXXXXXXXXATNVIEEGLDVSHCNIVVKFDPPQDFRSYLQSKGRARAQNSQYIVF--THETQKTEAQIQKFNLINEELNKILKSRVIED-ELNKDDSERNVTPSEDDKYDYVPY----GENGPRITLNSASSVLNRYLGKLRCNSISE--PKIIYTYFQDEFNFHHVSLLLPMPAPYLEEIKGLPCSNKRRAKQFVNLEACKILHKYDELDSSLLPYNR--------------FDNNLVIQESNDIEIIKYEKYTATKLSTKFQNLSIPANKLYLYSIKYTPSVFL--KLGINDISMF---DVSTYLGILLPNPIHQNKDFMKFPIYLVGGMTSVEIKF-EYNLPVNSINYSLLLKCHKILFNIYSERIRRFDKNIF-FDPSKAKSS---IILTILKDNK---IDFNKIKEIITNPIVDNLIKNDQSS-----------WVGSVIRPNYIT-NEFGAFVISKVCHDMNADSIFKND--MTYEKFLNKKYNIILSPNEKLSPLIKV------IRLTTIQSCVNKERRFLRNNRKLQRINESECY-----FVPSLTECISLSSSLWTQLCIFPTIHHRMNQILSIEDF 2884
            R YQ+E+   A + N I+ LN+GSGKTFIA +L K+    ++ D     K+  FLV +   V Q  ++++ +  LK  +G +  Q +      W K++W  +   ++++VMT  +FL++L     +LS +  L+FDE H   +   Y +I +         +ILGLTA ++ G    +D+E  +++LE  L     T+ D +  +   +    I+  +   + D   +++  + +++  +       + N  + + E+++    K+ LS+  +VL  LG      +  M + +L   + ++      K  L+ D   + L+ I++  E + S +  DM   + K  KL+ ++   K               +N+D                               F N +  +IF+  +   + LN L+    K +    +I+SNFI GH   +  P+  QM V   KQ E+L+ F+  + N+LIAT+++EEG+D+  CN+VV+FD P ++RSY+QSKGRARA  S YI+   + + +  E  ++ +  I     KIL+++  +  +    +SE    P  DD   + PY     +  PR+T+N+A   +NRY  +L  +  +   PK     F D    +  +L LP+ +P    I G P +  R A + V L  CK LH+  ELD  L+P  +               + ++  +  +      Y K     L   +     P    YLY I    +  L  +L      ++   D +   GIL   PI Q      FP+Y   G  ++ I+  +    +N     L+ + H+ +F+     I R +K    F P+ A  +   + L ++ D+    IDF K  E I        I N Q S           +  +VI P Y   ++   F ++ V  D+   S F +    T+ ++   KYN+ L+   +  PL+ V      + L T +  +N++ + L  +   +R  + E        VP L     + +SLW +    P+I +R++ +L+ E+ 
Sbjct:   47 RKYQVELLEAALDHNTIVCLNSGSGKTFIAVLLSKELSYQIRGDFSKNTKRTVFLVNSEKQVSQQVSAVRTHTDLK--VGEYSDQEKTQC---WAKERWYLEFETHQVLVMTCHIFLNVLKSGNVSLSNINLLVFDECHLAIQDHPYREIMKICESCQPCPRILGLTASILNGKCDPRDLEEKIQKLEEILRSNAETATDLVVLDRYASQPCEIV-LDCGPYIDKSGLYQRLLNELDEAL---NFLIDCNISTHSKERDSTLISKQILSDCQTVLLVLGPWCADKVAGMMVRELQKYIKHEQEELHRKFLLFTD---TILRKIHALCEEHFSPASLDMKFVTPKVIKLLEILRKYKPYERQQFESVEWYNNRNQDNYVSWSDSEDDDDEDEEIEEKEKTETSFPSPFTNILCGIIFVERRYTAVVLNRLIKEAGKQDPELAYISSNFITGHGIGKNQPRNKQMEVEFRKQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLVVRFDLPSEYRSYVQSKGRARAPISNYIMLADSDKIKAFEEDLKTYKAI----EKILRNKCSKSIDCGNTESE----PIVDDDEIFPPYVLRQDDGSPRVTINTAIGHINRYCARLPSDPFTHLAPKCKTREFPD--GLYRSTLYLPINSPLRAPIVGPPMNCGRLADRAVALICCKKLHEIGELDDHLMPVGKETVKYEEELDLHDEEETSVPGRPGSTKRRQCYPKAIPECLRNSYPK---PGQPCYLYVIGMVLTTPLPDELNFRRRKLYPPEDTTRCFGILTAKPIPQ---IPHFPVYTRSGEVTISIELKKSGFTLNLEQLELITRLHQYIFS----HILRLEKPALEFKPTVADCAYCVLPLNVVNDSGTLDIDF-KFVEDIEKSEARTGIPNTQYSAESPFIFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQ--PLLDVDHTSSRLNLLTPRH-LNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAIHPVPASLWRKAVCLPSILYRLHCLLTAEEL 1073          

HSP 2 Score: 123.25 bits (308), Expect = 3.305e-39
Identity = 74/227 (32.60%), Postives = 121/227 (53.30%), Query Frame = 2
Query: 3344 IKNKNLADCCEAIIGSILTNYGIDYSIQYLQWLNLPLVPD----------------------------NELNADI-----------EISPKLAFQNISMDTDIPQSIN---DLEKILNYHFKNKGYIVQAITHPSSIANRKFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYLNYFDSKMFHILPKVVE-ELLNNQLQ 3895
            I +K++ADC EA++G  LT+ G   +  +L  L L ++P+                               N D+           +I P+  F++   +  +   I+   + EK +NY FKNK Y++QA TH S   N    CYQRLEFLGD+++D+L+T ++  + ++ +PG +T+LRSALVNN  FA L+VK+ +HKY      ++FH++   V+ +L  N++Q
Sbjct: 1534 IADKSIADCVEALLGCYLTSCGERAAQLFLCSLGLKVLPEVRKLVTNTNVISASSSYQNSTRDNCTLTARTNTDLSSCKGIDYGYLKIPPRCMFEHPDAEKTLDHLISGFENFEKKINYPFKNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFKAISPELFHVIDDFVQFQLEKNEMQ 1760          

HSP 3 Score: 61.2326 bits (147), Expect = 3.305e-39
Identity = 28/60 (46.67%), Postives = 40/60 (66.67%), Query Frame = 3
Query: 3933 VVKVLGDIFESIAGAIFVDSNYDLKAVWTVYKVFMEEPLKKFFNNIPRNKISMLHEKYPQ 4112
            V K +GDIFES+AGAI++DS   L+ VW VY   M+  ++KF  N+PR+ +  L E  P+
Sbjct: 1781 VPKAMGDIFESLAGAIYMDSGMSLETVWHVYYPMMQPLIEKFSANVPRSPVRELLEMEPE 1840          

HSP 4 Score: 71.633 bits (174), Expect = 1.092e-11
Identity = 39/90 (43.33%), Postives = 56/90 (62.22%), Query Frame = 2
Query: 3047 NDRTNLEQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVV---KNSDE 3307
            +D  NLE+ E+LGDSFLK   + YLF    D  +EG+L+  RS+ +SN NL+ L  +KG       + F+P  N+LPP ++V   KNSD+
Sbjct: 1293 SDGFNLERLEMLGDSFLKHAITTYLFCTYPDA-HEGRLSYMRSKKVSNCNLYRLGKKKGSPSRMVVSIFDPPVNWLPPGYIVNQDKNSDK 1381          
BLAST of Endoribonuclease Dicer vs. Ensembl Xenopus
Match: cox6b1 (cytochrome c oxidase subunit VIb polypeptide 1 (ubiquitous) [Source:Xenbase;Acc:XB-GENE-5945264])

HSP 1 Score: 218.394 bits (555), Expect = 1.670e-56
Identity = 266/1066 (24.95%), Postives = 473/1066 (44.37%), Query Frame = 2
Query:   47 RDYQIEIYNKAKNENVIIKLNTGSGKTFIASMLIKDY-LNVKSD-----KKIFFLVKNSSLVHQHTNSLKDYLFLKDEIGYFYGQMENSWVDNWTXXXXXXXXXXXXXXVMTAKVFLDILNHNKYNLSQVCYLIFDEVHHLTKSDDYSQISEHVIRTTSDIKILGLTACLIKGVKHVKDIEFAVKQLEHKLNCKVITSMDNIAREFCGNIKETIINYETESFPDLVAIFKSAIEKIESFIPVDGHHSNDNSGSLNAEQNNFKTLKKYLSESFSVLSTLGLVPCKLITDMFIEDLHGAVNNDSMFFDEKTKLYLDEFLSCLKFINSNIESYISKS--DMLMCSEKCKKLINLILDLKS--------------KNED-------------------------------FKNTISILIFINEKIHVLALNVLLGILPKINKAFDFINSNFIIGHSTSQ-YPKKLQMSV--TKQXXXXXXXXXXXXXXXXATNVIEEGLDVSHCNIVVKFDPPQDFRSYLQSKGRARAQNSQYIVF--THETQKTEAQIQKFNLINEELNKILKSRVIED-ELNKDDSERNVTPSEDDKYDYVPY----GENGPRITLNSASSVLNRYLGKLRCNSISE--PKIIYTYFQDEFNFHHVSLLLPMPAPYLEEIKGLPCSNKRRAKQFVNLEACKILHKYDELDSSLLPYNR--------------FDNNLVIQESNDIEIIKYEKYTATKLSTKFQNLSIPANKLYLYSIKYTPSVFL--KLGINDISMF---DVSTYLGILLPNPIHQNKDFMKFPIYLVGGMTSVEIKF-EYNLPVNSINYSLLLKCHKILFNIYSERIRRFDKNIF-FDPSKAKSS---IILTILKDNK---IDFNKIKEIITNPIVDNLIKNDQSS-----------WVGSVIRPNYIT----NEFGAFVISKVCHDMNADSIFKND--MTYEKFLNKKYNIILSPNEKLSPLIKV------IRLTTIQSCVNKERRFLRNNRKLQRINESECY-----FVPSLTECISLSSSLWTQLCIFPTIHHRMNQILSIEDF 2884
            R YQ+E+   A + N I+ LN+GSGKTFIA +L K+    ++ D     K+  FLV +   V Q  ++++ +  LK  +G +  Q +      W K++W  +   ++++VMT  +FL++L     +LS +  L+FDE H   +   Y +I +         +ILGLTA ++ G    +D+E  +++LE  L     T+ D +  +   +    I+  +   + D   +++  + +++  +       + N  + + E+++    K+ LS+  +VL  LG      +  M + +L   + ++      K  L+ D   + L+ I++  E + S +  DM   + K  KL+ ++   K               +N+D                               F N +  +IF+  +   + LN L+    K +    +I+SNFI GH   +  P+  QM V   KQ E+L+ F+  + N+LIAT+++EEG+D+  CN+VV+FD P ++RSY+QSKGRARA  S YI+   + + +  E  ++ +  I     KIL+++  +  +    +SE    P  DD   + PY     +  PR+T+N+A   +NRY  +L  +  +   PK     F D    +  +L LP+ +P    I G P +  R A + V L  CK LH+  ELD  L+P  +               + ++  +  +      Y K     L   +     P    YLY I    +  L  +L      ++   D +   GIL   PI Q      FP+Y   G  ++ I+  +    +N     L+ + H+ +F+     I R +K    F P+ A  +   + L ++ D+    IDF K  E I        I N Q S           +  +VI P  +     ++   F ++ V  D+   S F +    T+ ++   KYN+ L+   +  PL+ V      + L T +  +N++ + L  +   +R  + E        VP L     + +SLW +    P+I +R++ +L+ E+ 
Sbjct:   35 RKYQVELLEAALDHNTIVCLNSGSGKTFIAVLLSKELSYQIRGDFSKNTKRTVFLVNSEKQVSQQVSAVRTHTDLK--VGEYSDQEKTQC---WAKERWYLEFETHQVLVMTCHIFLNVLKSGNVSLSNINLLVFDECHLAIQDHPYREIMKICESCQPCPRILGLTASILNGKCDPRDLEEKIQKLEEILRSNAETATDLVVLDRYASQPCEIV-LDCGPYIDKSGLYQRLLNELDEAL---NFLIDCNISTHSKERDSTLISKQILSDCQTVLLVLGPWCADKVAGMMVRELQKYIKHEQEELHRKFLLFTD---TILRKIHALCEEHFSPASLDMKFVTPKVIKLLEILRKYKPYERQQFESVEWYNNRNQDNYVSWSDSEDDDDEDEEIEEKEKTETSFPSPFTNILCGIIFVERRYTAVVLNRLIKEAGKQDPELAYISSNFITGHGIGKNQPRNKQMEVEFRKQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLVVRFDLPSEYRSYVQSKGRARAPISNYIMLADSDKIKAFEEDLKTYKAI----EKILRNKCSKSIDCGNTESE----PIVDDDEIFPPYVLRQDDGSPRVTINTAIGHINRYCARLPSDPFTHLAPKCKTREFPD--GLYRSTLYLPINSPLRAPIVGPPMNCGRLADRAVALICCKKLHEIGELDDHLMPVGKETVKYEEELDLHDEEETSVPGRPGSTKRRQCYPKAIPECLRNSYPK---PGQPCYLYVIGMVLTTPLPDELNFRRRKLYPPEDTTRCFGILTAKPIPQ---IPHFPVYTRSGEVTISIELKKSGFTLNLEQLELITRLHQYIFS----HILRLEKPALEFKPTVADCAYCVLPLNVVNDSGTLDIDF-KFVEDIEKSEARTGIPNTQYSAESPFIFKLEDYQDAVIIPRQVIYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQ--PLLDVDHTSSRLNLLTPRH-LNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAIHPVPASLWRKAVCLPSILYRLHCLLTAEEL 1064          

HSP 2 Score: 123.25 bits (308), Expect = 3.172e-39
Identity = 74/227 (32.60%), Postives = 121/227 (53.30%), Query Frame = 2
Query: 3344 IKNKNLADCCEAIIGSILTNYGIDYSIQYLQWLNLPLVPD----------------------------NELNADI-----------EISPKLAFQNISMDTDIPQSIN---DLEKILNYHFKNKGYIVQAITHPSSIANRKFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYLNYFDSKMFHILPKVVE-ELLNNQLQ 3895
            I +K++ADC EA++G  LT+ G   +  +L  L L ++P+                               N D+           +I P+  F++   +  +   I+   + EK +NY FKNK Y++QA TH S   N    CYQRLEFLGD+++D+L+T ++  + ++ +PG +T+LRSALVNN  FA L+VK+ +HKY      ++FH++   V+ +L  N++Q
Sbjct: 1528 IADKSIADCVEALLGCYLTSCGERAAQLFLCSLGLKVLPEVRKLVTNTNVISASSSYQNSTRDNCTLTARTNTDLSSCKGIDYGYLKIPPRCMFEHPDAEKTLDHLISGFENFEKKINYPFKNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFKAISPELFHVIDDFVQFQLEKNEMQ 1754          

HSP 3 Score: 61.2326 bits (147), Expect = 3.172e-39
Identity = 28/60 (46.67%), Postives = 40/60 (66.67%), Query Frame = 3
Query: 3933 VVKVLGDIFESIAGAIFVDSNYDLKAVWTVYKVFMEEPLKKFFNNIPRNKISMLHEKYPQ 4112
            V K +GDIFES+AGAI++DS   L+ VW VY   M+  ++KF  N+PR+ +  L E  P+
Sbjct: 1775 VPKAMGDIFESLAGAIYMDSGMSLETVWHVYYPMMQPLIEKFSANVPRSPVRELLEMEPE 1834          

HSP 4 Score: 74.7146 bits (182), Expect = 1.479e-12
Identity = 42/106 (39.62%), Postives = 62/106 (58.49%), Query Frame = 2
Query: 3047 NDRTNLEQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVV---KNSDESVEVNNSREFILIKNK 3355
            +D  NLE+ E+LGDSFLK   + YLF    D  +EG+L+  RS+ +SN NL+ L  +KG       + F+P  N+LPP ++V   KNSD+      S E +++  K
Sbjct: 1284 SDGFNLERLEMLGDSFLKHAITTYLFCTYPDA-HEGRLSYMRSKKVSNCNLYRLGKKKGSPSRMVVSIFDPPVNWLPPGYIVNQDKNSDKWESNETSGEDVMVNGK 1388          
BLAST of Endoribonuclease Dicer vs. Ensembl Xenopus
Match: cox6b1 (cytochrome c oxidase subunit VIb polypeptide 1 (ubiquitous) [Source:Xenbase;Acc:XB-GENE-5945264])

HSP 1 Score: 210.69 bits (535), Expect = 3.841e-54
Identity = 269/1087 (24.75%), Postives = 473/1087 (43.51%), Query Frame = 2
Query:   47 RDYQIEIYNKAKNENVIIKLNTGSGKTFIASMLIKDY-LNVKSD-----KKIFFLVKNSSLVHQHTNSLKDYLFLKDEIGYFYGQMENSWVDNWTXXXXXXXXXXXXXXVMTAKVFLDILNHNKYNLSQVCYLIFDEVHHLTKSDDYSQISEHVIRTTSDIKILGLTACLIKGVKHVKDIEFAVKQLEHKLNCKVITSMDNIAREFCGNIKETIINYETESFPDLVAIFKSAIEKIESFIPVDGHHSNDNSGSLNAEQNNFKTLKKYLSESFSVLSTLGLVPCKLITDMFIEDLHGAVNNDSMFFDEKTKLYLDEFLSCLKFINSNIESYISKS--DMLMCSEKCKKLINLILDLKS--------------KNED-------------------------------FKNTISILIFINEKIHVLALNVLLGILPKINKAFDFINSNFIIGHSTSQ-YPKKLQMSV--TKQXXXXXXXXXXXXXXXXATNVIEEGLDVSHCNIVVKFDPPQDFRSYLQSKGRARAQNSQYIVF--THETQKTEAQIQKFNLINEELNKILKSRVIED-ELNKDDSERNVTPSEDDKYDYVPY----GENGPRITLNSASSVLNRYLGKLRCNSISE--PKIIYTYFQDEFNFHHVSLLLPMPAPYLEEIKGLPCSNKRRAKQFVNLEACKILHKYDELDSSLLPYNR--------------FDNNLVIQESNDIEIIKYEKYTATKLSTKFQNLSIPANKLYLYSIKYTPSVFL--KLGINDISMF---DVSTYLGILLPNPIHQNKDFMKFPIYLVGGMTSVEIKF-EYNLPVNSINYSLLLKCHKILFNIYSERIRRFDKNIF-FDPSKAKSS---IILTILKDNK---IDFNKIKEIITNPIVDNLIKNDQSS-----------WVGSVIRPNY--------------ITNEFGA-----------FVISKVCHDMNADSIFKND--MTYEKFLNKKYNIILSPNEKLSPLIKV------IRLTTIQSCVNKERRFLRNNRKLQRINESECY-----FVPSLTECISLSSSLWTQLCIFPTIHHRMNQILSIEDF 2884
            R YQ+E+   A + N I+ LN+GSGKTFIA +L K+    ++ D     K+  FLV +   V Q  ++++ +  LK  +G +  Q +      W K++W  +   ++++VMT  +FL++L     +LS +  L+FDE H   +   Y +I +         +ILGLTA ++ G    +D+E  +++LE  L     T+ D +  +   +    I+  +   + D   +++  + +++  +       + N  + + E+++    K+ LS+  +VL  LG      +  M + +L   + ++      K  L+ D   + L+ I++  E + S +  DM   + K  KL+ ++   K               +N+D                               F N +  +IF+  +   + LN L+    K +    +I+SNFI GH   +  P+  QM V   KQ E+L+ F+  + N+LIAT+++EEG+D+  CN+VV+FD P ++RSY+QSKGRARA  S YI+   + + +  E  ++ +  I     KIL+++  +  +    +SE    P  DD   + PY     +  PR+T+N+A   +NRY  +L  +  +   PK     F D    +  +L LP+ +P    I G P +  R A + V L  CK LH+  ELD  L+P  +               + ++  +  +      Y K     L   +     P    YLY I    +  L  +L      ++   D +   GIL   PI Q      FP+Y   G  ++ I+  +    +N     L+ + H+ +F+     I R +K    F P+ A  +   + L ++ D+    IDF K  E I        I N Q S           +  +VI P                I   F A           F ++ V  D+   S F +    T+ ++   KYN+ L+   +  PL+ V      + L T +  +N++ + L  +   +R  + E        VP L     + +SLW +    P+I +R++ +L+ E+ 
Sbjct:   35 RKYQVELLEAALDHNTIVCLNSGSGKTFIAVLLSKELSYQIRGDFSKNTKRTVFLVNSEKQVSQQVSAVRTHTDLK--VGEYSDQEKTQC---WAKERWYLEFETHQVLVMTCHIFLNVLKSGNVSLSNINLLVFDECHLAIQDHPYREIMKICESCQPCPRILGLTASILNGKCDPRDLEEKIQKLEEILRSNAETATDLVVLDRYASQPCEIV-LDCGPYIDKSGLYQRLLNELDEAL---NFLIDCNISTHSKERDSTLISKQILSDCQTVLLVLGPWCADKVAGMMVRELQKYIKHEQEELHRKFLLFTD---TILRKIHALCEEHFSPASLDMKFVTPKVIKLLEILRKYKPYERQQFESVEWYNNRNQDNYVSWSDSEDDDDEDEEIEEKEKTETSFPSPFTNILCGIIFVERRYTAVVLNRLIKEAGKQDPELAYISSNFITGHGIGKNQPRNKQMEVEFRKQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLVVRFDLPSEYRSYVQSKGRARAPISNYIMLADSDKIKAFEEDLKTYKAI----EKILRNKCSKSIDCGNTESE----PIVDDDEIFPPYVLRQDDGSPRVTINTAIGHINRYCARLPSDPFTHLAPKCKTREFPD--GLYRSTLYLPINSPLRAPIVGPPMNCGRLADRAVALICCKKLHEIGELDDHLMPVGKETVKYEEELDLHDEEETSVPGRPGSTKRRQCYPKAIPECLRNSYPK---PGQPCYLYVIGMVLTTPLPDELNFRRRKLYPPEDTTRCFGILTAKPIPQ---IPHFPVYTRSGEVTISIELKKSGFTLNLEQLELITRLHQYIFS----HILRLEKPALEFKPTVADCAYCVLPLNVVNDSGTLDIDF-KFVEDIEKSEARTGIPNTQYSAESPFIFKLEDYQDAVIIPRQVMFFPFLQCYLFLKILQHFEADKYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQ--PLLDVDHTSSRLNLLTPRH-LNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAIHPVPASLWRKAVCLPSILYRLHCLLTAEEL 1085          

HSP 2 Score: 134.035 bits (336), Expect = 1.925e-42
Identity = 74/200 (37.00%), Postives = 122/200 (61.00%), Query Frame = 2
Query: 3344 IKNKNLADCCEAIIGSILTNYGIDYSIQYLQWLNLPLVPD-NELNADI-----------EISPKLAFQNISMDTDIPQSIN---DLEKILNYHFKNKGYIVQAITHPSSIANRKFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYLNYFDSKMFHILPKVVE-ELLNNQLQ 3895
            I +K++ADC EA++G  LT+ G   +  +L  L L ++P+  + N D+           +I P+  F++   +  +   I+   + EK +NY FKNK Y++QA TH S   N    CYQRLEFLGD+++D+L+T ++  + ++ +PG +T+LRSALVNN  FA L+VK+ +HKY      ++FH++   V+ +L  N++Q
Sbjct: 1546 IADKSIADCVEALLGCYLTSCGERAAQLFLCSLGLKVLPEVRKTNTDLSSCKGIDYGYLKIPPRCMFEHPDAEKTLDHLISGFENFEKKINYPFKNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFKAISPELFHVIDDFVQFQLEKNEMQ 1745          

HSP 3 Score: 61.2326 bits (147), Expect = 1.925e-42
Identity = 28/60 (46.67%), Postives = 40/60 (66.67%), Query Frame = 3
Query: 3933 VVKVLGDIFESIAGAIFVDSNYDLKAVWTVYKVFMEEPLKKFFNNIPRNKISMLHEKYPQ 4112
            V K +GDIFES+AGAI++DS   L+ VW VY   M+  ++KF  N+PR+ +  L E  P+
Sbjct: 1766 VPKAMGDIFESLAGAIYMDSGMSLETVWHVYYPMMQPLIEKFSANVPRSPVRELLEMEPE 1825          

HSP 4 Score: 71.633 bits (174), Expect = 1.186e-11
Identity = 39/90 (43.33%), Postives = 56/90 (62.22%), Query Frame = 2
Query: 3047 NDRTNLEQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVV---KNSDE 3307
            +D  NLE+ E+LGDSFLK   + YLF    D  +EG+L+  RS+ +SN NL+ L  +KG       + F+P  N+LPP ++V   KNSD+
Sbjct: 1305 SDGFNLERLEMLGDSFLKHAITTYLFCTYPDA-HEGRLSYMRSKKVSNCNLYRLGKKKGSPSRMVVSIFDPPVNWLPPGYIVNQDKNSDK 1393          
BLAST of Endoribonuclease Dicer vs. Ensembl Mouse
Match: Dicer1 (dicer 1, ribonuclease type III [Source:MGI Symbol;Acc:MGI:2177178])

HSP 1 Score: 228.794 bits (582), Expect = 7.994e-60
Identity = 269/1062 (25.33%), Postives = 486/1062 (45.76%), Query Frame = 2
Query:   47 RDYQIEIYNKAKNENVIIKLNTGSGKTFIASMLIKDYLN-VKSD-----KKIFFLVKNSSLVHQHTNSLKDYLFLKDEIGYFYGQMENSWVDNWTXXXXXXXXXXXXXXVMTAKVFLDILNHNKYNLSQVCYLIFDEVHHLTKSDDYSQISEHVIRTTSDIKILGLTACLIKGVKHVKDIEFAVKQLEHKLNCKVITSMDNIARE-FCGNIKETIINYETESFPDLVAIFKSAIEKIESFIPVDGHHSND-NSGSLNAEQNNFKTLKKYLSESFSVLSTLGLVPCKLITDMFIEDLHGAVNNDSMFFDEKTKLYLDEFLSCLKFINSNIESYISKS--DMLMCSEKCKKLINLILDLKS--------------KNED------------------------------FKNTISILIFINEKIHVLALNVLLGILPKINKAFDFINSNFIIGHSTSQ-YPKKLQMSV--TKQXXXXXXXXXXXXXXXXATNVIEEGLDVSHCNIVVKFDPPQDFRSYLQSKGRARAQNSQYIVF--THETQKTEAQIQKFNLINEELNKILKSRVIEDELNKDDSERNVTPSEDDKYDYVPY----GENGPRITLNSASSVLNRYLGKLRCNSISE--PKIIYTYFQDEFNFHHVSLLLPMPAPYLEEIKGLPCSNKRRAKQFVNLEACKILHKYDELDSSLLPYNR--------------FDNNLVIQESNDIEIIKYEKYTATKLSTKFQNLSIPANKLYLYSIKYTPSVFL--KLGINDISMF---DVSTYLGILLPNPIHQNKDFMKFPIYLVGGMTSVEIKF-EYNLPVNSINYSLLLKCHKILFNIYSERIRRFDKNIF-FDPSKAKSS---IILTILKDNK---IDFNKIKEIITNPIVDNLIKNDQSS----------WVGSVIRPNYIT-NEFGAFVISKVCHDMNADSIFKND--MTYEKFLNKKYNIILSPNEKLSPLIKV------IRLTTIQSCVNKERRFLRNNRKLQRINESECY-----FVPSLTECISLSSSLWTQLCIFPTIHHRMNQILSIEDF 2884
            R YQ+E+   A + N I+ LNTGSGKTFIA +L K+  + ++ D     K+  FLV +++ V Q  ++++ +  LK  +G +     N+   +WTK++WS++ +K+++++MT  V L +L +   +LS +  L+FDE H       Y +I +      S  +ILGLTA ++ G    +++E  +++LE  L     T+ D +  + +     E +++     F D   +++  + ++E+ +       ND N    + E+++    K+ LS+  +VL  LG      +  M + +L   + ++      K  L+ D  L   + I++  E Y S +  D+   + K  KL+ ++   K               +N+D                              F N +  +IF+  +   + LN L+    K +    +I+SNFI GH   +  P+  QM     KQ E+L+ F+  + N+LIAT+V+EEG+D+  CN+VV+FD P ++RSY+QSKGRARA  S Y++   T + +  E  ++ +  I     KIL+++  +   + D +E +V    DD+  + PY     + GPR+T+N+A   +NRY  +L  +  +   PK       D     + +L LP+ +P    I G P  + R A++ V L  C+ LHK  ELD  L+P  +               + ++  +  +      Y K     L   +     P    YLY I    +  L  +L      ++   D +   GIL   PI Q      FP+Y   G  ++ I+  +    ++     L+ + H+ +F+     I R +K    F P+ A+S+   + L ++ D+    IDF  +++I  +     +     S           +  +VI P Y   ++   F ++ V  D+   S F +    T+ ++   KYN+ L+   +  PL+ V      + L T +  +N++ + L  +   +R  + E        VP L     + +SLW +    P+I +R++ +L+ E+ 
Sbjct:   35 RKYQVELLEAALDHNTIVCLNTGSGKTFIAVLLTKELAHQIRGDLNPHAKRTVFLVNSANQVAQQVSAVRTHSDLK--VGEYSDLEVNA---SWTKERWSQEFTKHQVLIMTCYVALTVLKNGYLSLSDINLLVFDECHLAILDHPYREIMKLCESCPSCPRILGLTASILNGKCDPEELEEKIQKLERILRSDAETATDLVVLDRYTSQPCEIVVD--CGPFTDRSGLYERLLMELEAAL----DFINDCNVAVHSKERDSTLISKQILSDCRAVLVVLGPWCADKVAGMMVRELQKYIKHEQEELHRKFLLFTDTLL---RKIHALCEEYFSPASLDLKYVTPKVMKLLEILRKYKPYERQQFESVEWYNNRNQDNYVSWSDSEDDDDDEEIEEKEKPETNFPSPFTNILCGIIFVERRYTAVVLNRLIKEAGKQDPELAYISSNFITGHGIGKNQPRSKQMEAEFRKQEEVLRKFRAHETNLLIATSVVEEGVDIPKCNLVVRFDLPTEYRSYVQSKGRARAPISNYVMLADTDKIKSFEEDLKTYKAI----EKILRNKCSK---SADGAEADVHAGVDDEDAFPPYVLRPDDGGPRVTINTAIGHINRYCARLPSDPFTHLAPKCRTRELPD--GTFYSTLYLPINSPLRASIVGPPMDSVRLAERVVALICCEKLHKIGELDEHLMPVGKETVKYEEELDLHDEEETSVPGRPGSTKRRQCYPKAIPECLRESYPK---PDQPCYLYVIGMVLTTPLPDELNFRRRKLYPPEDTTRCFGILTAKPIPQ---IPHFPVYTRSGEVTISIELKKSGFTLSQQMLELITRLHQYIFS----HILRLEKPALEFKPTGAESAYCVLPLNVVNDSGTLDIDFKFMEDIEKSEARIGIPSTKYSKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQ--PLLDVDHTSSRLNLLTPRH-LNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLHCLLTAEEL 1060          

HSP 2 Score: 123.635 bits (309), Expect = 2.084e-39
Identity = 95/321 (29.60%), Postives = 153/321 (47.66%), Query Frame = 2
Query: 3131 SNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKY-------FCYTNFNPKYNYLPPNFVVK---NSDESVEVNNSREFI--------LIKNKNLADCCEAIIGSILTNYGIDYSIQYLQWLNL-----------------------------------PLVPDNELNADIE-----ISPKLAFQNISMDTDIPQSINDL-------EKILNYHFKNKGYIVQAITHPSSIANRKFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYLNYFDSKMFHILPKVVE-ELLNNQLQ 3895
            ++D+  E K+ +K S       L  +    GL+ +        CY   +P       +FVV     S+E+  V+  ++ I         I +K++ADC EA++G  LT+ G   +  +L  L L                                   P+ P +    D+E     I P+  F +     D  +++N L       EK +NY FKNK Y++QA TH S   N    CYQRLEFLGD+++D+L+T ++  + ++ +PG +T+LRSALVNN  FA L+VK+ +HKY      ++FH++   V+ +L  N++Q
Sbjct: 1460 ASDSAYEWKMPKKAS-------LGSMPFASGLEDFDYSSWDAMCY--LDPSKAVEEDDFVVGFWNPSEENCGVDTGKQSISYDLHTEQCIADKSIADCVEALLGCYLTSCGERAAQLFLCSLGLKVLPVIKRTSREKALDPAQENGSSQQKSLSGSCASPVGPRSSAGKDLEYGCLKIPPRCMFDH----PDAEKTLNHLISGFETFEKKINYRFKNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVKFQLEKNEMQ 1767          

HSP 3 Score: 60.8474 bits (146), Expect = 2.084e-39
Identity = 28/60 (46.67%), Postives = 40/60 (66.67%), Query Frame = 3
Query: 3933 VVKVLGDIFESIAGAIFVDSNYDLKAVWTVYKVFMEEPLKKFFNNIPRNKISMLHEKYPQ 4112
            V K +GDIFES+AGAI++DS   L+ VW VY   M+  ++KF  N+PR+ +  L E  P+
Sbjct: 1788 VPKAMGDIFESLAGAIYMDSGMSLEVVWQVYYPMMQPLIEKFSANVPRSPVRELLEMEPE 1847          

HSP 4 Score: 80.8777 bits (198), Expect = 1.328e-14
Identity = 45/113 (39.82%), Postives = 66/113 (58.41%), Query Frame = 2
Query: 3047 NDRTNLEQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVV---KNSDESVEVNNSREFILIKNKNLADCCE 3376
            +D  NLE+ E+LGDSFLK   + YLF    D  +EG+L+  RS+ +SN NL+ L  +KGL      + F+P  N+LPP +VV   K++ E  E +   +  L+ N  L + CE
Sbjct: 1297 SDGFNLERLEMLGDSFLKHAITTYLFCTYPDA-HEGRLSYMRSKKVSNCNLYRLGKKKGLPSRMVVSIFDPPVNWLPPGYVVNQDKSNSEKWEKDEMTKDCLLANGKLGEACE 1408          
BLAST of Endoribonuclease Dicer vs. Ensembl Mouse
Match: Dicer1 (dicer 1, ribonuclease type III [Source:MGI Symbol;Acc:MGI:2177178])

HSP 1 Score: 96.2857 bits (238), Expect = 3.171e-20
Identity = 94/357 (26.33%), Postives = 184/357 (51.54%), Query Frame = 2
Query:   47 RDYQIEIYNKAKNENVIIKLNTGSGKTFIASMLIKDYLN-VKSD-----KKIFFLVKNSSLVHQHTNSLKDYLFLKDEIGYFYGQMENSWVDNWTXXXXXXXXXXXXXXVMTAKVFLDILNHNKYNLSQVCYLIFDEVHHLTKSDDYSQISEHVIRTTSDIKILGLTACLIKGVKHVKDIEFAVKQLEHKLNCKVITSMDNIARE-FCGNIKETIINYETESFPDLVAIFKSAIEKIES---FIPVDGHHSNDNSGSLNAEQNNFKTL-KKYLSESFSVLSTLGLVPCKLITDMFIEDLHGAVNNDSMFFDEKTKLYLDEFLSCLKFINSNIESYISKS--DMLMCSEKCKKLINLI 1078
            R YQ+E+   A + N I+ LNTGSGKTFIA +L K+  + ++ D     K+  FLV +++ V Q  ++++ +  LK  +G +     N+   +WTK++WS++ +K+++++MT  V L +L +   +LS +  L+FDE H       Y +I +      S  +ILGLTA ++ G    +++E  +++LE  L     T+ D +  + +     E +++     F D   +++  + ++E+   FI       ND + ++++++ +   + K+ LS+  +VL  LG      +  M + +L   + ++      K  L+ D     L+ I++  E Y S +  D+   + K  KL+ ++
Sbjct:   35 RKYQVELLEAALDHNTIVCLNTGSGKTFIAVLLTKELAHQIRGDLNPHAKRTVFLVNSANQVAQQVSAVRTHSDLK--VGEYSDLEVNA---SWTKERWSQEFTKHQVLIMTCYVALTVLKNGYLSLSDINLLVFDECHLAILDHPYREIMKLCESCPSCPRILGLTASILNGKCDPEELEEKIQKLERILRSDAETATDLVVLDRYTSQPCEIVVD--CGPFTDRSGLYERLLMELEAALDFI-------NDCNVAVHSKERDSTLISKQILSDCRAVLVVLGPWCADKVAGMMVRELQKYIKHEQEELHRKFLLFTDTL---LRKIHALCEEYFSPASLDLKYVTPKVMKLLEIL 374          
BLAST of Endoribonuclease Dicer vs. Ensembl Mouse
Match: Drosha (drosha, ribonuclease type III [Source:MGI Symbol;Acc:MGI:1261425])

HSP 1 Score: 84.3445 bits (207), Expect = 1.047e-15
Identity = 73/270 (27.04%), Postives = 124/270 (45.93%), Query Frame = 2
Query: 3065 EQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVVKNSDESVEVNNSREFILIKNKNLADCCEAIIGSILTNYGIDYSIQYLQ------------WLNLPLVP--DNELNAD---IEISPKLAFQNISMDTDIPQSINDLEKILNYHFKNKGYIVQAITHPSSIANR-KFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKY 3820
            E+ E LGD+ ++F+TS +L++     + EG L   R+ ++ N++L  LA +  LD++  Y +         P+ + + SD                  +A+C EA+IG++     ++ + Q               WLN PL P    E N D   IE SP L            Q + + E+ +   F +   + +A T  +   N       QR+EFLGDS++  + T Y+ ++    + G +T LRS+LVNN T A ++ + G  +Y
Sbjct:  965 ERLEFLGDAVVEFLTSVHLYYLFPSLE-EGGLATYRTAIVQNQHLAMLAKKLELDRFMLYAHG--------PD-LCRESD--------------LRHAMANCFEALIGAVYLEGSLEEAKQLFGRLLFNDPDLREVWLNYPLHPLQLQEPNTDRQLIETSPVL------------QKLTEFEEAIGVIFTHVRLLARAFTLRTVGFNHLTLGHNQRMEFLGDSIMQLVATEYLFIHFPDHHEGHLTLLRSSLVNNRTQAKVAEELGMQEY 1198          
BLAST of Endoribonuclease Dicer vs. Ensembl Mouse
Match: Drosha (drosha, ribonuclease type III [Source:MGI Symbol;Acc:MGI:1261425])

HSP 1 Score: 84.3445 bits (207), Expect = 1.047e-15
Identity = 73/270 (27.04%), Postives = 124/270 (45.93%), Query Frame = 2
Query: 3065 EQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVVKNSDESVEVNNSREFILIKNKNLADCCEAIIGSILTNYGIDYSIQYLQ------------WLNLPLVP--DNELNAD---IEISPKLAFQNISMDTDIPQSINDLEKILNYHFKNKGYIVQAITHPSSIANR-KFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKY 3820
            E+ E LGD+ ++F+TS +L++     + EG L   R+ ++ N++L  LA +  LD++  Y +         P+ + + SD                  +A+C EA+IG++     ++ + Q               WLN PL P    E N D   IE SP L            Q + + E+ +   F +   + +A T  +   N       QR+EFLGDS++  + T Y+ ++    + G +T LRS+LVNN T A ++ + G  +Y
Sbjct:  965 ERLEFLGDAVVEFLTSVHLYYLFPSLE-EGGLATYRTAIVQNQHLAMLAKKLELDRFMLYAHG--------PD-LCRESD--------------LRHAMANCFEALIGAVYLEGSLEEAKQLFGRLLFNDPDLREVWLNYPLHPLQLQEPNTDRQLIETSPVL------------QKLTEFEEAIGVIFTHVRLLARAFTLRTVGFNHLTLGHNQRMEFLGDSIMQLVATEYLFIHFPDHHEGHLTLLRSSLVNNRTQAKVAEELGMQEY 1198          
BLAST of Endoribonuclease Dicer vs. Ensembl Mouse
Match: Ddx58 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 [Source:MGI Symbol;Acc:MGI:2442858])

HSP 1 Score: 70.0922 bits (170), Expect = 1.873e-11
Identity = 121/543 (22.28%), Postives = 230/543 (42.36%), Query Frame = 2
Query:   32 SFMKTRDYQIEIYNKAK-NENVIIKLNTGSGKTFIASMLIKDYLN---VKSDKKIFFLVKNSSLVHQHTNSLKDYLFLKDEIGYFYGQMENSWVDNWTXXXXXXXXXXXXXXVMTAKVFLDILNHNKY-NLSQVCYLIFDEVHHLTKSDDYSQIS----EHVIRTTSDI--KILGLTACLIKGVKHVKDIEFAVKQLEHKLNCKVITSMDNIAREFCGNIKETIINYETESFPDLVA-----IFKSAIEKIESFIPVDGHHSNDNSGSLNAEQNNFKTLKKYLSESFSVLSTLGLV-------PCKLITDMFIEDLHGAVNNDSMFFDEKTKLYLDEFLSCLK-FINSNIESYISKSDMLMC-----------------SEKCKKLINLILDLKSKNEDFKNTISILIFINEKIHVLALNVLLGILPKINKAFDFINSNFIIGHSTSQYPKKLQMSVTKQXXXXXXXXXXXXXXXXATNVIEEGLDVSHCNIVVKFDPPQDFRSYLQSKGRARAQNSQYIVFTHETQKTEAQIQKFNLINEEL 1537
            S +K R+YQ+E+   AK  +N II   TG GKTF++ ++ + +L         K+ F      +  Q       Y    + +GY    +  +  D+         I    II++T ++ ++ LN+    +LS    +IFDE H+ +K+  Y+QI     +H +  + D   +++GLTA +  GV   K  E A++ +  KL   +  S+    R+    +++ +  Y+ +     VA      FK  I ++           ++  G L   QN     +KY      V     +          ++   +F+   H    ND++   E  ++   + L+ LK F +   E+   +++  +                  S +  KL +L L L+ +    K     ++F+  +  V AL   +    + N A  F+    + G   +     + +   K   +         NILIAT+V +EG+D++ CN+V+ ++   +    +Q++GR RA++S+  + T      E   +K N+I E++
Sbjct:  240 SPLKPRNYQLELALPAKKGKNTIICAPTGCGKTFVSLLICEHHLKKFPCGQKGKVVFFANQIPVYEQQATVFSRYF---ERLGYNIASISGATSDS---VSVQHIIEDNDIIILTPQILVNNLNNGAIPSLSVFTLMIFDECHNTSKNHPYNQIMFRYLDHKLGESRDPLPQVVGLTASV--GVGDAKTAEEAMQHI-CKLCAALDASVIATVRDNVAELEQVV--YKPQKISRKVASRTSNTFKCIISQLMKETEKLAKDVSEELGKLFQIQNREFGTQKYEQWIVGVHKACSVFQMADKEEESRVCKALFLYTSHLRKYNDALIISEDAQM--TDALNYLKAFFHDVREAAFDETERELTRRFEEKLEELEKVSRDPSNENPKLRDLYLVLQEEYH-LKPETKTILFVKTRALVDALKKWI----EENPALSFLKPGILTGRGRTNRATGMTLPAQK-CVLEAFRASGDNNILIATSVADEGIDIAECNLVILYEYVGNVIKMIQTRGRGRARDSKCFLLTSSADVIEK--EKANMIKEKI 761          
BLAST of Endoribonuclease Dicer vs. UniProt/SwissProt
Match: sp|P84634|DCL4_ARATH (Dicer-like protein 4 OS=Arabidopsis thaliana OX=3702 GN=DCL4 PE=1 SV=2)

HSP 1 Score: 260.381 bits (664), Expect = 7.337e-74
Identity = 351/1393 (25.20%), Postives = 618/1393 (44.36%), Query Frame = 2
Query:   44 TRDYQIEIYNKAKNENVIIKLNTGSGKTFIASMLIKDYLN-VKSDKK--IFFLVKNSSLVHQHTNSLKDYLFLKDEIGYFYGQMENSWVDNWTXXXXXXXXXXXXXXVMTAKVFLDILNHNKYNLSQVCYLIFDEVHHLTKSDD--YSQISEHVIRTTS--DIKILGLTACLI--KGVKHVKDIEFAVKQLEHKLNCKVITSMDNIA---------------REFCGNIKETIINYETESFPDLVAIFKSAIEKIESFIPVDGHHSNDNSGSLNAEQNNFKTLKKYLSESFS----VLSTLGLVPCKLITDMFIEDLHGAVNNDSMFFDEKTKLYLDEFLS-CLKFINSNIESYISKSDMLMCSEK-----CKKLINLILDLKSKNEDFKNTISILIFINEKIHVLALNVLLGILPKINKAFDFINSNFIIGHSTSQYPKKLQMSVTKQXXXXXXXXXXXXXXXXATNVIEEGLDVSHCNIVVKFDPPQDFRSYLQSKGRARAQNSQYIVFTHETQKTEAQ-IQKFNLINEELNKILKSRVIEDELNKDDSERNVTPSEDDKYDYVPYGENGPRITLNSASSVLNRYLGKLRCNSISEPKIIYTYFQ-DEFNFHHVSLLLPMPAPYLEEIKGLPCSNKRRAKQFVNLEACKILHKYDELDSSLLPYNRFD-NNLVIQESNDIEIIKYEKYTATKLSTKFQNLSIPANKLYLYSIKYTPSVFLKLGINDISMFDVSTYLGILLPNPIHQNKD----FMKFPIYLVGGMTSVEIKFEYNLPV--------------NSINYSLLLK--CHKILFNIYSERIRRFDKNIFFDPSK-AKSSIILTI---LKDNK----IDFNKIKEIITNPI-------VDNL-------IKNDQSSWVGSVIRPNYITNEFGA--FVISKVCHDMNADSIFKNDMT--YEKFLNKKYNIILSPNEKLSPLIKVIRLTTIQSCVNKERRFLRNNRKLQRINESECYFV---PSLT--ECISLSSSLWTQLCIFPTIHHRMNQILSIEDFAHDLEFMNLIENSDCFEINFDDCYNIENIESSIYDPNVLKFINN-IFPCFMAKTCNDRTNLEQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPK--YNYLPPNFVVKNSDESVEVNN-SREFILIKN----------------KNLADCCEAIIGSILTNYGIDYSIQYLQWLNLPLVPDNELNADIEISPKLAFQNISMDTDIPQS----INDLEKILNYHFKNKGYIVQAITHPSSIANR-KFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYLNYFDSKMFHILPKVVEELLN 3883
             R YQ+E+  KA  ENVI+ L TG GKT IA MLI +  + V S KK    FL    +LV Q    + D +  K  I +  G+        W ++  + ++      VMT ++ L  L H    +  +  LIFDE HH  +  +  Y++I +   ++ S    +I G+TA  +  KG    +++  ++  LE+ LN KV +   N+                R    +  ++ I YE      L  I +  +  ++  I  D H +               ++K+ L  S       L  LGL        + +   H  V ++ +  + K+K+  D +LS   + ++S +    + SD+L  +        +KL+ LI  L       +  +  +IF+N  +    L+ +L  L  +        S+F++G S+        MS      ILK F+ K+ N+L+AT V EEGLD+  C +V+++D P+   S++QS+GRAR   S+Y        + E   I+ F +  + +N  +  R  E+   + D E                 E G  I+  S+ S+L +Y  +L  +   +PK  + +   DEF      + LP  AP + EI+     +   AK+   L+A   LH    L+  LLP ++ +  + +  +  D + IK E  +   L      + +P     L+  K+ PS          S  ++ +Y  + +P+P  +       FMK P+ +      +++   +   V              + I  + L +    K+LF    E I  F      D S+ +KS+  L +   L D +    +D+  I+  +++PI       V+++       +K     W    ++ + +   +    + ++ +CH  N  S  K   T  + + + K Y + L       PL++V  L  +++ ++     ++ N + Q ++E   YF+   P L+  +   LS  + + L + P+I HRM  +L   +  H L                          +SI  P + +   + +      + C++R +LE+ E+LGD+FLKF  S++LF   +D+ +EG+LT++RS +++N NL  LA +K L  Y      +P   + +  P  V  +   S EV++ +R+  ++++                K +AD  EA++G+ L + G   ++++L+W+ +        N D E S ++    I+    +P +    +  LE  L+Y F +KG +VQA  HPS   NR    CYQRLEFLGD+V+D+L+T Y      KL PG++T+LRS  VNN   A ++V F   ++L + +S   H   +V+E+  N
Sbjct:  124 ARRYQVELCKKATEENVIVYLGTGCGKTHIAVMLIYELGHLVLSPKKSVCIFLAPTVALVEQQAKVIADSVNFKVAI-HCGGKRIVKSHSEWEREIAANEVL-----VMTPQILLHNLQHCFIKMECISLLIFDECHHAQQQSNHPYAEIMKVFYKSESLQRPRIFGMTASPVVGKGSFQSENLSKSINSLENLLNAKVYSVESNVQLDGFVSSPLVKVYYYRSALSDASQSTIRYENM----LEDIKQRCLASLKLLI--DTHQTQ-----------TLLSMKRLLKRSHDNLIYTLLNLGLWGAIQAAKIQLNSDHN-VQDEPVGKNPKSKI-CDTYLSMAAEALSSGVAKDENASDLLSLAALKEPLFSRKLVQLIKILSVFR--LEPHMKCIIFVNRIVTARTLSCILNNLELLRS----WKSDFLVGLSSGLK----SMSRRSMETILKRFQSKELNLLVATKVGEEGLDIQTCCLVIRYDLPETVTSFIQSRGRARMPQSEYAFLVDSGNEKEMDLIENFKVNEDRMNLEITYRSSEETCPRLDEE------------LYKVHETGACISGGSSISLLYKYCSRLPHDEFFQPKPEFQFKPVDEFGGTICRITLPANAP-ISEIESSLLPSTEAAKKDACLKAVHELHNLGVLNDFLLPDSKDEIEDELSDDEFDFDNIKGEGCSRGDL----YEMRVPV----LFKQKWDPST---------SCVNLHSYYIMFVPHPADRIYKKFGFFMKSPLPVEAETMDIDLHLAHQRSVSVKIFPSGVTEFDNDEIRLAELFQEIALKVLFE-RGELIPDFVPLELQDSSRTSKSTFYLLLPLCLHDGESVISVDWVTIRNCLSSPIFKTPSVLVEDIFPPSGSHLKLANGCWNIDDVKNSLVFTTYSKQFYFVADICHGRNGFSPVKESSTKSHVESIYKLYGVEL--KHPAQPLLRVKPLCHVRNLLHNR---MQTNLEPQELDE---YFIEIPPELSHLKIKGLSKDIGSSLSLLPSIMHRMENLLVAIELKHVLS-------------------------ASI--PEIAEVSGHRVLEALTTEKCHERLSLERLEVLGDAFLKFAVSRHLF-LHHDSLDEGELTRRRSNVVNNSNLCRLAIKKNLQVYIRDQALDPTQFFAFGHPCRVTCDEVASKEVHSLNRDLGILESNTGEIRCSKGHHWLYKKTIADVVEALVGAFLVDSGFKGAVKFLKWIGV--------NVDFE-SLQVQDACIASRRYLPLTTRNNLETLENQLDYKFLHKGLLVQAFIHPS--YNRHGGGCYQRLEFLGDAVLDYLMTSYFFTVFPKLKPGQLTDLRSLSVNNEALANVAVSFSLKRFL-FCESIYLH---EVIEDYTN 1399          

HSP 2 Score: 42.3578 bits (98), Expect = 7.337e-74
Identity = 19/42 (45.24%), Postives = 28/42 (66.67%), Query Frame = 3
Query: 3939 KVLGDIFESIAGAIFVDSNYDLKAVWTVYKVFMEEPLKKFFN 4064
            KVLGD+ ES  GA+F+D  ++L  VWT+   F+ +P+K   N
Sbjct: 1418 KVLGDLVESCLGALFLDCGFNLNHVWTMMLSFL-DPVKNLSN 1458          
BLAST of Endoribonuclease Dicer vs. UniProt/SwissProt
Match: sp|A2RAF3|DCL1_ASPNC (Dicer-like protein 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=dcl1 PE=3 SV=2)

HSP 1 Score: 229.565 bits (584), Expect = 1.726e-61
Identity = 329/1351 (24.35%), Postives = 555/1351 (41.08%), Query Frame = 2
Query:   38 MKTRDYQIEIYNKAKNENVIIKLNTGSGKTFIASMLIK--------DYLNVKSDKKIFFLVKNSSLVHQHTNSLKDYLFLKDEIGYFYGQMENSWVDNWTXXXXXXXXXXXXXXVMTAKVFLDILNHNKYNLSQVCYLIFDEVHHLTKSDDYSQISEHVIRTT-------SDIKILGLTACLI--KGVKHVKDIEFAVKQLEHKLNCKVITSMD-NIAREFCGNIKETIINYETESFPDLVAIFKSAIEKIESFIPVDGHHSNDNSGSLNAEQNNFKTLKKYLSESFSVLSTLGLVPCKLITDMFIEDLHGAVNNDSMFFDEKTKLYLDEFLSCLKFINSNIE-SYISKSDMLMCSEKCKKLINLILDLKSKNEDF---KNTISILIFINEKIHVLALNVLLGILPKINKAFDFINSNFIIGHSTSQYPKKLQMSVTKQXXXXXXXXXXXXXXXXATNVIEEGLDVSHCNIVVKFDPPQDFRSYLQSKGRARAQNSQYIVFTHETQKTEAQIQKFNLINEELNKILKSRVIEDELNKD-DSERNVTPSEDDKYDYVPYGENGPRITLNSASSVLNRYLGKLRCNSISEPKIIYTYFQDEFNFHHVSLLLPMPAPYLEEIKGLPCSNKRRAKQFVNLEACKILHKYDELDSSL-------LPYNRFDNNLVIQESNDIEIIKYEKYTATKLSTKFQNLSIPANKLYLYSIKYTPSVFLKLGINDISMFDVSTYLGILLPNPIHQNKDFMKFPIYLVGGMTSVEIKFEYNLPVNSINYSLLLKCHKI-LFNIYSERIRR------FDKN-----IFFDPSKAKSSIILTILKDNKIDFNKIKEIITNPIVDNLIKNDQSSWVGSVIRPNYITNEFGAFVISKVCHDMNADSIFKNDMTYEKFLNKKYNIILSPNEKLSPLIKVIRLTTIQSC-----------VNKERRFLRNNRKLQRINESECYFVPSLTECISLSSSLWTQLCIFPTIHHRMNQ-ILSIEDFAHDLEFMNLIENSDCFEINFDDCYNIENIESSIYDPNVLKFINNIFPCFMAKTCNDRTNLEQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNF-VVKNSDESVEVNNSREFILIKNKNLADCCEAIIGSILTNYGIDY----SIQYLQWL-NLPLVPDNELNADIEISPKLAFQNISMDTDIPQSINDLEKILNYHFKNKGYIVQAITHPS-SIANRKFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYLNYFDSKMFHILPKVVEELLNNQLQCEHS 3907
            +  R+YQ+E++ +AK +N I  L+TGSGKT IA +L+K        D +  K  +  FFLV + +L +Q    L++ L     +G+F+G M     D W+K  W +   K  +IV TA++    L ++   +SQ+  LIFDE HH  K   Y++I    IR +          +I G+TA  I  KG     DI     +LE  L+ ++ T+ + ++ R+      E + ++     P   +++K               H  D  G +   +  F+   +  SE     S       + + D  +  L G+V   +   + +T   + E  S  K I    E S I KS      E   +L   +  L+ +   +   +     ++F  ++   L L  L   L        F+    +IG  +      + ++  +Q   L  F+  + N L AT+V EEGLD+  CN+VV+FD  Q    Y+QS+GRAR  NS Y     E    E + +   + + E+ +     + ED L    D + +    +D+          G ++T +SA+++L RY   L+       ++ Y        F    ++LP  +P +  + G P   K  AK+    + C +L K   LD          LP  R +  L I         +Y+  +   L  + Q +  P  +L+   I + PS+ L      + +F         LP+       F +FPI+L       +   E  +    +   LLL   ++    +++ R+ R      +DK       +  P+K +SS + +      +D+  +  +  N  +      D  SWV   +   +  +    F    V H +   S     +   + +N   N  LS       L K  R   + +C           V   R  L      +R  E+ C+      +  ++ +S       FP I  R++  ++S++      E +N       F +  D        +S   D +  + I+        +    R N E+ E LGD FLK  TS  LF   N  D+E      R  LI NKNLF+ A  K + KY     F+ ++ + P    +++  D S +     +  L + K +AD CEA+IG+ L + G D+    +++ +  L N P          I       +Q  + D         +E+ L+Y F+    +  A THPS   A  K  CYQRLEFLGDS+ID +    +       +P  +T  + A+V+N     L+VK G H +L YF + +   + +  EE+   + + E +
Sbjct:  115 LDPREYQLELFERAKVQNTIAVLDTGSGKTLIAVLLLKHTLEKELNDRMEGKPHRIAFFLVDSVTLAYQQAAVLRNNL--DQSVGHFFGAMGT---DLWSKSVWDQHFQKNMVIVCTAEILNQCLLNSYIKMSQINILIFDEAHHTKKDHPYARI----IRDSYLEEVYSKRPRIFGMTASPIDTKG-----DIVDEATRLEKLLDSRIATTSNMSLLRQVARRPVERVWSFNKLEQPFATSLYK---------------HLEDRFGDMACLEGIFRFAWQASSELGRWCSDRAWA--RALADDVLPKLEGSVRKTA---NSETSSNVPE--SAYKEILRITEASEIVKSYAFSSPETFGQLSPKVQVLREELARYFGRQTETKCIVFTQKRYTALILAELFQTL-----NIPFLRPGVLIGVRSGDL-AGMNITFRQQFISLVKFRTGEINCLFATSVAEEGLDIPDCNLVVRFDLYQTLIQYVQSRGRARHFNSTYASMV-ERGNLEHEQRLLEVQDAEMMQSFCRTLPEDRLLYGFDHDLDTVLQKDEGNRTFRIKSTGAKLTYHSATAILARYASSLQYEKEFSAQVTYVVLPINGAFV-CEVILPEKSP-IRGLTGSPAMKKSIAKRSAAFDTCLLLRKNKLLDDHFNSIYHRRLPAMR-NAKLAITSKR---TSQYDMISKPSLWGRKQGM--PPKELHGTFITFLPSMQLSHEPAPLLLFTRER-----LPH-------FPEFPIFL-------DDDVETTIITTPLEKQLLLSEKEVDALTVFTLRVFRDVFHKTYDKEPEKMAYWLAPAKVQSSYLPSYDPRQILDWESLTYVRDNDSIPFSTNADPESWVDLFVFDAW--DGRCRFFTVGVEHSLTPSSPPPPFVARRRHMNDVMNYCLS-------LSKNSRAKFLSTCHWDQPVLRAELVRLRRNLLDKMTDTERDVETRCFICIEPLKVSAIPASTAFSCLAFPAIISRIDAYLISLQG----CESLN-------FTVKLDLALEAFTKDSDNTDEHRAQQIH-------VQRGMGR-NYERLEFLGDCFLKMATSIALFT-QNPDDDEFDYHVNRMCLICNKNLFNAAVDKEIYKYIRSRGFS-RHTWYPEGLKLLQGKDHSRKATTESKHALAE-KTIADVCEALIGAALLSGGPDHRFDMAVKAVTTLVNSPSHKAERWKDYISFYTIPKYQRRAADGAELYLSRKIEEKLSYRFRYPTLLGSAFTHPSYPSAWAKVPCYQRLEFLGDSLIDMVCVEDLFARFPDRDPQWLTEHKMAMVSNKFLGALAVKLGLHTHLKYFSAPLQSQITQYAEEIQTAEGESEGA 1364          

HSP 2 Score: 31.5722 bits (70), Expect = 1.726e-61
Identity = 15/44 (34.09%), Postives = 27/44 (61.36%), Query Frame = 3
Query: 3939 KVLGDIFESIAGAIFVDSNYDLKAVWTVYKVFMEEPLKKFFNNI 4070
            K L D+ E+  GA+FVDS+++ +    V + F  + +K FF ++
Sbjct: 1376 KCLPDMVEAYVGAVFVDSDFNFE----VIERFFRDYIKPFFEDM 1415          
BLAST of Endoribonuclease Dicer vs. UniProt/SwissProt
Match: sp|Q4WVE3|DCL1_ASPFU (Dicer-like protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=dcl1 PE=3 SV=3)

HSP 1 Score: 221.861 bits (564), Expect = 1.605e-60
Identity = 327/1359 (24.06%), Postives = 548/1359 (40.32%), Query Frame = 2
Query:   32 SFMKTRDYQIEIYNKAKNENVIIKLNTGSGKTFIASMLIK--------DYLNVKSDKKIFFLVKNSSLVHQHTNSLKDYLFLKDEIGYFYGQMENSWVDNWTXXXXXXXXXXXXXXVMTAKVFLDILNHNKYNLSQVCYLIFDEVHHLTKSDDYSQI---SEHVIRTTSDIKILGLTACLI--KGVKHVKDIEFAVKQLEHKLNCKVITSMD-NIAREFCGNIKETIINYETESFPDLVAIFKSAIEKIESFIPVDGHHSNDN--SGSLNAEQNNFKTLKKYLSE-------SFSVLSTLGLVPCKLITDMFIEDLHGAVNNDSMFFDEKTKLYLDEFLSCLKFINSNIESYISKSDMLMCSEKCKKLINLILDLKSKNEDFKNTISILIFINEKIHVLALNVLLGILPKINKAFDFINSNFIIGHSTSQYPKKLQMSVTKQXXXXXXXXXXXXXXXXATNVIEEGLDVSHCNIVVKFDPPQDFRSYLQSKGRARAQNSQYIVFTH----ETQKTEAQIQKFNLINEELNKILKSRVIEDELNKDDSERNVTPSEDDKYDYVPYGENGPRITLNSASSVLNRYLGKLRCNSISEPKIIYTYFQDEFNFHHVSLLLPMPAPYLEEIKGLPCSNKRRAKQFVNLEACKILHKYDELDSSLLPYNRFDNNLVIQESNDIEIIKYEKYTATKLSTKFQNLSIPANKLYLYSIKYTPSVFLKLGINDISMFDVSTYLGILLPNPIHQN------------KDFMKFPIYL----VGGMTSVEIKFEYNLPVN---SINYSLLLKCHKILFNIYSERIRRFDKNIFFDPSKAKSSIILTILKDNKIDFNKIKEIITNPIVDNLIKNDQSSWVGSVIRPNYITNEFGAFVISKVCHDMNADSIFKNDMTYEKFLNKKYNIILSPNEKLSPLIKVIRLTTIQSC-----------VNKERRFLRNNRKLQRINESECYFVPSLTECISLSSSLWTQLCIFPTIHHRMNQILSIEDFAHDLEFMNLIENSDCFEINFDDCYNIENIESSIYDPNVLKFINNIFPCFMAKTCNDRTNLEQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVVKNSDESVEVNNSREFILIKNKNLADCCEAIIGSILTNYGIDYSIQYLQWLNLPLV--PDNELNADIE-----ISPKLAFQ-NISMDTDIPQSINDLEKILNYHFKNKGYIVQAITHPS--SIANRKFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYLNYFDSKMFHILPKVVEELLNNQLQCEHS 3907
              +  R+YQIE++ +AK +N I  L+TGSGKT IA +L++        D  N K+ +  FFLV + +L +Q    L++ +     + +F+G M     D W K  W K + +  +IV TA++    L ++   + Q+  LIFDE HH  K   Y++I   S    + +   ++ G+TA  I  KG     DI  A  +LE  L+ ++ T+    + RE      E +  Y     P     F + + K+     +D  + N     G      N    L K+ S+       +  VL  L     KLI    ++  HGAV  D +   E ++   + F +                D  +  E   K+  L ++L     D   T  I +F  ++     LN L  +L   N     +    +IG         + ++  +Q   L  F+  + N L AT+V EEGLD+  CN+V++FD  +    Y+QS+GRAR   S Y +       E +    +I++   I     +IL    I   L+ +D + +    E++          G ++T +SA ++L RY   L+    + P++ Y       N +   ++LP  +P +  + G P   K  AK+    + C +L K               N L+    N I    Y +      + K   L+I   +   Y +   PS++ K        F    ++ +L   P+ ++             +F  F IYL       + S  +K    + V+   S+    L     I   +Y   +++     +  P++A           + ID++ +  +  N  +      +  S V   I  N+    F  F ++ V   +         +   +++N   N  LS       L K  R   + SC           V   R  L      ++  ++EC+         +L  S+ +    FP I  R++  L   +   +LE   +I      E    D  N E      +    + F        M K      N E+ E LGD FLK  TS  LF   N  D+E      R  LI NKNLF+ A +K + +Y     F+    Y     ++   D S ++ +  +  L   K +AD CEA+IG+ L + G ++           LV  P + ++   E       PK   + +   + D+ + +   E+ L YHF     +  AITHPS  S    +  CYQRLEFLGDS++D +    +       +P  ++  + A+V+N     LSVK GFH+ +  F + +   +   VEE+   Q + + +
Sbjct:  122 GMLDPREYQIELFERAKTQNTIAVLDTGSGKTLIAVLLLRHTILNELDDRANGKTHRVSFFLVDSVTLAYQQAAVLRNNI--DQNVAHFFGAMG---TDLWDKRTWDKHLQRNMVIVCTAEILNQCLLNSYVRMDQINLLIFDEAHHAKKDHPYARIIRDSYFKAQPSQRPRVFGMTASPIDTKG-----DITEAATRLETFLDSRIATTSKITLLREVVSRPIEKVWAYNRLEPP-----FATELYKL-----MDTRYGNIKVLEGVYRFAWNASSELGKWCSDRAWWHALADDVLPKLEGNINKLIESNTMKAEHGAVFKDIIRIREASETVKNYFFT----------------DPELPGELSPKVQRLRMELSKHFNDTTGTKCI-VFTQKRYTAKILNELFTVLNIPN-----LRPGVLIGVRPGDI-GGMNITFRQQFLALVKFRTGEINCLFATSVAEEGLDIPDCNLVIRFDLYRTLIQYVQSRGRARHCTSTYAIMVEKDNAEHEGRLKEIREAENIMRRFCEILPEDRI---LHGNDHDLDSFLQEEEGRRTFTVKSTGAKLTYHSAIAILARYASSLQYEKETVPQVTYV-VTIASNAYVCEVILPEKSP-IRGLTGSPAMRKAVAKRSAAFDTCLLLRK---------------NRLLDGYFNSI----YHRRLPAMRNAK---LAITCKRTNAYDMLLKPSIWAKQRTTPTETF-YGIHMSLLPSKPLSRDHRPILLLTREKLPEFPAFSIYLDEDVETKVLSYPLKHGLQISVDKLQSLTVFTLRIFRDIFHKVYEHEVQKMP--YWLAPAEAIDGRGSGKNPRDCIDWDTVSFVHNNDEITFTRNLNPESLVNRFIFDNW-DGRFRYFTVA-VADTLQPSDPPPPSVPRRRYMNNIMNYTLS-------LSKNSRARFLSSCDWNQPVLQAELVRLRRNLLDKMTTQEKEMQTECFICAEPLRISALPPSIVSTCLAFPAIISRLDSYLIALEACDELEL--VIRPDFALEAFTKDSDNTEE-----HRGQQIHFQRG-----MGK------NYERLEFLGDCFLKMATSIALFS-QNPNDDEFDYHVNRMCLICNKNLFNTAIKKQIYRYIRSRGFSRHIWYPDGLTLLHGKDHSTKLLSEGKHAL-GEKTIADVCEALIGASLLSGGPEHRFDMATKAVSALVDSPSHRVSCWKEYITLYTLPKYQTEKHRGSEDDLARHV---EEELGYHFTYPRLLASAITHPSLPSTWGYRVPCYQRLEFLGDSLLDMVCVEDLFRRFPDRDPQWLSEHKMAMVSNKFLGALSVKLGFHRRIMAFSNPLQAQITHYVEEIETAQAESQGA 1375          

HSP 2 Score: 36.1946 bits (82), Expect = 1.605e-60
Identity = 21/62 (33.87%), Postives = 32/62 (51.61%), Query Frame = 3
Query: 3939 KVLGDIFESIAGAIFVDSNYDLKAVWTVYKVFMEEPLKKFFNNIP-------RNKISMLHEK 4103
            K L D+ E+  GAIFVDS +D +    V + F E  +K FF ++        ++  + LH K
Sbjct: 1387 KCLPDMVEAYLGAIFVDSKFDFQ----VIEAFFERQIKPFFEDMSIYDTFANKHPTTFLHNK 1444          
BLAST of Endoribonuclease Dicer vs. UniProt/SwissProt
Match: sp|A1CBC9|DCL1_ASPCL (Dicer-like protein 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) OX=344612 GN=dcl1 PE=3 SV=2)

HSP 1 Score: 225.328 bits (573), Expect = 5.124e-60
Identity = 318/1374 (23.14%), Postives = 567/1374 (41.27%), Query Frame = 2
Query:   32 SFMKTRDYQIEIYNKAKNENVIIKLNTGSGKTFIASMLIK--------DYLNVKSDKKIFFLVKNSSLVHQHTNSLKDYLFLKDEIGYFYGQMENSWVDNWTXXXXXXXXXXXXXXVMTAKVFLDILNHNKYNLSQVCYLIFDEVHHLTKSDDYSQI---SEHVIRTTSDIKILGLTACLI--KGVKHVKDIEFAVKQLEHKLNCKVITSMD-NIAREFCGNIKETIINYETESFPDLVAIFKSAIEKIESFIPVDGHHSNDNSGSLNAEQNNFKTLKKYLSESFSVLSTLGLVPCK------LITDMFIEDLHGAVNNDSMFFDEKTKLYLDEFLSCLKFI----NSNIESYISKSDMLMCSEKCKKLINLILDLKSKNEDFKNTISILIFINEKIHVLALNVLLGILPKINKAFDFINSNFIIGHSTSQYPKKLQMSVTKQXXXXXXXXXXXXXXXXATNVIEEGLDVSHCNIVVKFDPPQDFRSYLQSKGRARAQNSQYIVFTH-ETQKTEAQIQKFNLINEELNKILKSRVIEDELNKDDSERNVTPSEDDKYDYVPYGENGPRITLNSASSVLNRYLGKLRCNSISEPKIIYTYFQDEFNFHHVSLLLPMPAPYLEEIKGLPCSNKRRAKQFVNLEACKILHKYDELDSSLLPYNRFDNNLVIQESNDIEIIKYEKYTATKLSTKFQNLSIPANKLYLYSIKYTPSVFLK-LGINDISMFDVSTYLGILLPNPI---HQN---------KDFMKFPIYLVGGMTSVEIKFEYNLPVNSINYSLLLKCHKI-LFNIYSERIRRFDKNIFFDPSKAKSSIILTILKDNK-IDFNKIKEIITNPIVD----NLIKNDQSSWVGSVIRPNYITNEF--------GAFVISKVCHDMNADSIFKNDMTYEKFLNK--KYNIILSPNEKLSPLI------KVIRLTTIQSCVNKERRFLRNNRKLQRINESECYFVPSLTECISLSSSLWTQLCIFPTIHHRMNQ-ILSIEDFAHDLEFMNLIENSDCFEINFDDCYNIENIESSIYDPNVLKFINNIFPCFMAKTCNDRTNLEQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVVKNSDESVEVNNSREFILIKNKNLADCCEAIIGSILTNYGIDYSI-------------------QYLQWLNLPLVPDNELNADIEISPKLAFQNISMDTDIPQSINDLEKILNYHFKNKGYIVQAITHPSSIANRKF--SCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYLNYFDSKMFHILPKVVEELLNNQLQCEHS 3907
              +  R+YQIE++ +AK +N I  L+TGSGKT IA +L++        D  N K  +  FFLV + +L +Q    L++   +   + +F+G M     D W +  W + + +  +IV TA++    L ++   ++Q+  LIFDE HH  K   Y++I   S          +I G+TA  I  KG     DI  A  +LE  L+ ++ T+    + R+      E +  Y+    P     FK+ + K+                 +     N K L+     ++   S LG   C        + D  +  L G VN       E T    +  ++  +       SNI    + +D     E   K+  L  +L SK+         +IF  ++     L+ L  IL     +   +    +IG  +      + ++  +Q   L  F++ + N L AT+V EEGLD+  CN+VV+FD       Y+QS+GRAR  +S Y      +    EA++++     + +    ++   +  L+ +D + +     ++          G R+T +SA ++L RY   L+    + P+  Y   Q   N +   ++LP  +P +  + G P   K  AKQ    + C +L ++  LD                  +  + I +++  A + +     L+I + K   Y +   PS++ +  GI    ++   T L +L   P+   HQ           DF  FPIYL       +   E  +   S++  + L   ++     ++ RI R   ++F    + +S  +   L   + +D N  +E     I+D      ++ +        + P  + N F          F   KV   + A     + +   + ++    Y + LS N +   L        V++   ++   N   +     +K+Q    +EC+      +  ++  S+ +    FP I  R++  ++SIE      + ++L+  SD         Y +E +     +    +     F   M K      N E+ E LGD FLK  TS  LF   N  D+E      R  LI NKNLF+ A ++ + +Y    +F+ ++ + P    +    +  +   S+    +  K +AD CEA+IG+ L + G ++                     ++ +++ L   P+ ++         LA Q              +E+ L YHF+    +  A+THPS+ +   F   CYQRLEFLGDS++D +    +       +P  +T  + A+V+N     L+VK GFHK++  F + +   +   VEE+   + + E +
Sbjct:  119 GLLDPREYQIELFERAKAQNTIAVLDTGSGKTLIAVLLLRHVLQNELNDRANGKPHRVSFFLVDSVTLAYQQAAVLRNN--IDQNVAHFFGAMG---TDLWDRQVWEEHLQQNMVIVCTAEILNQCLLNSHVRMNQINLLIFDEAHHTKKDHPYARIIRDSYFKASPPQRPRIFGMTASPIDTKG-----DIIAAATRLETLLDSRIATTSKITLLRQVVSRPIEKVWAYDRLESP-----FKTNLHKL-----------------MENRFGNVKALEGVFRFAWYASSELGRW-CSDRAWLYALADDVLPKLEGHVNK----LAESTAAATERDMAFKEITLIKEASNIVKAHTFNDPEFPGELSPKVRLLQTEL-SKHFSHAPETKCIIFTQKRYTAKTLHELFTIL-----SIPHLRPGVLIGVRSGDI-GGMNITFRQQFLALVKFRKGEINCLFATSVAEEGLDIPDCNLVVRFDLYHTLIQYVQSRGRARHYHSTYASMVEKDNSDHEARLREVREAEKTMQNFCETLPEDRILHGNDHDLDSLLQHEEGRRTFTVKSTGARLTYHSAIAILARYASSLQYEKETTPQATYV-VQSVGNTYVCEVILPEKSP-IRGLTGSPAIRKSIAKQSAAFDTCLLLRRHKLLD------------------DFFKSIYHKRLPAMRNA----KLAITSKKTNQYDMLLKPSIWRRHQGILPSKLY--GTILSLLPSEPLSREHQPILVLTREKLPDFPAFPIYL-------DEDIETKVVPRSLDTGMELSAEELRALTTFTLRIFR---DVFHKVYEQESEKLPYWLAPAEPLDANG-REPGPRGIIDWKTVTFVQENDEIVFSRDLAPESLVNRFMFDKWDGRSRFFTIKVMEGLRAADPPPSSVPRRRHMDNIMSYCLSLSKNSRARFLAGCHWDQPVLQAELVRLRRNLLDKLTTEEKKIQ----TECFICAEPLKISAIPPSIASTCLAFPAIITRLDSYLISIE----ACDELDLVIRSD---------YALEAVTKDSDNTEEHRGQQIHFQRGMGK------NYERLEFLGDCFLKMATSIALF-TQNPDDDEFDYHVNRMCLICNKNLFNTAKKRQIYRYIRSRSFS-RHVWYPDGLTLLQGKDHSKKMLSQAKHALGEKTIADVCEALIGACLLSGGPEHRFDMGVKAVSVFVDSPSHAVSRWKEYIGLYKPPNYQVRKAEGAETNLALQ--------------VEEKLGYHFRYPRLLCSAVTHPSTPSTWYFRVPCYQRLEFLGDSLLDMVCVEDLFHRFPDRDPQWLTEHKMAMVSNKFLGALAVKLGFHKHIKAFSNPLQAQITYYVEEIETAEAESEGA 1372          

HSP 2 Score: 31.187 bits (69), Expect = 5.124e-60
Identity = 15/44 (34.09%), Postives = 26/44 (59.09%), Query Frame = 3
Query: 3939 KVLGDIFESIAGAIFVDSNYDLKAVWTVYKVFMEEPLKKFFNNI 4070
            K L D+ E+  GAIFVDS++  +    V + F +  +K +F ++
Sbjct: 1384 KCLPDMVEAYLGAIFVDSDFSFE----VIEAFFQAQIKPYFQDM 1423          
BLAST of Endoribonuclease Dicer vs. UniProt/SwissProt
Match: sp|Q6TUI4|DICER_BOVIN (Endoribonuclease Dicer OS=Bos taurus OX=9913 GN=DICER1 PE=2 SV=3)

HSP 1 Score: 228.794 bits (582), Expect = 5.230e-59
Identity = 272/1061 (25.64%), Postives = 490/1061 (46.18%), Query Frame = 2
Query:   47 RDYQIEIYNKAKNENVIIKLNTGSGKTFIASMLIKDY-LNVKSD-----KKIFFLVKNSSLVHQHTNSLKDYLFLKDEIGYFYGQMENSWVDNWTXXXXXXXXXXXXXXVMTAKVFLDILNHNKYNLSQVCYLIFDEVHHLTKSDDYSQISEHVIRTTSDIKILGLTACLIKGVKHVKDIEFAVKQLEHKLNCKVITSMDNIARE-FCGNIKETIINYETESFPDLVAIFKSAIEKIESFIPVDGHHSNDNSGSLNAEQNNFKTL-KKYLSESFSVLSTLGLVPCKLITDMFIEDLHGAVNNDSMFFDEKTKLYLDEFLSCLKFINSNIESYISKS--DMLMCSEKCKKLINLILDLKS--------------KNED------------------------------FKNTISILIFINEKIHVLALNVLLGILPKINKAFDFINSNFIIGHSTSQ-YPKKLQMSV--TKQXXXXXXXXXXXXXXXXATNVIEEGLDVSHCNIVVKFDPPQDFRSYLQSKGRARAQNSQYIVF--THETQKTEAQIQKFNLINEELNKILKSRVIEDELNKDDSERNVTPSEDDKYDYVPY---GENGPRITLNSASSVLNRYLGKLRCNSISE--PKIIYTYFQDEFNFHHVSLLLPMPAPYLEEIKGLPCSNKRRAKQFVNLEACKILHKYDELDSSLLPYNR--------------FDNNLVIQESNDIEIIKYEKYTATKLSTKFQNLSIPANKLYLYSIKYTPSVFL--KLGINDISMF---DVSTYLGILLPNPIHQNKDFMKFPIYLVGGMTSVEIKFEYNLPVNSINY-SLLLKCHKILFNIYSERIRRFDKNIF-FDPSKAKSS---IILTILKDNK---IDFNKIKEIITNPIVDNLIKNDQSS----------WVGSVIRPNYIT-NEFGAFVISKVCHDMNADSIFKND--MTYEKFLNKKYNIILSPNEKLSPLIKV------IRLTTIQSCVNKERRFLRNNRKLQRINESECY-----FVPSLTECISLSSSLWTQLCIFPTIHHRMNQILSIEDF 2884
            R YQ+E+   A + N I+ LNTGSGKTFIA +L K+    ++ D     K+  FLV +++ V Q  ++++ +  LK  +G  Y  +E S   +WTK+KW+++ +K+++++MT  V L++L +   +LS +  L+FDE H       Y +I +      S  +ILGLTA ++ G    +++E  +++LE  L     T+ D +  + +     E +++     F D   +++  + ++E  +    +  ND + S+++++ +   + K+ LS+  +VL  LG      +  M + +L   + ++      K  L+ D FL   + I++  E + S +  D+   + K  KL+ ++   K               +N+D                              F N +  +IF+  +   + LN L+    K +    +I+SNFI GH   +  P+  QM     KQ E+L+ F+  + N+LIAT+++EEG+D+  CN+VV+FD P ++RSY+QSKGRARA  S Y++   T + +  E  ++ +  I     KIL+++  +   + D  E +  P  DD   + PY    E+GPR+T+N+A   +NRY  +L  +  +   PK       D     + +L LP+ +P    I G P S  R A++ V L  C+ LHK  ELD  L+P  +               + ++  +  +      Y K     L   +     P    YLY I    +  L  +L      ++   D +   GIL   PI Q      FP+Y   G  ++ I+ + +    S+    L+ + H+ +F+     I R +K    F P+ A S+   + L ++ D+    IDF  +++I  +     +     S           +  +VI P Y   ++   F ++ V  D+   S F +    T+ ++   KYN+ L+   +  PL+ V      + L T +  +N++ + L  +   +R  + E        VP L     + +SLW +    P+I +R++ +L+ E+ 
Sbjct:   45 RKYQVELLEAALDHNTIVCLNTGSGKTFIAVLLTKELSYQIRGDFNRNGKRTVFLVNSANQVAQQVSAVRTHSDLK--VGE-YSNLEVS--ASWTKEKWNQEFTKHQVLIMTCYVALNVLKNGYLSLSDINLLVFDECHLAILDHPYREIMKLCENCPSCPRILGLTASILNGKCDPEELEEKIQKLEKILKSNAETATDLVVLDRYTSQPCEIVVD--CGPFTDRSGLYERLLMELEEAL----NFINDCNISVHSKERDSTLISKQILSDCRAVLVVLGPWCADKVAGMMVRELQKHIKHEQEELHRKFLLFTDTFL---RKIHALCEEHFSPASLDLKFVTPKVIKLLEILRKYKPYERQQFESVEWYNNRNQDNYVSWSDSEDDEEDEEIEEKEKPETNFPSPFTNILCGIIFVERRYTAVVLNRLIKEAGKQDPELAYISSNFITGHGIGKNQPRNKQMEAEFRKQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLVVRFDLPTEYRSYVQSKGRARAPISNYVMLADTDKIKSFEEDLKTYKAI----EKILRNKCSK---SVDTGEADTEPVVDDDDVFPPYVLRPEDGPRVTINTAIGHVNRYCARLPSDPFTHLAPKCRTRELPD--GTFYSTLYLPINSPLRASIVGPPMSCIRLAERVVALICCEKLHKIGELDDHLMPVGKETVKYEEELDLHDEEETSVPGRPGSTKRRQCYPKAIPECLRESYPR---PGQPCYLYVIGMVLTTPLPDELNFRRRKLYPPEDTTRCFGILTAKPIPQ---IPHFPVYTRSGEVTISIELKKSGFTLSLQMLELITRLHQYIFS----HILRLEKPALEFKPTDADSAYCVLPLNVVNDSSTLDIDFKFMEDIEKSEARIGIPSTKYSKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQ--PLLDVDHTSSRLNLLTPRH-LNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLHCLLTAEEL 1069          

HSP 2 Score: 122.094 bits (305), Expect = 2.528e-38
Identity = 84/262 (32.06%), Postives = 134/262 (51.15%), Query Frame = 2
Query: 3281 NFVVK---NSDESVEVNNSREFI--------LIKNKNLADCCEAIIGSILTNYGIDYSIQYLQWLNLPLVP-----DNE--------------------------------LNADIE-----ISPKLAFQNISMDTDIPQSIN---DLEKILNYHFKNKGYIVQAITHPSSIANRKFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYLNYFDSKMFHILPKVVE-ELLNNQLQ 3895
            +FVV     S+E+  V+  ++ I         I +K++ADC EA++G  LT+ G   +  +L  L L ++P     D E                                +  D+E     I P+  F +   D  +   I+   + EK +NY FKNK Y++QA TH S   N    CYQRLEFLGD+++D+L+T ++  + ++ +PG +T+LRSALVNN  FA L+VK+ +HKY      ++FH++   V+ +L  N++Q
Sbjct: 1523 DFVVGFWNPSEENCGVDTGKQSISYDLHTEQCIADKSIADCVEALLGCYLTSCGERAAQLFLCSLGLKVLPVIKRTDREKAMCPTRENFTSQQKNLSGSRAAASGAGYRASVLKDLEYGCLKIPPRCMFDHPEADRTLRHLISGFENFEKKINYRFKNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVQFQLEKNEMQ 1784          

HSP 3 Score: 61.2326 bits (147), Expect = 2.528e-38
Identity = 28/61 (45.90%), Postives = 40/61 (65.57%), Query Frame = 3
Query: 3933 VVKVLGDIFESIAGAIFVDSNYDLKAVWTVYKVFMEEPLKKFFNNIPRNKISMLHEKYPQM 4115
            V K +GDIFES+AGAI++DS   L+ VW VY   M   ++KF  N+PR+ +  L E  P++
Sbjct: 1805 VPKAMGDIFESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRSPVRELLEMEPEI 1865          

HSP 4 Score: 64.3142 bits (155), Expect = 9.430e-9
Identity = 40/89 (44.94%), Postives = 55/89 (61.80%), Query Frame = 2
Query: 3047 NDRTNLEQFEILGDSFLKF-ITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVVKNSDES 3310
            +D  NLE+ E+LGDSFLK  IT+  L     D  +EG+L+  RS+ +SN NL+ L  +KGL      + F+P  N LPP +VV N D+S
Sbjct: 1307 SDGFNLERLEMLGDSFLKHAITTVSLSALILDA-HEGRLSYMRSKKVSNCNLYRLGKKKGLPSRMVVSIFDPPVNGLPPGYVV-NQDKS 1393          
BLAST of Endoribonuclease Dicer vs. TrEMBL
Match: A0A2S1PRV8 (Putative dicerB OS=Actinia equina OX=6106 PE=2 SV=1)

HSP 1 Score: 392.119 bits (1006), Expect = 2.210e-116
Identity = 394/1419 (27.77%), Postives = 652/1419 (45.95%), Query Frame = 2
Query:   26 NFSFMKTRDYQIEIYNKAKNENVIIKLNTGSGKTFIASMLIK--------DYLNVKSDKKIFFLVKNSSLVHQHTNSLKDYLFLKDEIGYFYGQMENSWVDNWTXXXXXXXXXXXXXXVMTAKVFLDILNHNKYNLSQVCYLIFDEVHHLTKSDDYSQISEH--VIRTTSDIKILGLTACLIKGVKHVKDIEFAVKQLEHKLNCKVITSMDNIAREFCGNIKETIINYETESFPDLVAIFKSAIEKI--ESFIPVDGHHSNDNSGSLNAEQNNFKTLKKYLSESFSVLSTLGLVPCKLITDMFIEDLHGAVNNDSMFFDEKTKLYLDEFLSC-LKFINSNIESY------ISKSDMLMCSEKCKKLINLILDLKSKNEDFKNTISILIFINEKIHVLALNVLLGILPKINKAFDFINSNFIIGHS---TSQYPKKLQMSVTKQXXXXXXXXXXXXXXXXATNVIEEGLDVSHCNIVVKFDPPQDFRSYLQSKGRARAQNSQYIVFTHETQKTEAQIQKFNLINEELNKILKSRVIEDELNKDDSERNVTPSEDDKYDYV------PY-GENGPRITLNSASSVLNRYLGKLRCNSISEPKIIYTYFQDEFNFHHVSLLLPMPAPYLEEIKGLPCSNKRRAKQFVNLEACKILHKYDELDSSLLPYNRFDNNLVIQESNDIEI-IKYEKYTATKLSTKFQNLSI-----------PANKLYLYSIKYTPSVFLKL---GINDISMFDVSTYLGILLPNPIHQNKDFMKFPIYLVGGMTSVEIKFEYNLPVNSINYSLLLKCHKILFNIYSERIR-RFDK----NIFFDPSKAKSSIILTILKDNKIDFNKIKEIITNPIVDNLIKNDQSSWVGSVIRPNYITNEFGAFVISKVCHDMNADSIF---KNDMTYEKFLNKKYNIILSPNEKLSPLIKVIRLTTIQSCVNKERRFL--RNNRKLQRINESECYFVPSLTECISLSSSLWTQLCIFPTIHHRMNQIL--------------------SIEDFAHDLEFMN--------LIENSDCFEINFD---DCYNIENIES------SIYDPNVLKFINN----IFPCFMAKTCNDRTNLEQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVVKNS----------------------DESVEVNNSREFILIKNKNLADCCEAIIGSILTNYGIDYSIQYLQWLNLPLVPDNELNADIEISPK--LAFQNISMDTDIPQS-----------INDLEKILNYHFKNKGYIVQAITHPSSIANR-KFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYLNYFDSKMFHILPKVVEELLNNQ 3889
            N   +  R YQ+E+  KA  +N+++ L TG+GKTFI+ +LIK        DY +    K+ FFLV    LV Q    +     L   +G + G+     VD W K++W K++  ++++VMTA++F+D+L H K  LS+V  ++FDE HH  K   Y+Q+  +          ++LGLTA ++ G      IE  ++ LE  L     TS D    ++     E    Y T    D+ A  K   E++  E   P D    ND    +  +    K  K  + E    L  LG      + + F+ D+ G  +        +   +L  + S  L+ +    ++Y       S + +   S K K L+ ++    + ++     +  ++F+  +     L   + +L + +KA  F+   +++GH    T+    K  MS  KQ ++L+ F+  +FN+LIAT+V+EEGLDV  CN+VV+FD P  F+SY+QSKGRARA++S YI+   + Q T A+++ +  I E L+ +   R I              P++++  + V      PY    G  +T+ ++ ++L +Y  KL  +  +     Y   +   +    +L +P+  P  E+I G P   K++AK     EACK LH+  ELD  L P     +N    E  D+E+ +  +  + TK   +     +           P ++ YLY        F K      +  S+ +    LGIL+ + +   + F  +P    G +T   I       +     SL+ + H     I SE +R  F++      +  P +  SS   T + + +IDF++ ++++       +   +      S+I P +   E   F+I ++C +++  S F       TYE++  K+Y  +     +  PLI V    ++   VN    FL  R   K +   + + +F+P L      S+ L  +    P+I HRM  +L                    S+E    DL  +         ++EN     +      D YN E  ES      S++  N   F+      +      K   D  +LE+ E+LGD+FLK   S YLF F  + D EGKLT+++   ISN  L+ ++T   L  Y   T  + K ++ PP   VK                         ES + + S +   I +K++AD  EA+IG+ L + G   ++ +L +L + ++PD E NA +  SP    +F     D  +P S           +   E+ +NY F+NK Y++QA+TH S   NR    CYQRLEFLGD+V+DF+VT  +   NK+L+PG++T+LR ALVNNN FA ++V+ G+HKYL     + F  +   V++L +++
Sbjct:   28 NQESLSARPYQVELLVKALEKNIVVCLGTGTGKTFISVLLIKELSHQIMKDYED--GGKRTFFLVNTVPLVAQQRKVIDQNTDLS--VGKYVGE---DGVDFWGKERWLKELKDHQVLVMTAQIFVDMLGHGKIQLSKVNLIVFDECHHAKKEHPYAQVMRYFTAYNRYDHPRVLGLTASIVNGKVKPHRIEQEIQTLERILRASCETSSDECVGKYATKPTEYAHPYSTRE--DVSAEEKQLQERLNQEVLFPWD-EFLND----VRDKSETMKISKSIVKECIETLEVLGASAANRVAEYFL-DVTGRFSRTRGLLSSEYSHWLMGYNSTQLRQVQKIYKTYKTELYGPSNNSVQHVSAKVKALVEILKQYGTGDK----KLCGIVFVQRRCTAAVLCEQITLLSQHDKALSFVKCEYVVGHGMVGTAASSAK-DMSCKKQDKVLEKFRNHEFNLLIATSVVEEGLDVPRCNLVVRFDFPMTFQSYVQSKGRARAKDSFYIILLPDGQDT-AELEMYQAIEEYLSHVCYDRRI--------------PTDEESTEAVDTDLLQPYRTRKGASVTMANSIALLCKYCSKLPGDRFTLINPDYKTVEVGKDAFQTTLTMPINCPIKEKIMGDPMPRKKQAKMAAAYEACKRLHQEGELDDHLFPIESLSDNE--SEDEDVEMGVAGQPKSGTKRKKQAYPRKVPDILKESLPTGPRDRCYLYG-------FTKAHNKATDSHSVEEEVLKLGILMTSELPPVRRFTLYPDE--GAVTISVIPIAKPQRLTDAQLSLIDQFHS---RISSEMLRNSFERQNLDGYYIVPLETSSS---TRMDEIRIDFDRAEKVLCQEETVRITCLEDVKSGDSIITPMHRPRE--RFIIEEICTNLSPMSAFPERSKAKTYEEYFRKEYPSLKRITRRAQPLILV---KSMPQRVN----FLVDRKKMKSKEKTKKDIHFIPELCTLEPFSAKLLLEARELPSILHRMTSLLLVMEMRKLIAEGCRVDVQQFSVEQNEEDLSTIGGDILTGNAMVENPVPQRLALSSKRDKYNNE-FESVSKNLDSLFSNNRTNFLQPDSALLLQALTTKGAGDAFDLERLEMLGDAFLKQAVSIYLFCFYTNKD-EGKLTRRKVSQISNLKLYKVSTAHHLPGYIQTTVLDRK-SWAPPCLQVKPQSTGKILQERFTSKKKAKKQKLDSESKQEDFSSQ--TISDKSVADSIEALIGAYLVSGGYKGALYFLDYLGIKVLPD-EDNAALSGSPSNYASFLTPPCDP-LPSSRPEDLENAALELQGFERRINYEFRNKIYLLQALTHASYAHNRLTPDCYQRLEFLGDAVLDFVVTECLYSRNKRLSPGELTDLRQALVNNNIFAKIAVEHGYHKYLKQTSPEWFKKIGDFVQKLEDDE 1378          

HSP 2 Score: 60.077 bits (144), Expect = 2.210e-116
Identity = 26/54 (48.15%), Postives = 36/54 (66.67%), Query Frame = 3
Query: 3939 KVLGDIFESIAGAIFVDSNYDLKAVWTVYKVFMEEPLKKFFNNIPRNKISMLHE 4100
            KVLGDIFES+AGA+F+DS  D+   W VY   M+  +  +  N+P N I ++HE
Sbjct: 1405 KVLGDIFESVAGAVFLDSGMDVVVTWKVYYRMMKPYIDYYSKNVPYNPIRLVHE 1458          
BLAST of Endoribonuclease Dicer vs. TrEMBL
Match: A0A131YTU7 (Endoribonuclease Dicer OS=Rhipicephalus appendiculatus OX=34631 PE=3 SV=1)

HSP 1 Score: 402.134 bits (1032), Expect = 1.065e-112
Identity = 395/1462 (27.02%), Postives = 664/1462 (45.42%), Query Frame = 2
Query:   47 RDYQIEIYNKAKNENVIIKLNTGSGKTFIASMLIKDYLNV------KSDKKIFFLVKNSSLVHQHTNSLKDYLFLKDEIGYFYGQMENSWVDNWTXXXXXXXXXXXXXXVMTAKVFLDILNHNKYNLSQVCYLIFDEVHHLTKSDDYSQISE--HVIRTTSDIKILGLTACLIKGVKHVKDIEFAVKQLEHKLNCKVIT--SMDNIAREFCGNIKETIINYETESFPDLVAIFKSAIEKIESFIPVDGHHSNDNSGSLNAEQNNFKTLKKYLSESFSVLSTLGLVPCKLITDMFIEDLH---GAVNNDSMFFDEKTKL-YLDEFLS-CLKFINSNIESYISKSD---MLMCSEKCKKLINLILDLKSKNEDFKN-----------TISILIFINEKIHVLALNVLLGILPKINKAFDFINSNFIIGHSTSQY--PKKLQMSVTKQXXXXXXXXXXXXXXXXATNVIEEGLDVSHCNIVVKFDPPQDFRSYLQSKGRARAQNSQYIVFTHETQKTEAQIQKFNLINEELNKILKSRVIEDELNKDDSERNVTPSEDDKY-DYVPYGENG-PRITLNSASSVLNRYLGKLRCNSISEPKIIY---TYFQDEFNFHHVSLLLPMPAPYLEEIKGLPCSNKRRAKQFVNLEACKILHKYDELDSSLLPYNRFDNNLVIQESNDIEIIKYEKYTATKLSTKFQN-------LSIPANKLYLYSIKYTPSVFLKLGINDISMF------------DVSTYLGILLPNPIHQNKDFMKFPIYLVGGMTSVEIKFEYNLPVNSINYSLLLKC-HKILFNIYSERIRRFDKNIF-FDPSKAKSSIILT-ILKDNKIDFNKIKEIITNPIVDNLI-------------KNDQSSWVGSVIRPNYITNEF--GAFVISKVCHDMNADSIFKNDMTYEKFLNKKYNIILSPNEKLSPLIKVIRLTTIQSCVNKERRFLRNNRKLQR--INESECYFVPSLTECISLSSSLWTQLCIFPTIHHRMNQILSIEDFAHDL------------------EFMNLIENSDCF-------EINFDDCY----NIENI------ESSIYDPNVLKFINNIFPCFM-----AKTCNDRTNLEQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVVKNSDESV------------------------EVNNS--------------------------REFILIKNKNLADCCEAIIGSILTNYGIDYSIQYLQWLNLPLVP---DNELNADIEISPKLAFQNI-SMDTDIPQSIND------------------LEKILNYHFKNKGYIVQAITHPSSIANRKFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYLNYFDSKMFHILPKVVE 3871
            R+YQ+E++  A  EN I+ L TG+GKTFIA MLIK+Y         +  K+ FFLV    LV Q   ++K    L+  +G + G M    VDNW K++W K+  + +++VMT  VF  I++H    +S+V  LI DE H   K   Y ++     V+      ++LGLTA +I        +E  V  LE  L+ +V+T  +  ++AR +     E ++ +++   P +  I    +    +F P               E +  + + + L     VL  +G+    L  ++ +E+       +N++S+  + +  L +LDE    C + I   IES  ++SD   + M + K K+L+ ++   + + E  +N           ++  +IF+ E+I    L   L  L      + +I + FI+GH  +     K+  MS  KQ  +L+ F+ ++ N+L+AT+V+EEG+DV  C++VV+FD P DFRSY+QSKGRARAQ S Y++ T      +A     N ++  +  IL ++  E +     SE  ++ + D+    Y+P  E+G PRITL+SA  ++NRY   L  +  +  K  Y   T   ++   +  ++ LPM +P  E I+G P   K+ AK    LE CK LH+ +E D+ LLP  R    L + + +D E  +     A K  TK +          + A    L +  Y   +     +N  S              D  T+  +LL   +        FPI+   G   V +     L   S      L+C H+    I+ + +R  ++ +  FD S A S  +L  ++KD  +       +I  P VD ++             K +   + G+V+ P Y    +    F + ++  D+  DSI     ++  +L+  +++ ++  +   P+++V+      + +    R  + ++ L++   N      VP   +   +S+S+W +    P+I +R+NQ+L +E+    +                  +F + +  S          E+ F +      ++E I       S  Y P  LK      P  +     +    D  +LE+ E+LGDSFLK+  +  LF  S     EG LTQ RS++I N+NL  L ++  +        F P  N+LPP ++V    E +                        E+ NS                          R+   + +K++AD  EAIIG+ L   G   +++ ++W+ L L     D + + D E +   AF    +  T + + I+D                   EK L Y F+++ +++QA TH S   NR   CYQRLEFLGD+VID+LVT Y+     K NPG++T+LRS+LVNN  FA L V+ G H+ L + +  +F+ + + V+
Sbjct:   35 REYQVELFEAAVKENTIVCLGTGTGKTFIAVMLIKEYEASIRIPFEEGGKRTFFLVPTVPLVVQQQKAIKCQTDLR--VGGYVGDMN---VDNWNKERWEKEFVESQVLVMTPDVFKVIIHHGFLKMSRVNLLILDECHRAVKQHTYREVMRCMDVLEPHERPRVLGLTASVINSKATEHQVERKVHDLEMALHSRVLTVSNQQSMAR-YGTKPVEVLVEHQSTGSPSICGI---EVPTFPTFRP---------------ETSQGQEMDRRLRSLTKVLQDMGVWCGHLAVEVIMEEARRMLDGLNDNSVLREVEVCLEWLDEVRQRCKRHI---IESNAAQSDEPLLAMATPKLKRLLQILWAFRPR-ERLQNGNDADAAEPPMSLCGIIFVKERIVARILRDWLRELANKIPRYAYIMAEFIVGHGANLQLGSKEAGMSFKKQCRVLEQFRRQECNLLVATSVVEEGMDVPKCSLVVRFDFPDDFRSYVQSKGRARAQRSLYVMMTSRDDYNKAAANLRNYLS--IEAILMNKCHERKAPL-TSEVVLSFAVDELLPPYMPVREDGAPRITLSSAIGLVNRYCMILPSDMFTHLKPTYQLSTVTVEDKEMYVCTIYLPMTSPLKEAIRGRPMETKKYAKMAAALETCKRLHQINEFDNCLLPVKRM---LKLLDDSDNEETEEVPPGAPKPGTKKRRRVYQKRVCRLFAEARVLEAGHYRLHILTTRLVNMASELQNWRNETLVDPEDCPTWFALLLREDM---PCLPSFPIFTRSGDEEVTV-VRAGLVSLSAGECCRLQCFHRA---IWDDVLRMKERPLLQFDLSSAPSCPVLAPVIKDGDVS------MIDWPFVDMVVNGINGKHATGTAYKFNPCDYEGAVVVPRYAPPHYHHSTFYVKEIRTDLTVDSI-DGKGSFRDYLSLIHHMHVT--DSTQPILEVVFTEVRLNLLTPRYRNRKGDKFLKKTATNRRAELRVPEFCDVHPVSASIWRKAVCLPSIVYRLNQLLVMEELRASIAAATGIGVKTFRGRWPSVDFQSAVSGSATISFSPAPNEVEFGNLLRGHGDVEEIRMPRLSRSFEYQPE-LKGNPGPSPGLLLEAVTSAKAADGFDLERLEVLGDSFLKYAVTIDLFCGSTSA-QEGLLTQTRSRIICNRNLHQLGSKMHVGSMITQEQFEPLRNWLPPGYLVPEGAEDIMMDVDFVFWVIREDTKILDKLNYKELCNSYEHYKDEMKRPEFVPPPRNTSGPVPIRQSSQLSDKSVADSVEAIIGAFLLVTGPIGALRVMKWMGLKLQQCNLDAQGSGDTESTAVPAFMGFPAPRTSLLRYIDDPEGHLVSPSSPWHAALCLAEKTLGYTFRDRSFLLQACTHASYYKNRLTDCYQRLEFLGDAVIDYLVTRYLYEGPHKFNPGQLTDLRSSLVNNTFFAALVVRHGLHRCLLHCNPGLFNAVARFVQ 1444          
BLAST of Endoribonuclease Dicer vs. TrEMBL
Match: H6WZT1 (Dicer-2 OS=Penaeus japonicus OX=27405 GN=Dcr2 PE=2 SV=1)

HSP 1 Score: 391.349 bits (1004), Expect = 2.843e-112
Identity = 388/1398 (27.75%), Postives = 659/1398 (47.14%), Query Frame = 2
Query:   47 RDYQIEIYNKAKNENVIIKLNTGSGKTFIASMLIKDYLNV------KSDKKIFFLVKNSSLVHQHTNSLKDYLFLKDEIGYFYGQMENSWVDNWTXXXXXXXXXXXXXXVMTAKVFLDILNHNKYNLSQVCYLIFDEVHHLTKSDDYSQISEHVIRTTSDIK---------ILGLTACLIKGVKHVKDIEFAVKQLEHKLNCKVITSMD-NIAREFCGNIKETIINYETESF-PDLVAIFKSAIEKIESFIPVDGHHSNDNSGSLNAEQNNFKTLKKYLSESFSVLSTLGLVPCKLITDMFIEDLHGAVNNDSMFFDEKTKLYLDEFLSCLKFINSNI-ESYISKSDMLMCSEKCKKLIN----LILDLKSKNEDFKNT---ISILIFINEKIHVLALNVLLGILPKINKAFDFINSNFIIG-HSTSQYPKKL-QMSVTKQXXXXXXXXXXXXXXXXATNVIEEGLDVSHCNIVVKFDPPQDFRSYLQSKGRARAQNSQYIVFTHETQKTEAQIQKFNLINEELNKILKSRVIEDELNKDDSERNVTPSE-------DDKY--DYVPYGENGPRITLNSASSVLNRYLGKLRCNSISE--PKIIYTYFQDEFNFHHVSLLLPMPAPYLEEIKGLPCSNKRRAKQFVNLEACKILHKYDELDSSLLPYNRFDNNLV-----IQESNDIEIIKYEKYTATKLSTKFQNLSIP-----ANKLYLYSIKYTPSVFLKLGINDISMFDVST---YLGILLPNPIHQNKDFMKFPIYLVGGMTSVEIKFEYNLPVNSINYSL---LLKCHKILFNIYSERIRRFDKNIF-FDPSKAKSSIILTILKDNK-IDFNKIKEIIT-NPIVDNLIKND-------QSSWVGSVIRPNYITNEFGAFVISKVCHDMNADSIFKNDM----TYEKFLNKKYNIILSPNEKLSPLIKVIRLTTIQSCVNKERRFLRNNRKLQRINESECY--FVPSLTECISLSSSLWTQLCIFPTIHHRMNQILSIEDFAHDLEFMNLIENSDCFEINFDDCYNIENIESSIYDPNVLKFINN-----IFP-----CFMAKTCNDRT--NLEQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVVKNS-DESV------------------EVNNSREFIL---------------------------IKNKNLADCCEAIIGSILTNYGIDYSIQYLQWLNLPLVPDNELNADIE-ISPKLAFQNISMDTDI---PQSINDLEKILNYHFKNKGYIVQAITHPSSIANRKFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYLNYFDSKM 3844
            R YQ+E++N A  +N I+ L TGSGKTFI+ +LIK+  +          K+  F+V    LVHQ   +++ +     E+G + G M    VD WT + W  ++ K++++V+ A++FLD++ H K  LS V  LI DE HH T S    +I    +R   ++K         I+GLTAC++      +++   ++ LE  ++C ++TS+D     ++    KE +I + TES   D     K+ +  +E  I  D          +N +    K +KK +     ++S LG           IE L      + M  D K +         LK ++  + E Y++      C  K K + N    +   +KS  E F      +  LIF+  +     L  LL  + K N  F F+  ++++G +S      +L ++ + KQ E L+ F+  + N LI+T+V+EEG+D+  CN+VV+FD PQ++R+Y+QS+GRARA+ S Y++   E +           ++E L  I   + IED L      RN+  ++       +D+Y   Y PYG  GP+IT NSA  ++N Y GK   +  ++  P+++    +       V + LP+ AP  + I G   +NK  AK+   L+ C  LH+  ELDS+L P    D++LV     +     +     E  T  +     ++L  P          LYSI   P  F + G  +    D ST    +G +    +  +     FP++       V +      P+  ++ SL   + K H+++F    E I   ++N+  FDP K+K  + +  L  ++ ID N + EI + + I   +IK+        +S +  ++I P Y       + +S +  ++N  + F   +    +YE++  ++Y + L   +K  PL++          + KE  +L+   K  R  +      FVP     I + +SLW Q+   P+I HR+N    + +F    +  +    ++  + ++   +  E + SS  +  V +F++      I P      F  K  ++    NLE+ E+LGDSFLKF+T + LF   +++ +EG+L+Q R + + NK LF LA QKGL+        NPK N   P F +K   +ES+                  +V + +E +                            + +K++ADC EAIIG+ L   G + +  +L WL + +  DN L  + + +      +  + D  I      ++ LEK + Y F+++ +IVQA+TH S + N+   CYQRLEFLGD+V+D+LVT +I       +PG++++LRS  V N+T    + K   H++L + + K+
Sbjct:   15 RSYQLELFNCALKKNSILVLGTGSGKTFISILLIKELGHQIRESLKGGSKRTVFVVNTVPLVHQQAAAIQQHTPF--EVGKYEGSM---GVDYWTDEHWQNELEKHEVLVVVAQIFLDLILHAKLPLSSVNLLIMDECHHATGSHPMREI----MRAYENLKQHSPEKLPRIMGLTACVVHRKCKRREVLKYMESLEAAMDCALVTSVDPETVLKYTTGPKEKVICFYTESITSDYQETVKAQLAGLECDIITDCF--------INYKAR--KQIKKKVKNIEHIMSDLGDWCVARAIKYEIEHLD---ETEGMEEDPKIR-------EILKLLSEKLREVYVA------CELKEKGMANPVEHITFKVKSLLEIFSKCNKEVFGLIFVESRNTAKILYDLLLEIAKQNPEFSFVKPSYVVGCNSRPGIDIRLAELELRKQRETLENFRRGETNFLISTSVLEEGVDIRKCNVVVRFDMPQNYRAYVQSRGRARAKPSVYLLMVEEAK-----------VSEMLECIGVYKEIEDSLQYLCHGRNLPTAQTTRKHFAEDEYIKPYEPYGPVGPKITSNSAIQLVNLYCGKFPSDKFTDNLPEVVEEVKE---GMTTVGIRLPIMAPLKDMIYGSGWANKDLAKKSAALQLCIKLHEMGELDSNLRPKESNDDSLVEGLVDLPPEEPVPEGTSESGTRKRRRVHAKDLCYPFSNEHGGSYCLYSIDIKP--FGQSG--ESVTIDSSTCISKIGFICKEGLVSS----PFPLFF-SKWGDVMVNVREVGPLTDLDTSLFDKIKKFHRLVF----ENIIELNENLMSFDPEKSKWDVFIVPLDFSEIIDLNMLNEIYSFDSIKPVMIKSHNQNTKFVRSKFEDALIYPQYGIPSNQMYYVSHIFDELNPCNTFPEGLKGYESYERYFLERYGLEL--KDKNQPLLEAKH-------IPKELNYLKKIPKKAREKKGNLVPRFVPEFCGLIPIKASLWWQIMCMPSIFHRLNSFNLMHEFIVKTKITSPAIKNEVLDFSWTKKFIYELLGSS--ENTVPRFLDRKKQEYIHPFSMLHAFTLKEASEDKEFNLERLELLGDSFLKFVTGEALF-LRDESYHEGRLSQSRGKRVCNKTLFRLACQKGLEGKIAAKVLNPKKNGSIPGFRIKPEFEESLRSLEVPHDFWHQVPNTVKDVGDLKEAVFALMSDDASKDEKAEKKGSCYNPWTEHEVSDKSIADCVEAIIGAYLRVCGNEAAAAFLHWLGVGVFRDNSLLMEPKTVRTARVRKECAQDLTIFYKKAVLDRLEKKIGYTFRDRSFIVQAVTHSSYVNNQVTDCYQRLEFLGDAVLDYLVTCHIFCRFTDYSPGQLSDLRSYFVKNDTLGRAAAKGKLHQHLLHINPKL 1338          

HSP 2 Score: 47.3654 bits (111), Expect = 2.843e-112
Identity = 24/62 (38.71%), Postives = 34/62 (54.84%), Query Frame = 3
Query: 3933 VVKVLGDIFESIAGAIFVDSNYDLKAVWTVYKVFMEEPLKKFFNNIPRNKISMLHEKYPQMK 4118
            + K LGD+ E+I GA+++DSN  LK  W V +  +E+ L      I  N I  L E+ P  K
Sbjct: 1372 IPKALGDMVEAIIGAVYLDSNRSLKVAWQVIERILEDLLNTSIQTIQLNPIRQLLEEVPGEK 1433          
BLAST of Endoribonuclease Dicer vs. TrEMBL
Match: R9R7R6 (Dicer 2 OS=Penaeus monodon OX=6687 PE=2 SV=1)

HSP 1 Score: 394.815 bits (1013), Expect = 3.740e-112
Identity = 388/1394 (27.83%), Postives = 659/1394 (47.27%), Query Frame = 2
Query:   47 RDYQIEIYNKAKNENVIIKLNTGSGKTFIASMLIKDYLNV------KSDKKIFFLVKNSSLVHQHTNSLKDYLFLKDEIGYFYGQMENSWVDNWTXXXXXXXXXXXXXXVMTAKVFLDILNHNKYNLSQVCYLIFDEVHHLTKSDDYSQIS---EHVIRTTSD--IKILGLTACLIKGVKHVKDIEFAVKQLEHKLNCKVITSMDNIA-REFCGNIKETIINYETESF-PDLVAIFKSAIEKIESFIPVDGHHSNDNSGSLNAEQNNFKTLKKYLSESFSVLSTLGLVPCKLITDMFIEDLHGAVNNDSMFFDEKTKLYLDEFLSCLK------FINSNIESYISKSDMLMCSEKCKKLINLILDLKSKNEDFKNTISILIFINEKIHVLALNVLLGILPKINKAFDFINSNFIIG-HSTSQYPKKL-QMSVTKQXXXXXXXXXXXXXXXXATNVIEEGLDVSHCNIVVKFDPPQDFRSYLQSKGRARAQNSQYIVFTHETQKTEAQIQKFNLINEELNKILKSRVIEDELNKDDSERNVTPS-------EDDKY--DYVPYGENGPRITLNSASSVLNRYLGKLRCNSISE--PKIIYTYFQDEFNFHHVSLLLPMPAPYLEEIKGLPCSNKRRAKQFVNLEACKILHKYDELDSSLLPYNRFDNNL------------VIQESNDIEIIKYEKYTATKLSTKFQNLSIPANKLYLYSIKYTPSVFLKLGINDISM----FDVSTYLGI-----LLPNPIHQNKDFMKFPIYLVGGMTSVEIKFEYNLPVNSINYSLLLKCHKILFNIYSERIRRFDKNIFFDPSKAKSSIILTILKDNK-IDFNKIKEIIT----NPIV----DNLIKNDQSSWVGSVIRPNYITNEFGAFVISKVCHDMNADSIF----KNDMTYEKFLNKKYNIILSPNEKLSPLIKVIRLTTIQSCVNKERRFLRNNRKLQRINESECY--FVPSLTECISLSSSLWTQLCIFPTIHHRMNQILSIEDFAHDLEFMNLIENSDCFEINFDDCYNIENIESS------IYDPNVLKFIN--NIFPCFMAKTCNDRT--NLEQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVVKNS-DESVE------------------VNNSREFIL---------------------------IKNKNLADCCEAIIGSILTNYGIDYSIQYLQWLNLPLVPDNELNADIE-ISPKLAFQNISMDTDI---PQSINDLEKILNYHFKNKGYIVQAITHPSSIANRKFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYLNYFDSKM 3844
            R YQ+E++N A  +N I+ L TGSGKTFI+ +LIK+  +          K+  F+V    LVHQ   +++ +     E+G + G M    VD WT + W  ++ K++++V+ A++FLD++ H +  LS V  LI DE HH T S    +I    E + + + D   +I+GLTAC++      KD+   ++ LE  ++C ++TS+D +   ++    KE +I Y TE+   D     K+ +  +E  I  D              +   K +KK +     ++S LG           IE L      + M  D K +    E L  LK      +I   ++     + +   + K K+L+ +    K   E F      LIF+  +     L  LL  + + N  F F+  ++++G +S      +L ++ + KQ E L+ F++++ N LI+T+V+EEG+D+  CN+VV+FD PQ++R+Y+QS+GRARA+ S Y++   E +           ++E L  I   R IE  L     +RN+  +       E+D+Y   Y PYG  GP+IT NSA  ++N Y GKL  +  ++  P+++    +       V + LP+ AP  + I G   +NK  AK+   L+ C  LH+  ELDS+L P    D++L            V + + +    K ++  A +L   F N  +      LYSI   P      G  D S+    F     +G      LL +P         FP++       V +  +   P+  ++ SL  K  K    ++   I   +  I FDP ++K  + +  L  ++ ID + + EI +     P++    +   K  +S +   +I P Y       + +S++  ++N  + F    K   +YE++  ++Y   L   +K  PL++          + KE  +L+   K  +  +      FVP     I + +SLW Q+   P+I HR+N +  + +F  + +  +    +   + ++   +  E + SS        D    ++I+  N+   F  K  ++    NLE+ E+LGDSFLKF+T + LF   +++ +EG+L+Q R +L+ NK LF LA Q+GL+       FNPK N   P F+VK   +ES+                   V + +E +                            + +K++ADC EAIIG+ L   G + +  +L WL + +  DN L  + + I      +  + D +I      ++ LEK + Y F+++ +IVQA+TH S + N+   CYQRLEFLGD+V+D+LVT +I       +PG++++LRS  V N+T    + K   H++L + + K+
Sbjct:   15 RSYQLELFNCALKKNSILVLGTGSGKTFISILLIKELGHQIRESLKGGSKRTVFVVNTVPLVHQQAAAIQQHTPF--EVGKYEGSM---GVDYWTDEHWQNELEKHEVLVVVAQIFLDLILHARLPLSSVNLLIMDECHHTTGSHPMREIMRAYETLKQHSPDKLPRIMGLTACVVHRKCKRKDVLKYMESLEAAMDCALVTSIDPVTVLKYTTGPKEKLICYFTENITSDYQETVKAQLAGLECDIITDCF----------INEKARKQIKKKVKNIEHIMSDLGDWCVARAIKYEIEHLD---ETEGMEEDPKVR----EILKLLKERLRDVYIACELKEKCMSNPLEHITFKVKRLLEIFS--KCNKEVFG-----LIFVERRNTAKILYDLLLEIAQQNPVFSFVRPSYVVGCNSRPGIDIRLAELELRKQKETLEKFRKEETNFLISTSVLEEGVDIRKCNVVVRFDIPQNYRAYVQSRGRARAKPSVYLLMVEEAK-----------VSEMLECIGVYREIEASLQYLCHDRNLPTAQVTRKHFEEDEYIKPYEPYGPVGPKITSNSAIQLVNLYCGKLPSDKFTDNLPEVVEEVKE---GIVTVGIRLPIMAPLKDMIYGSGWANKDLAKKSAALQLCIKLHEMGELDSNLRPKESSDDSLVEGLVDLPPEEPVPEGTPESGTRKRKRIYAKELCYPFSN--VHRRSYCLYSINIKP-----FGQTDQSVTIDSFTCINKIGFICKEGLLCSP---------FPLFF-SKWGDVMVNVKEVGPLTDLDTSLFDKIKKFHRLVFENLIELKENLINFDPEESKWDVFVVPLDFSEIIDLDLLNEIYSLDSIKPVMMRSHNQSTKFVRSKFEDGLIYPLYGIPSDQMYYVSQIFDELNPCNTFPEGKKGYESYERYFLERYG--LEIKDKNQPLLEAKH-------IPKELNYLKRIPKKAKEKKGNLVPRFVPEFCGIIPIRASLWWQIMCMPSIFHRLNSLNLMHEFIMETKITSPAVKNKVLDFSWTRKFIHELLGSSENAVPIFLDRKKQEYIHPFNMLHAFTLKEASEDKDFNLERLELLGDSFLKFVTGEALF-LRDESYHEGRLSQSRGKLVCNKTLFRLACQRGLEGKIAAKVFNPKRNGHIPGFIVKAEFEESLRSHEVPHDIWHQVPNTVKNVGDLKEAVYDLMSDDASKDDKAEKKGSCYNPWTEHEVSDKSIADCVEAIIGAYLLVCGNEAATSFLDWLGVGVFKDNSLLMEPKTIRTAYVCKEHAQDLNIFYKKAVLDRLEKKIGYTFRDRSFIVQAVTHSSYVNNQVTDCYQRLEFLGDAVLDYLVTCHIFCRFTDYSPGQLSDLRSYFVKNDTLGLAAAKGKLHQHLLHLNPKL 1338          

HSP 2 Score: 43.1282 bits (100), Expect = 3.740e-112
Identity = 22/62 (35.48%), Postives = 33/62 (53.23%), Query Frame = 3
Query: 3933 VVKVLGDIFESIAGAIFVDSNYDLKAVWTVYKVFMEEPLKKFFNNIPRNKISMLHEKYPQMK 4118
            + K LGD+ E+I GA+++DSN  LK  W V +  + + L      I  N +  L E+ P  K
Sbjct: 1372 IPKALGDMVEAIIGAVYLDSNRSLKVAWQVIERILGDLLNTPIQAIQLNPVRQLLEEVPGEK 1433          
BLAST of Endoribonuclease Dicer vs. TrEMBL
Match: U3MHS9 (Dicer 1 OS=Nematostella vectensis OX=45351 PE=2 SV=1)

HSP 1 Score: 371.318 bits (952), Expect = 2.470e-110
Identity = 370/1408 (26.28%), Postives = 638/1408 (45.31%), Query Frame = 2
Query:   38 MKTRDYQIEIYNKAKNENVIIKLNTGSGKTFIASMLIKDY-LNVK-----SDKKIFFLVKNSSLVHQHTNSLKDYLFLKDEIGYFYGQMENSWVDNWTXXXXXXXXXXXXXXVMTAKVFLDILNHNKYNLSQVCYLIFDEVHHLTKSDDYSQISEHVIRTTSDIKILGLTACLIKGVKHVKDIEFAVKQLEHKLNCKVITSMDNIAREFCGNIKETIINY---ETESFPDLVAIF-KSAIEKIESFIPVDGHHSNDNSGSLNAEQNNFKTLKKYLSESFSVLSTLGLVPCKLITDMFIEDL---HGAV--NNDSMFFDEKTKLYLDEFLSCLKFINSNIESYISKSDMLMCSEKCKKLINLILDLKSKNEDFKN-TISILIFINEKIHVLALNVLLGILPKINKAFDFINSNFIIGHSTSQY--PKKLQMSVTKQXXXXXXXXXXXXXXXXATNVIEEGLDVSHCNIVVKFDPPQDFRSYLQSKGRARAQNSQYIVFTHETQKTEA--QIQKFNLINEELNKILKSRVIEDELNKDDSERNVTPSEDDKYDYVPYGEN-GPRITLNSASSVLNRYLGKLRCNSISE--PKIIYTYFQDEFNFHHVSLLLPMPAPYLEEIKGLPCSNKRRAKQFVNLEACKILHKYDELDSSLLPYNRF-DNNLVIQESND--------IEIIKYEKYTATKLSTKFQNLSIPANKLYLYSIKYTPSVFLKLGINDISMFDVSTYLGILLPNPIHQNKDFMKFPIYLVGGMTSVEIKFEYNLPVNSI-----------NYSLLLKCHKILFNIYSERIRRFDKNIFFDPSKAKSSIILTILKDNKIDFNKIK-EIITNPIVDNLIKNDQSSWVGSVIRPNYITNEFGAFVISKVCHDMNADSIFKND---MTYEKFLNKKYNIILSPNEKLSPLIKVIRLTTIQSCVNKER-RFLRNNRKLQRINESE-CYFVPSLTECISLSSSLWTQLCIFPTIHHRMNQILSIEDFAHDLEFMNLIENSDCFEINFDDCYNIENIESSIYD------------PNVLKF------INNIFPCFMAKTCNDRT-----------------------NLEQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNF-------------------------VVKNSDESVEVN------NSREFIL---IKNKNLADCCEAIIGSILTNYGIDYSIQYLQWLNLPLVPDNELNADIEISPKLAFQ-------NISMDTDIPQ-------SINDLEKILNYHFKNKGYIVQAITHPSSIANRKFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYLNYFDSKMF 3847
            +  R YQ E+   A  +N+I+ L TG+GKTFI+ MLIK+    V+       K+ FFLV    L  Q    +     LK  +  F G M    VD W+ ++W K++   +++VMTA++FLD+L H +  LS V  ++FDE HH  K   Y QI  +    +   +ILGLTA +I   K    +E  + +LE  +     TS D    +F    +E I  Y   +TE   DL  +  ++ +   + F+       +D   S   ++   K +K  +S+   +L  +G      + + F++DL    G V  N+D ++  +     L  F   +  +++       + D+     K K L+ ++    +      + ++  ++F+  +     L   L I+   + + +FI  +F++GH  S        QM  TKQ ++LK+F++ + N+L+AT+V+EEGLDV  CN VV+FD PQ+FRSY+QSKGRARA+NS +IV   +     A  +++++      L +  + R +        +      + +D+Y   PY  + G R+T  ++ S L  Y  KL  +  +   P+II    +  F     +L+LP+  P  + I+G+    K  ++Q    EACK LH+  ELD +L P     + +    ES D            +   Y         ++L       + YSI        +  +   ++++    +GI+L  P+       +F ++L  G   V IK   + P  S+           +  LL +  ++   + ++++  +   +  D   A   I L  ++D +    KI   I     +D+L   D      ++I P +   +   +V+ +VC ++N  S F +     TY ++  K Y+  ++  +   PL++V  ++        ER  FL N +K  R   +   +F+P L    ++ +SL +   I P++ HRM   L   +    ++  + + +  C   N      I  + +S+              P V  +         I     A   N+RT                       +LE+ E+LGD+FLK   S +L+    D D EGKLT++++  +SN+ L+ +A + GL +Y   T  + + ++  P+                            +  +   E++       +R+  L   I +K++AD  EA+IG+ LT  G   ++ +L WL + ++P++ ++ D    P+ + +        I+     PQ        +   E  + Y F NK Y++QA+TH S   NR   CYQRLEFLGD+++DFLVT  I   N  L+PG++T+LR ALVNNN FA ++VK GF+K L     + F
Sbjct:   23 LTPRPYQSELVRIALEKNIIVCLGTGTGKTFISVMLIKELSFQVRKSRKEGGKRTFFLVNTVPLAKQQKEVIAKNTDLK--VKEFIGDM---GVDFWSDEQWKKELDDNQVLVMTAQIFLDLLGHARLRLSDVNLIVFDECHHARKGHPYKQIMGY-FEESDYPRILGLTASII-NTKETHKMEQLICELEATMRAACQTSDDITVSQFATRPEEIIYPYSNDKTEVEQDLNQLLVETVLNPWQEFV-------DDLRAS--GQKEVLKGVKSLISDCRQILDEMGASAANRVAEYFLKDLERVQGLVVANDDVIWLYQYCATQLRRFRE-IYSVHTIAHEVSEEDDLTHLLPKAKALVEILKQYGNPQASTPDISLCGIVFVERRYTAKILCEQLNIIATRDPSLEFIKCDFVVGHGASGINSSSDTQMGSTKQEKVLKMFRKHQINLLVATSVVEEGLDVPKCNFVVRFDFPQNFRSYVQSKGRARAKNSAFIVLVEDKDSEWAGLEVERYQETENYLQEKCQGRPLP-------TSEECEQANEDQY-LQPYVTSLGARLTQRNSLSFLLSYCSKLPGDQYTRLMPEIITEEVEGAF---RSTLMLPINCPLRDTIEGIVMPRKMLSRQAAAYEACKRLHQMGELDDNLRPVVSLSEESDEGTESEDDGKSKGKTGTKKRRRCYNRKIPDVLKESLPTAGAAYWFYSIDIKSPETRRAPVELGTLWN----MGIMLRKPLPA---IRRFQLFLDSGPVIVSIKPCDSTPTPSVPGFHLRIIEAFSRCLLSRALRMPLEVTADKLHGY-HVVLLD--SACKGIDLARMRDVERQMEKIDLPIRDQDALDSLASGD------TIITPKHREKQ-QRYVLERVCPELNPTSPFPDRSKARTYAEYYEKTYDCHIT--DMHQPLLQVRNMS--------ERINFLVNRKKQSRKKSNHVVHFIPELCSHDAIPASLLSNAQILPSVLHRMTSFLLAVELREKIKSKSDVIDEACAPEN--TLSVIGGVPASVIGRSLSPLRKKRSPPRVRSYDLFDKEFQEISQSLQAMFSNERTVLLHPDSELLLQALTTKSAGDAFDLERLEMLGDAFLKQAVSIFLYCCYKDGD-EGKLTKRKTSQLSNRALYRVACRLGLPEYLQNTQLD-RVSWTTPSLQAAEVEPVGSPGKSQKTASNKRCQSASRQPENRPEMSTLEKPETARDKALHQSIPDKSVADSVEALIGAYLTTCGYQGALHFLDWLGVKVLPESPMSTD---GPRASSKYSIFTRPTITEYNSNPQVLKRFAVQLQGFENRIGYEFSNKLYLIQALTHASYSQNRLTDCYQRLEFLGDALLDFLVTELIYSRNTNLDPGELTDLRQALVNNNIFAEIAVKHGFNKSLFQMSPEWF 1368          

HSP 2 Score: 60.8474 bits (146), Expect = 2.470e-110
Identity = 31/83 (37.35%), Postives = 46/83 (55.42%), Query Frame = 3
Query: 3939 KVLGDIFESIAGAIFVDSNYDLKAVWTVYKVFMEEPLKKFFNNIPRNKISMLHEKYPQMKCTFENQEFSNLIKLTAILPNGSV 4187
            KVLGDIFES+AGAIF+DS  DL   W VY   ++  +  +  ++P+N + ++HEK           +   L     +LP+G V
Sbjct: 1408 KVLGDIFESVAGAIFLDSGMDLVLTWRVYYRMLKPYIDAYSADVPKNPVRLIHEK-----------DADALFSEAKVLPSGKV 1479          
BLAST of Endoribonuclease Dicer vs. Ensembl Cavefish
Match: dicer1 (dicer 1, ribonuclease III [Source:NCBI gene;Acc:103033221])

HSP 1 Score: 226.868 bits (577), Expect = 2.562e-59
Identity = 269/1058 (25.43%), Postives = 480/1058 (45.37%), Query Frame = 2
Query:   47 RDYQIEIYNKAKNENVIIKLNTGSGKTFIASMLIKD---YLNVKSDKKIFFLVKNSSLVHQHTNSLKDYLFLKDEIGYFYGQMENSWVDNWTXXXXXXXXXXXXXXVMTAKVFLDILNHNKYNLSQVCYLIFDEVHHLTKSDDYSQISEHVIRTTSDIKILGLTACLIKGVKHVKDIEFAVKQLEHKLNCKVITSMDNIARE-FCGNIKETIINYETESFPDLVAIFKSAIEKIESFIPVDGHHSNDNSGSLNAEQNNFKTL-KKYLSESFSVLSTLGLVPCKLITDMFIEDLHGAVNNDSMFFDEKTKLYLDEFLSCLKFINSNIESYISKS--DMLMCSEKCKKLINLILDLKS--------------KNED------------------------------FKNTISILIFINEKIHVLALNVLLGILPKINKAFDFINSNFIIGHSTSQ-YPKKLQMSV--TKQXXXXXXXXXXXXXXXXATNVIEEGLDVSHCNIVVKFDPPQDFRSYLQSKGRARAQNSQYIVFTHE--TQKTEAQIQKFNLINEEL-NKILKSRVIED-ELNKDDSERNVTPSEDDKYDYVPYGENGPRITLNSASSVLNRYLGKLRCNSISEPKIIYTYFQDEFNFHHVSLLLPMPAPYLEEIKG--LPCSNKRRAKQFVNLEACKILHKYDELDSSLLPYNR--------------FDNNLVIQESNDIEIIKYEKYTATKLSTKFQNLSIPANKLYLYSIKYTPSVFL--KLGINDISMF---DVSTYLGILLPNPIHQNKDFMKFPIYLVGGMTSVEIKFE-YNLPVNSINYSLLLKCHKILFNIYSERIRRFDKNIF-FDPSKAKSS---IILTILKDNK---IDFNKIKEIITNPIVDNLIKNDQ-----------SSWVGSVIRPNYIT-NEFGAFVISKVCHDMNADSIFKND--MTYEKFLNKKYNIILSPNEKLSPLIKV------IRLTTIQSCVNKERRFLRNNRKLQRINESECY-----FVPSLTECISLSSSLWTQLCIFPTIHHRMNQILSIEDF 2884
            R YQ+E+   A   N I+ LNTGSGKTFIA +LIK+    +   + ++  FLV  +S V Q  ++++ +  L+       G+  +S   +W ++KW + I + +++VMT  +FL  L      LS +  L+FDE H       Y  I +         +ILGLTA ++ G     D+E  ++ LE  L     T+ D +  + +    +E +++     + D   + ++ + +++  +    H  ND + S++ E  +   + K+ L++  +VL+ LG         + + +L   + ++    + K  L+ D   + L+ +++  E + S +  D+   + K  KL+ ++ + K               +N+D                              F N +  +IF+  +   + LN L+    K +    +I+SNFI GHS  +  P+  QM V   KQ E+L+ F+  + N+LIAT+++EEG+D+  CN+VV+FD P ++RSY+QSKGRARA  S YI+      T+  E  ++ +  I + L NK  KS    D E++    + N+ P    + D     + GPR+T+N+A   +NRY  +L  +  +         + + + +  +L LP+ +P  E IKG  +PC+  R A++ V L  C+ LHK  ELD  L+P  +               + N+  +  +      Y K     L   +    +P    YLY I    +  L  +L      ++   D +   GIL   PI +      FP+Y   G  ++ I+ +     +++    L+ + H+ +F+     I R +K    F P++A S+   + L I+ D+    +DF K  E I        I N Q             +  +VI P Y   ++   F ++ V  D+   S F +    T+ ++   KYN+ LS   +  PL+ V      + L T +  +N++ + L  +   +R  + E        VP L     + +SLW +    P+I +R++ +L+ E+ 
Sbjct:   35 RKYQVELLEAALEHNTIVCLNTGSGKTFIAVLLIKELSHQIRRGNGRRTVFLVNAASSVVQQASTVRTHSDLQ------VGEYTDS-CTSWLEEKWRQDIMENQVLVMTCHIFLHALRSGVLCLSTINLLVFDECHLAITDHPYRDIMKKCEDYRGCPRILGLTASILNGKCDPSDLEEKIQNLERILKSNAETATDLVVLDRYASQPREVVLD--CGPYQDKSGLSETLLNELDEAL----HFLNDCNLSVHREDRDPTYISKQVLNDCRAVLTVLGPWCADKAAGIMVRELQKYIKHEQEELNRKFLLFTD---TILRKLHALCEEHFSPASLDLKFVTPKVIKLLEILHEYKPFERQQFESVEWYNNRNQDNYVSWSDSEDDDDDEEVEVKEKPEANFPSPFTNILCGIIFVERRYTAVVLNRLIKEAGKQDPELAYISSNFITGHSIGKNQPRNKQMEVEFRKQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLVVRFDLPTEYRSYVQSKGRARAPVSNYIMLADSECTKAFEEDLKTYKAIEKILRNKCSKSAECNDYEVDSVLDDDNILPPYVLRTD-----DGGPRVTINTAIGHINRYCARLPSDPFTHLAPKCKTAELKASVYQSTLFLPINSPLREPIKGPLMPCA--RLAEKAVALHCCEKLHKIGELDDHLMPVGKETVKYEEELDLHEEEETNVPGRPGSTKRRQCYPKAIPECLRGSY---PVPEQSYYLYVIGMVLTTPLPDELNFRRRKLYPPEDTTRCFGILTAKPIPR---IPHFPVYTRSGEVTISIELQKSGFSLSAAQLELITRLHQYIFS----HILRLEKPALEFRPTEADSAYCVLPLNIVGDSSTLDMDF-KFMEDIEKSEARIGIPNTQYTKQNPFTFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLSNVNQ--PLLDVDHTSSRLNLLTPRH-LNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLHCLLTAEEL 1055          

HSP 2 Score: 130.183 bits (326), Expect = 2.400e-41
Identity = 75/205 (36.59%), Postives = 120/205 (58.54%), Query Frame = 2
Query: 3344 IKNKNLADCCEAIIGSILTNYGIDYSIQYLQWLNLPLVPDN------------ELNAD-----IEISPKLAFQNISMDTDIPQSIN---DLEKILNYHFKNKGYIVQAITHPSSIANRKFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYLNYFDSKMFHILPKVVE-ELLNNQLQ 3895
            I +K++ADC EA++G  LT+ G   +  +L  L L ++P              E  AD     ++I P+  F +   +  +   I+   + EK +NY FKNK Y++QA TH S   N    CYQRLEFLGD+++D+L+T ++  + ++ +PG +T+LRSALVNN  FA L+VK+ +HKY      ++FH++   V+ +L  N++Q
Sbjct: 1527 IADKSIADCVEALLGCYLTSCGERAAQMFLCSLGLKVLPVEKRSRKKVEEAACEGPADPQYGWLKIPPRCMFDHPDAERTLNHLISGFENFEKKINYTFKNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVQFQLEKNEMQ 1731          

HSP 3 Score: 60.8474 bits (146), Expect = 2.400e-41
Identity = 28/60 (46.67%), Postives = 39/60 (65.00%), Query Frame = 3
Query: 3933 VVKVLGDIFESIAGAIFVDSNYDLKAVWTVYKVFMEEPLKKFFNNIPRNKISMLHEKYPQ 4112
            V K +GDIFES+AGAI++DS   L+ VW VY   M   ++KF  N+PR+ +  L E  P+
Sbjct: 1752 VPKAMGDIFESLAGAIYMDSKMSLETVWQVYYPMMRPLIEKFSANVPRSPVRELLEMEPE 1811          

HSP 4 Score: 73.9442 bits (180), Expect = 1.372e-12
Identity = 39/96 (40.62%), Postives = 57/96 (59.38%), Query Frame = 2
Query: 3047 NDRTNLEQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVVKNSDESVEVNNSRE 3334
            +D  NLE+ E+LGDSFLK   + YLF    D  +EG+L+  RS+ +SN NL+ L  +KGL      + F+P  N+LPP +VV      ++  +S E
Sbjct: 1276 SDGFNLERLEMLGDSFLKHAITTYLFCTYPDA-HEGRLSYMRSKKVSNCNLYRLGKKKGLPSRMVVSIFDPPVNWLPPGYVVNQDKRGMDKWDSDE 1370          
BLAST of Endoribonuclease Dicer vs. Ensembl Cavefish
Match: drosha (drosha ribonuclease III [Source:NCBI gene;Acc:103043153])

HSP 1 Score: 82.4185 bits (202), Expect = 3.436e-15
Identity = 66/265 (24.91%), Postives = 126/265 (47.55%), Query Frame = 2
Query: 3065 EQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVVKNSDESVEVNNSREFILIKNKNLADCCEAIIGSILTNYGID----------YSIQYLQ--WLNLPLVPDNELNADIEISPKLAFQNISMDTDIPQSINDLEKILNYHFKNKGYIVQAITHPSSIANR-KFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKY 3820
            E+ E LGD+ ++F+TS +L++     + EG L   R+ ++ N++L  LA +  LD++  Y +         P+ + + SD                  +A+C EA+IG++    G+           ++ + L+  WLN P  P       +++   L  + +   + + Q + D E+ +   F +   + +A T  +   N       QR+EFLGDS++  + T Y+ ++    + G +T LRS+LVNN T A ++ + G  ++
Sbjct:  907 ERLEFLGDAVVEFLTSVHLYYLFPSLE-EGGLATYRTAIVQNQHLAMLAKKLELDRFMLYAHG--------PD-LCRESD--------------LRHAMANCFEALIGAVYLEGGLQEAKLLFGRLLFNTEDLREVWLNYPPHP-------LQVQEPLTDRQLIETSPVLQKLTDFEEAIGVLFTHVRLLARAFTLRTVGFNHLTLGHNQRMEFLGDSIMQLVATEYLFIHFPDHHEGHLTLLRSSLVNNRTQAKVAEELGMQEF 1140          
BLAST of Endoribonuclease Dicer vs. Ensembl Cavefish
Match: drosha (drosha ribonuclease III [Source:NCBI gene;Acc:103043153])

HSP 1 Score: 82.4185 bits (202), Expect = 3.524e-15
Identity = 67/265 (25.28%), Postives = 125/265 (47.17%), Query Frame = 2
Query: 3065 EQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVVKNSDESVEVNNSREFILIKNKNLADCCEAIIGSILTNYGID----------YSIQYLQ--WLNLPLVPDNELNADIEISPKLAFQNISMDTDIPQSINDLEKILNYHFKNKGYIVQAITHPSSIANR-KFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKY 3820
            E+ E LGD+ ++F+TS +L++     + EG L   R+ ++ N++L  LA +  LD++  Y +         P+               RE  L     +A+C EA+IG++    G+           ++ + L+  WLN P  P       +++   L  + +   + + Q + D E+ +   F +   + +A T  +   N       QR+EFLGDS++  + T Y+ ++    + G +T LRS+LVNN T A ++ + G  ++
Sbjct:  878 ERLEFLGDAVVEFLTSVHLYYLFPSLE-EGGLATYRTAIVQNQHLAMLAKKLELDRFMLYAHG--------PDLC-------------RESDL--RHAMANCFEALIGAVYLEGGLQEAKLLFGRLLFNTEDLREVWLNYPPHP-------LQVQEPLTDRQLIETSPVLQKLTDFEEAIGVLFTHVRLLARAFTLRTVGFNHLTLGHNQRMEFLGDSIMQLVATEYLFIHFPDHHEGHLTLLRSSLVNNRTQAKVAEELGMQEF 1111          
BLAST of Endoribonuclease Dicer vs. Ensembl Cavefish
Match: drosha (drosha ribonuclease III [Source:NCBI gene;Acc:103043153])

HSP 1 Score: 82.0333 bits (201), Expect = 3.836e-15
Identity = 67/265 (25.28%), Postives = 125/265 (47.17%), Query Frame = 2
Query: 3065 EQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVVKNSDESVEVNNSREFILIKNKNLADCCEAIIGSILTNYGID----------YSIQYLQ--WLNLPLVPDNELNADIEISPKLAFQNISMDTDIPQSINDLEKILNYHFKNKGYIVQAITHPSSIANR-KFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKY 3820
            E+ E LGD+ ++F+TS +L++     + EG L   R+ ++ N++L  LA +  LD++  Y +         P+               RE  L     +A+C EA+IG++    G+           ++ + L+  WLN P  P       +++   L  + +   + + Q + D E+ +   F +   + +A T  +   N       QR+EFLGDS++  + T Y+ ++    + G +T LRS+LVNN T A ++ + G  ++
Sbjct:  907 ERLEFLGDAVVEFLTSVHLYYLFPSLE-EGGLATYRTAIVQNQHLAMLAKKLELDRFMLYAHG--------PDLC-------------RESDL--RHAMANCFEALIGAVYLEGGLQEAKLLFGRLLFNTEDLREVWLNYPPHP-------LQVQEPLTDRQLIETSPVLQKLTDFEEAIGVLFTHVRLLARAFTLRTVGFNHLTLGHNQRMEFLGDSIMQLVATEYLFIHFPDHHEGHLTLLRSSLVNNRTQAKVAEELGMQEF 1140          
BLAST of Endoribonuclease Dicer vs. Ensembl Cavefish
Match: drosha (drosha ribonuclease III [Source:NCBI gene;Acc:103043153])

HSP 1 Score: 77.411 bits (189), Expect = 1.116e-13
Identity = 62/253 (24.51%), Postives = 118/253 (46.64%), Query Frame = 2
Query: 3065 EQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVVKNSDESVEVNNSREFILIKNKNLADCCEAIIGSILTNYGIDYSIQYLQWLNLPLVPDNELNADIEISPKLAFQNISMDTDIPQSINDLEKILNYHFKNKGYIVQAITHPSSIANR-KFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKY 3820
            E+ E LGD+ ++F+TS +L++     + EG L   R+ ++ N++L  LA +  LD++  Y +         P+ + + SD                  +A+C EA+IG++    G+  +                L  + E+   L  + +   + + Q + D E+ +   F +   + +A T  +   N       QR+EFLGDS++  + T Y+ ++    + G +T LRS+LVNN T A ++ + G  ++
Sbjct:  907 ERLEFLGDAVVEFLTSVHLYYLFPSLE-EGGLATYRTAIVQNQHLAMLAKKLELDRFMLYAHG--------PD-LCRESD--------------LRHAMANCFEALIGAVYLEGGLQEAKLLF----------GRLLFNTEVQEPLTDRQLIETSPVLQKLTDFEEAIGVLFTHVRLLARAFTLRTVGFNHLTLGHNQRMEFLGDSIMQLVATEYLFIHFPDHHEGHLTLLRSSLVNNRTQAKVAEELGMQEF 1125          
BLAST of Endoribonuclease Dicer vs. Ensembl Sea Lamprey
Match: dicer1 (dicer 1, ribonuclease type III [Source:NCBI gene;Acc:324724])

HSP 1 Score: 123.25 bits (308), Expect = 1.435e-28
Identity = 167/637 (26.22%), Postives = 279/637 (43.80%), Query Frame = 2
Query: 1190 KINKAFDFINSNFIIGHSTSQ-YPKKL--QMSVTKQXXXXXXXXXXXXXXXXATNVIEEGLDVSHCNIVVKFDPPQDFRSYLQSKGRARAQNSQYIVFTHETQKTEAQIQKFNLINEEL------NKILKSR------VIEDELNKDDSERN-----VTPSEDDKYDYVP-YGENGPRITLNSASSVLNRYLGKLRCNSISE--PKIIYTYFQDEFNFHHVSLLLPMPAPYLEEIKGLPCSNKRR-AKQFVNLEACKILHKYDELDSSLLPYNR-----------FDNNLVIQESNDIEIIKYEKYTATKLSTKFQNLSIPANKLYLYSIKYTPSVFL--KLGINDISMF---DVSTYLGILLPNPIHQNKDFMKFPIYLVGGMTSVEIKF-EYNLPVNSINYSLLLKCHKILFNIYSERIRRFDK-NIFFDPSKAKSSIILTIL------KDNKIDFNKIKEIITNPIVDNLIKNDQS----------SWVGSVIRPNYIT-NEFGAFVISKVCHDMNADSIFKND--MTYEKFLNKKYNIILSPNEKLSPLIKV------IRLTTIQSCVNKERRFLRNNRKLQRINESECY-----FVPSLTECISLSSSLWTQLCIFPTIHHRMNQILSIEDF 2884
            K +    +I+SNFI GH   +  P+    +    KQ E+L+ F+  + N+L+AT+ +EEG+D+  CN+VV+FDPP D+RSY+QSKGRA+A  S Y++         A  Q+    + EL       KIL+S+       +E                V+  ED    Y P   E+G  +TLNSA  ++NRY  KL  +  +   PK       D   F  + L LP+  P  + + G PC + RR A++ V L  C+ LHK  ELD  LLP  +            D              + + YT T       +   P +  +LY +    S  L  +L      ++   D +   GIL    I Q      FP+Y   G  +V+I+       +     +L+ + H+ +F+     I R +K ++ F P+ A+++  +  L       D  IDF  ++EI  +     +     S           +  +VI P Y   ++   F ++ V  D+   S F +    T+ ++   KYN+ L+   +  PL+ V      + L T +  +N++ + L  +   +R  + E        VP L     + +S+W +    P+I +R++ +L+ E+ 
Sbjct:    8 KQDPELAYISSNFITGHGIGKNQPRSRHNEAEFRKQEEVLRKFRAHETNLLVATSAVEEGVDLPKCNLVVRFDPPADYRSYVQSKGRAQAPVSNYVML--------ADAQRMPAFHRELCTYKAIEKILRSKCSKCPEAVECGGGGIVGGGEVDALVVSCQEDLLPAYAPRQDESGASVTLNSAIGLVNRYCAKLPSDPFTHLAPKCKTLELLDG-TFCSM-LHLPINCPLRDPVVG-PCMSTRRLAEKAVALLCCERLHKAGELDDHLLPVGKETVKYEEELDLHDEEETGVPGRPGSTKRRQCYTKTIPECLNSSYPRPGSPCFLYVVGMVLSTPLPDELNFRRRRLYPPEDTARCFGILTAKRIPQ---IPCFPVYTRSGEVTVDIRLCRSCFQLTEEQLALVTRFHQYIFS----HILRLEKPDLEFQPALAEAAYCVLPLDTVHAGGDLDIDFGFMEEIELSEARTGIPAKQYSHEHPFSFLLPDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYQTFAEYYKTKYNLDLTNLNQ--PLLDVDHTSSRLNLLTPRH-LNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAIHPIPASMWRKAVCLPSILYRLHCLLTAEEL 623          
BLAST of Endoribonuclease Dicer vs. Ensembl Sea Lamprey
Match: DDX58 (DExD/H-box helicase 58 [Source:HGNC Symbol;Acc:HGNC:19102])

HSP 1 Score: 52.373 bits (124), Expect = 6.622e-7
Identity = 97/414 (23.43%), Postives = 186/414 (44.93%), Query Frame = 2
Query:  425 LIFDEVHHLTKSDDYSQISEHVIRTTSDI-----KILGLTACLIKGVKHVKDIEFAVKQLEHKL-------NCKVITSMDNIAR--EFCG-----------NIKETIINYETESFPDLVAIFKSAIEKIESFIPVDGHHSNDNSGSLNAEQNNFKTLKKYLSESFSVLSTLGLVPCKLITDMFIEDLHGAVNNDSMFFDEKTKL-----YLDEFLS-----CLKFINSNIESYISKSDMLMCSEKC--------KKLINLILDLKSKNEDFKNTISILIFINEKIHVLALNVLLGILPKINKAFDFINSNFIIGHSTSQYPKKLQMSVTKQXXXXXXXXXXXXXXXXATNVIEEGLDVSHCNIVVKFDPPQDFRSYLQSKGRARAQNSQYIVFTHETQKTEAQIQKFNLINEEL 1537
            +IFDE HH  K+  Y+ I +H +           +I+GLTA +  GV   K ++ A+   +H L       +C + T   N++   +F             N+  T+     + F D   I K  + K+E  + +  +      G+   EQ   K  ++      S++S    +P K +   F++       ND++F +E T+      YL++F         + +    E   S S+ L   + C         KL+ L   L+ + +    T SIL F+  +    A+   +    +I      +  + +IG + S++ + + ++  +   + +  +E+  N+LIAT+V +EGLD+  CN+V+ +D   +    +Q++GR RA+NS+ ++ T   +   A+ +K NL+ E++
Sbjct:   21 IIFDECHHTCKNHPYNVIMQHYLGVKHGPSVPLSQIVGLTASV--GVGENKSLQGAI---DHVLMLCANMDSCVISTVQRNLSELAQFVPIAQHSTWASPCNLIHTVGRRRADPFAD---IIKDIMAKVEDLL-LSLNLPEKERGTQQYEQWVIKVQREG-----SMIS----IPDKELEQKFLQKY-----NDALFINEDTRAKDAMNYLEKFFHRENVFLTELVTCKREMLPSFSEKLHDLQSCLNNPENENPKLLKLEEILRDEYQMNAATKSIL-FVKTRAISEAMESWIN---EIKTELPHLKPSKLIGRAKSKHHEGMTLN-QQSGAVDEFREEQGSNLLIATSVADEGLDIQRCNLVLLYDYVGNVIKSVQTRGRGRAENSKCMLIT-TLKGGLAEKEKVNLLMEKV 405          
BLAST of Endoribonuclease Dicer vs. Ensembl Yeast
Match: MPH1 (3'-5' DNA helicase involved in error-free bypass of DNA lesions; binds flap DNA, stimulates activity of Rad27p and Dna2p; prevents crossovers between ectopic sequences by removing substrates for Mus81-Mms4 or Rad1-Rad10 cleavage; homolog of human FANCM Fanconi anemia protein that is involved in stabilizing and remodeling blocked replication forks; member of SF2 DExD/H superfamily of helicases; nonsense or missense mutations in FANCM can make people more likely to get cancer [Source:SGD;Acc:S000001441])

HSP 1 Score: 56.9954 bits (136), Expect = 2.011e-8
Identity = 43/175 (24.57%), Postives = 74/175 (42.29%), Query Frame = 2
Query:   47 RDYQIEIYNKAKNENVIIKLNTGSGKTFIASMLIKDYLNVKSDKKIFFLVKNSSLVHQHTNS-LKDYLFLKDEIGYFYGQMENSWVDNWTXXXXXXXXXXXXXXVMTAKVFLDILNHNKYNLSQVCYLIFDEVHHLTKSDDYSQISEHVIRTTSDIKILGLTACLIKGVKHVKDI 568
            RDYQ  I +K+  +N +  + TG GKTFIAS ++ +Y       KI F      LV Q   + L       D+      +   +  + W            ++   T +V  + L     +   +  L+ DE H  T S  Y+ + + + R  S  ++L LTA     ++ V+++
Sbjct:   88 RDYQYTIVHKSLFQNTLCAIPTGMGKTFIASTVMLNYFRWTKKAKIIFTAPTRPLVAQQIKACLGITGIPSDQTAILLDKSRKNREEIWA---------NKRVFFATPQVVENDLKRGVLDPKDIVCLVIDEAHRATGSSAYTNVVKFIDRFNSSYRLLALTATPASDLEGVQEV 253          
BLAST of Endoribonuclease Dicer vs. Ensembl Nematostella
Match: EDO35651 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKX2])

HSP 1 Score: 105.531 bits (262), Expect = 1.332e-25
Identity = 51/93 (54.84%), Postives = 66/93 (70.97%), Query Frame = 2
Query: 3545 INDLEKILNYHFKNKGYIVQAITHPSSIANRKFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYL 3823
            +   EK + Y F NK Y++QA+TH S   NR   CYQRLEFLGD+++DFLVT  I   N  L+PG++T+LR ALVNNN FA ++VK GF+K L
Sbjct:    1 MQGFEKRIGYEFSNKLYLIQALTHASYSQNRLTDCYQRLEFLGDALLDFLVTELIYSRNTNLDPGELTDLRQALVNNNIFAEIAVKHGFNKSL 93          

HSP 2 Score: 61.2326 bits (147), Expect = 2.438e-10
Identity = 26/55 (47.27%), Postives = 38/55 (69.09%), Query Frame = 3
Query: 3939 KVLGDIFESIAGAIFVDSNYDLKAVWTVYKVFMEEPLKKFFNNIPRNKISMLHEK 4103
            KVLGDIFES+AGAIF+DS  DL   W VY   ++  +  +  ++P+N + ++HEK
Sbjct:  138 KVLGDIFESVAGAIFLDSGMDLVLTWRVYYRMLKPYIDAYSADVPKNPVRLIHEK 192          
BLAST of Endoribonuclease Dicer vs. Ensembl Nematostella
Match: EDO36559 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIA4])

HSP 1 Score: 86.2705 bits (212), Expect = 8.708e-23
Identity = 43/113 (38.05%), Postives = 73/113 (64.60%), Query Frame = 2
Query: 3554 LEKILNYHFKNKGYIVQAITHPS-----SIANRKFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYLNYFDSKMFHILPKVVEEL 3877
            +E  L Y F+++  ++QA+TH S     S  N   S Y++LEFLGD+++D+LVT +++    +L+PG IT+LRSA+VNN + A L+++  FHK++      +F ++ + V  L
Sbjct:    9 VEASLGYTFRDRDILLQALTHTSYPRAYSSVN---SSYEQLEFLGDALLDYLVTRHVLQRFPRLSPGAITDLRSAVVNNYSLACLTIQRDFHKHMRSMSMALFKVVRRFVRRL 118          

HSP 2 Score: 40.4318 bits (93), Expect = 8.708e-23
Identity = 19/59 (32.20%), Postives = 33/59 (55.93%), Query Frame = 3
Query: 3933 VVKVLGDIFESIAGAIFVDSNYDLKAVWTVYKVFMEEPLKKFFNNIPRNKISMLHEKYP 4109
            V KVLGD+FE++ GA++VD   D +  W+V    +   ++ +  ++P +    L E  P
Sbjct:  147 VPKVLGDLFEALLGALYVDCGRDEELAWSVIYPLLTPIIEHYSVHLPISPTRQLVEMMP 205          
BLAST of Endoribonuclease Dicer vs. Ensembl Nematostella
Match: EDO32746 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU62])

HSP 1 Score: 90.5077 bits (223), Expect = 2.868e-18
Identity = 73/283 (25.80%), Postives = 130/283 (45.94%), Query Frame = 2
Query: 3032 MAKTCNDRTNL---EQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVVKNSDESVEVNNSREFILIKNKNLADCCEAIIGSILTNYGIDYSIQ------------YLQWLNLP--LVPDNELNADIEISPKLAFQNISMDTDIPQSINDLEKILNYHFKNKGYIVQAITHPSSIANR-KFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYLN 3826
            + K   DR+ +   E+ E LGD+ L+ I SK+LF    D D EG L   RS L+ N++L  LA    L  Y  +++         P+   ++                 N  +A+C EA++G++    G+  + +            Y +W+ LP   + D E   D         +++   + + Q + + E+     F +   + +A THP    N       QRLEFLGDSV+ F+V++++  +    + G +T LRS+LVN+ + A ++ +    +++N
Sbjct:  523 LGKVEEDRSMIRHNERLEFLGDAVLELICSKHLFFMLPDMD-EGHLATFRSALVQNRHLALLAKMLDLSDYMQFSH--------GPDLCQEDD---------------LNHAMANCLEALLGAVYLEAGLQVATELFSRLAFTEQDLYDKWMELPKHRLQDQEPGGD---------RHLIGSSPVLQKLVEFEEGSGIPFTHIRLLARAFTHPQVGKNNLTLGDNQRLEFLGDSVLQFVVSVFLYQHFPDHHEGHLTLLRSSLVNSRSQAEIARQLNLQEFIN 772          
BLAST of Endoribonuclease Dicer vs. Ensembl Nematostella
Match: EDO32367 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SV86])

HSP 1 Score: 67.0106 bits (162), Expect = 4.737e-11
Identity = 43/176 (24.43%), Postives = 81/176 (46.02%), Query Frame = 2
Query:   47 RDYQIEIYNKAKNENVIIKLNTGSGKTFIASMLIKDYLNVKSDKKIFFLVKNSSLVHQHTNSLKDYLFL-KDEIGYFYGQMENSWVDN-WTXXXXXXXXXXXXXXVMTAKVFLDILNHNKYNLSQVCYLIFDEVHHLTKSDDYSQISEHVIRTTSDIKILGLTACLIKGVKHVKDI 568
            RDYQ  I  KA  +N+++ L TG GKTFIA++++ +Y       K+ F+     LV Q   +    + + + +     G M  +  +N W            ++  +T +V  + L+      + V  L+ DE H    +  Y Q+   ++  T++ ++L L+A     +K V+ +
Sbjct:   86 RDYQFNIVQKALYQNIMVTLPTGLGKTFIAAVVMYNYYRWYPQGKVVFMAPTKPLVAQQIEACYKIMGIPQTDTAEMTGNMAPTKRENLW---------RTKRVFFLTPQVLQNDLSRGSCAAADVVLLVVDEAHKALGNHSYCQVVREILSYTTNFRVLALSATPGDDIKAVQQV 252          
BLAST of Endoribonuclease Dicer vs. Ensembl Nematostella
Match: EDO47177 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMY2])

HSP 1 Score: 60.077 bits (144), Expect = 6.060e-9
Identity = 71/258 (27.52%), Postives = 123/258 (47.67%), Query Frame = 2
Query:   47 RDYQIEIYNKA-KNENVIIKLNTGSGKTFIASMLIKDYLNVKSDKKIFFLVKNSSLVHQHTNSLKDYLFLKDEIGYFYGQMENSWVDNWTXXXXXXXXXXXXXXVMTAKVFLDI----LNHNKYNLSQVCYLIFDEVHHLTKSDDYSQISEHVI-------RTTSDIKILGLTACLIKG-VKHVKDIEFAVKQLEHKLNCK-VITSMDNI----AREFCGNIKETIINYETESFPDLVAIFKSAIEKIESFI---PVD 757
            R YQ E+  KA +  N +I   T SGKT++A  + +++L+ K + K+ F+V   +LV Q T   K  L+L+D+  Y    +  S   N      S  +    ++V+TA+V L I    L      LS V  L+FDE HH  K   Y++I E+ +        +    +I+GLTA L  G  K+  + +  + ++   ++ + V+T  D       R   G  + T+ +   +      ++   A+E++E ++   PVD
Sbjct:    4 RGYQKELSEKALEGHNTVICAPTNSGKTYVALNIARNHLDKKKEGKVLFIVSTVNLVQQQTERFK--LYLQDK--YIVKDISGS---NGCDIPLSGLLGSSHVVVLTAQVMLCILVNALKDGSLQLSSVSLLVFDECHHTQKDHPYNKIMENYMTLRLQPAHSMPTPQIVGLTASLGVGKAKNTLEAQHHILEVCANMDAQHVVTVQDETNLEELRLHVGTPQRTVHSVTCDRTDVFESVIGKAMEQVELYVKGTPVD 254          
BLAST of Endoribonuclease Dicer vs. Ensembl Medaka
Match: dicer1 (dicer 1, ribonuclease III [Source:NCBI gene;Acc:101164359])

HSP 1 Score: 205.297 bits (521), Expect = 1.009e-52
Identity = 260/1072 (24.25%), Postives = 479/1072 (44.68%), Query Frame = 2
Query:   47 RDYQIEIYNKAKNENVIIKLNTGSGKTFIASMLIKDYLNV------KSDKKIFFLVKNSSLVHQHTNSLKDYLFLKDEIGYFYGQMENSWVDNWTXXXXXXXXXXXXXXVMTAKVFLDILNHNKYNLSQVCYLIFDEVHHLTKSDDYSQISEHVIRTTSDIKILGLTACLIKGVKHVKDIEFAVKQLEHKLNCKVITSMDNIARE-FCGNIKETIIN---YETESFPDLVAIFKSAIEKIESFIPVDGHHSNDNSGSLNAEQNNFKTL-KKYLSESFSVLSTLGLVPCKLITDMFIEDLHGAVNNDSMFFDEKTKLYLDEFLSCLKFINSNIESYISKS--DMLMCSEKCKKLINLILDLKS--------------KNED------------------------------FKNTISILIFINEKIHVLALNVLLGILPKINKAFDFINSNFIIGHSTSQYP---KKLQMSVTKQXXXXXXXXXXXXXXXXATNVIEEGLDVSHCNIVVKFDPPQDFRSYLQSKGRARAQNSQYIVFTHETQKTEAQIQKFNLINEELNKILKSRVIED-ELNKDDSERNVTPSEDDKYDYVPY----GENGPRITLNSASSVLNRYLGKLRCNSISEPKIIYTYFQDEFNFHHVSLLLPMPAPYLEEIKGLPCSNKRRAKQFVNLEACKILHKYDELDSSLLPYNRFDNNLVIQESNDIEIIKYE-----------KYTATKLSTKFQNL-------------SIPANKLYLYSIKYTPSVFL--KLGINDISMF---DVSTYLGILLPNPIHQNKDFMKFPIYLVGGMTSVEIKFE-YNLPVNSINYSLLLKCHKILFNIYSERIRRFDKNIF-FDPSKAKSS---IILTILKDN---KIDFNKIKEI----------ITNPIVDNLIKNDQSSWVGSVIRPNYIT-NEFGAFVISKVCHDMNADSIFKND--MTYEKFLNKKYNIILSPNEKLSPLIKV------IRLTTIQSCVNKERRFLRNNRKLQRINESECY-----FVPSLTECISLSSSLWTQLCIFPTIHHRMNQILSIEDF 2884
            R YQ+E+   A   N I+ LNTGSGKTFIA +L K+  +       ++ ++  FL   +S   Q   +++ +  L   +G +    E +    W++ +WS++I+  +++VMT  VFL +L ++   LS++  ++FD+ H       Y ++ +     T   +ILGLTA ++ G     ++E  ++ LE  L     T+ D +  + +    +E +++   Y  +S   L +  ++ +E+   F+       ND + S + E  +   + K+ LS+  +VL  LG         + + +L   + ++      K  L+ D   + L+ +++  E + S +  D+   + K  +L+ ++ + K               +N+D                              F N +  +IF+  +   + LN L+    K +    +I+SNFI GHS  +     K++++   KQ E+L+ F+  + N+LIAT+++EEG+D+  CN+VV+FD P ++RSY+QSKGRARA  S YI+   ++++T+A  Q+     + + KIL+++  +  E+ + D E+ V    DD     PY     + GPR+T+N+A   +NRY  +L  +  +         +        +L LP+ +P    IKG      R A++ V L  C+ LHK  ELD  L+P  +             E +KYE                  STK +               ++P    YLY I    +  L  +L      ++   D +   GIL   PI +      FP+Y   G  ++ I+ +     +++    L+ + H+ +F+     I R +K    F P+ A S+   + L ++ D+    +DF  +++I           T     N        +  +VI P Y   ++   F ++ V   +   S F +    T+ ++   KYN+ LS   +  PL+ V      + L T +  +N++ + L  +   +R  + E        VP L     + +SLW +    P+I +R++ +L+ E+ 
Sbjct:   35 RKYQVELLEAALEHNTIVCLNTGSGKTFIAVLLTKELSHQIRGSYQENARRTVFLANATSSAVQQAAAVRTHSDL--HVGEYSDPQEAT---TWSRQRWSREIADNQVLVMTCHVFLHVLTNHILPLSKINLVVFDDCHLAITEHPYCEVMKLFEEHTCGSRILGLTASILNGKCDPSELEQKIQNLERILKSSAETATDLVVLDRYACQPREVVLDCGPYMDKS--GLSSRLQAELEEALLFL-------NDCNISASREDRDPTFISKQILSDCLAVLQVLGPWCADKAAGIMVRELQKYIKHEQEELSRKFLLFTD---TILRKVHALCEEHFSPASLDLKFVTPKVLRLLEILHEYKPFERQQFESVEWYNNRNQDNYVSWSDSEDEDEDEEVEAKERPETNFPSPFTNILCGIIFVERRYTAVVLNRLIKEAGKQDPELAYISSNFITGHSIGKNQARNKQMEVEFRKQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLVVRFDLPTEYRSYVQSKGRARAPVSNYIMLA-DSERTQA-FQEDLTTYKAIEKILRNKCSKSVEVGEFDGEQVV----DDDNILPPYVLRSEDGGPRVTVNTAIGHINRYCARLPSDPFTHLAPKCKTVETGNGRFQSTLYLPINSPLRVPIKGPTMHCARLAEKAVALLCCEKLHKIGELDDHLMPVGK-------------ETVKYEEELDLHDEEETSVPGRPGSTKRRQCYPKAIPECLRDSYAVPEQTYYLYVIGMVLTTPLPDELNFRRRKLYPPEDTTRTFGILTAKPIPR---IPHFPVYTRSGEVTISIELQKSGFTLSAAQLDLITRLHQYIFS----HILRLEKPALEFKPTVADSAYCVLPLNVVGDSNTLDMDFKFMEDIEKSEARTGIPTTKYTKQNPFTFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTYLTPLSKFPSPEYETFAEYYKTKYNLDLSNLNQ--PLLDVDHTSSRLNLLTPRH-LNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLHCLLTAEEL 1060          

HSP 2 Score: 127.487 bits (319), Expect = 1.536e-40
Identity = 71/206 (34.47%), Postives = 117/206 (56.80%), Query Frame = 2
Query: 3344 IKNKNLADCCEAIIGSILTNYGIDYSIQYLQWLNLPLVPDNELNADIEISP--------------KLAFQNISMDTDIPQSINDL-------EKILNYHFKNKGYIVQAITHPSSIANRKFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYLNYFDSKMFHILPKVVE-ELLNNQLQ 3895
            I +K++ADC EA++G  LT+ G   +  +L  L L ++P     +    +P              K+  + +    D  +++  L       EK +NY F+NK Y++QA TH S   N    CYQRLEFLGD+++D+L+T ++  + ++ +PG +T+LRSALVNN  FA L+VK+ +HKY      ++FH++   V+ +L  N++Q
Sbjct: 1544 IADKSIADCVEALLGCYLTSCGERAAQMFLCSLGLKVLPSEPGTSRASKAPSSRTSAADLSYGWLKIPPRCMLAHPDAERTLQHLISGFENFEKKINYSFQNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFKAISPELFHVIDDFVQFQLEKNEMQ 1749          

HSP 3 Score: 60.8474 bits (146), Expect = 1.536e-40
Identity = 28/60 (46.67%), Postives = 39/60 (65.00%), Query Frame = 3
Query: 3933 VVKVLGDIFESIAGAIFVDSNYDLKAVWTVYKVFMEEPLKKFFNNIPRNKISMLHEKYPQ 4112
            V K +GDIFES+AGAI++DS   L+ VW VY   M   ++KF  N+PR+ +  L E  P+
Sbjct: 1770 VPKAMGDIFESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRSPVRELLEMEPE 1829          

HSP 4 Score: 75.0998 bits (183), Expect = 6.288e-13
Identity = 41/102 (40.20%), Postives = 61/102 (59.80%), Query Frame = 2
Query: 3044 CNDRTNLEQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVV---KNSDESVEVNNSREFI 3340
             +D  NLE+ E+LGDSFLK   + YLF    D  +EG+L+  RS+ +SN NL+ L  +KGL      + F+P  N+LPP +VV   K+S + V+  +  E +
Sbjct: 1277 ASDGFNLERLEMLGDSFLKHAITTYLFCTYPDA-HEGRLSYMRSKKVSNCNLYRLGKKKGLPSRMVVSIFDPPVNWLPPGYVVNQDKSSTDKVDSESKEELL 1377          
BLAST of Endoribonuclease Dicer vs. Ensembl Medaka
Match: dicer1 (dicer 1, ribonuclease III [Source:NCBI gene;Acc:101164359])

HSP 1 Score: 134.035 bits (336), Expect = 1.770e-42
Identity = 71/194 (36.60%), Postives = 118/194 (60.82%), Query Frame = 2
Query: 3344 IKNKNLADCCEAIIGSILTNYGIDYSIQYLQWLNLPLVPDNELNAD------IEISPKLAFQNISMDTDIPQSIN---DLEKILNYHFKNKGYIVQAITHPSSIANRKFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYLNYFDSKMFHILPKVVE-ELLNNQLQ 3895
            I +K++ADC EA++G  LT+ G   +  +L  L L + P +  +A       ++I P+    +   +  +   I+   + EK +NY F+NK Y++QA TH S   N    CYQRLEFLGD+++D+L+T ++  + ++ +PG +T+LRSALVNN  FA L+VK+ +HKY      ++FH++   V+ +L  N++Q
Sbjct: 1401 IADKSIADCVEALLGCYLTSCGERAAQMFLCSLGLKVTPSSRTSAADLSYGWLKIPPRCMLAHPDAERTLQHLISGFENFEKKINYSFQNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFKAISPELFHVIDDFVQFQLEKNEMQ 1594          

HSP 2 Score: 60.4622 bits (145), Expect = 1.770e-42
Identity = 28/60 (46.67%), Postives = 39/60 (65.00%), Query Frame = 3
Query: 3933 VVKVLGDIFESIAGAIFVDSNYDLKAVWTVYKVFMEEPLKKFFNNIPRNKISMLHEKYPQ 4112
            V K +GDIFES+AGAI++DS   L+ VW VY   M   ++KF  N+PR+ +  L E  P+
Sbjct: 1615 VPKAMGDIFESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRSPVRELLEMEPE 1674          

HSP 3 Score: 149.058 bits (375), Expect = 1.715e-35
Identity = 144/546 (26.37%), Postives = 268/546 (49.08%), Query Frame = 2
Query:   47 RDYQIEIYNKAKNENVIIKLNTGSGKTFIASMLIKDYLNV------KSDKKIFFLVKNSSLVHQHTNSLKDYLFLKDEIGYFYGQMENSWVDNWTXXXXXXXXXXXXXXVMTAKVFLDILNHNKYNLSQVCYLIFDEVHHLTKSDDYSQI-SEHVIRTTSDIKILGLTACLIKGVKHVKDIEFAVKQLEHKLNCKVITSMDNIARE-FCGNIKETIIN---YETESFPDLVAIFKSAIEKIESFIPVDGHHSNDNSGSLNAEQNNFKTL-KKYLSESFSVLSTLGLVPCKLITDMFIEDLHGAVNNDSMFFDEKTKLYLDEFLSCLKFINSNIESYISKS--DMLMCSEKCKKLINLILDLKS--------------KNED------------------------------FKNTISILIFINEKIHVLALNVLLGILPKINKAFDFINSNFIIGHSTSQ---YPKKLQMSVTKQXXXXXXXXXXXXXXXXATNVIEEGLDVSHCNIVVKFDPPQDFRSYLQSKGRARAQNSQYIVFTHETQKTEA 1501
            R YQ+E+   A   N I+ LNTGSGKTFIA +L K+  +       ++ ++  FL   +S   Q   +++ +  L   +G +    E +    W++ +WS++I+  +++VMT  VFL +L ++   LS++  ++FD+ H       Y ++  EH    T   +ILGLTA ++ G     ++E  ++ LE  L     T+ D +  + +    +E +++   Y  +S   L +  ++ +E+   F+       ND + S + E  +   + K+ LS+  +VL  LG         + + +L   + ++      K  L+ D   + L+ +++  E + S +  D+   + K  +L+ ++ + K               +N+D                              F N +  +IF+  +   + LN L+    K +    +I+SNFI GHS  +     K++++   KQ E+L+ F+  + N+LIAT+++EEG+D+  CN+VV+FD P ++RSY+QSKGRARA  S YI+   ++++T+A
Sbjct:   35 RKYQVELLEAALEHNTIVCLNTGSGKTFIAVLLTKELSHQIRGSYQENARRTVFLANATSSAVQQAAAVRTHSDL--HVGEYSDPQEAT---TWSRQRWSREIADNQVLVMTCHVFLHVLTNHILPLSKINLVVFDDCHLAITEHPYCEVMKEH----TCGSRILGLTASILNGKCDPSELEQKIQNLERILKSSAETATDLVVLDRYACQPREVVLDCGPYMDKS--GLSSRLQAELEEALLFL-------NDCNISASREDRDPTFISKQILSDCLAVLQVLGPWCADKAAGIMVRELQKYIKHEQEELSRKFLLFTD---TILRKVHALCEEHFSPASLDLKFVTPKVLRLLEILHEYKPFERQQFESVEWYNNRNQDNYVSWSDSEDEDEDEEVEAKERPETNFPSPFTNILCGIIFVERRYTAVVLNRLIKEAGKQDPELAYISSNFITGHSIGKNQARNKQMEVEFRKQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLVVRFDLPTEYRSYVQSKGRARAPVSNYIMLA-DSERTQA 558          

HSP 4 Score: 74.3294 bits (181), Expect = 9.416e-13
Identity = 40/105 (38.10%), Postives = 59/105 (56.19%), Query Frame = 2
Query: 3044 CNDRTNLEQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVVKNSDESVEVNNSREFILIKNKN 3358
             +D  NLE+ E+LGDSFLK   + YLF    D  +EG+L+  RS+ +SN NL+ L  +KGL      + F+P  N+LPP +VV     S +  +S   +L   + 
Sbjct: 1136 ASDGFNLERLEMLGDSFLKHAITTYLFCTYPDA-HEGRLSYMRSKKVSNCNLYRLGKKKGLPSRMVVSIFDPPVNWLPPGYVVNQDKSSTDKVDSEVGLLTNGRT 1239          
BLAST of Endoribonuclease Dicer vs. Ensembl Medaka
Match: drosha (drosha ribonuclease III [Source:NCBI gene;Acc:101175032])

HSP 1 Score: 79.337 bits (194), Expect = 2.668e-14
Identity = 72/273 (26.37%), Postives = 124/273 (45.42%), Query Frame = 2
Query: 3065 EQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVVKNSDESVEVNNSREFILIKNKNLADCCEAIIGSILTNYGID----------YSIQYLQ--WLNLPLVP--------DNELNADIEISPKLAFQNISMDTDIPQSINDLEKILNYHFKNKGYIVQAITHPSSIANR-KFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKY 3820
            E+ E LGD+ ++F+TS +L++     + EG L   R+ ++ N++L  LA +  LD++  Y +  P         + + SD                  +A+C EA+IG++    G+D          ++ + L+  WLN P  P        D +L   IE SP L            Q +   E  +   F +   + +A T  +   N       QR+EFLGDS++  + T Y+ ++    + G +T LRS+LVNN T A ++ + G  ++
Sbjct:  909 ERLEFLGDAVVEFLTSVHLYYLFPSLE-EGGLATYRTAIVQNQHLAMLAKKLELDRFMLYAH-GPD--------LCRESD--------------LRHAMANCFEALIGAVYLEGGLDEARLLFGRLLFNSEDLREVWLNYPAHPLQVQEPQTDRQL---IETSPVL------------QKLTSFEDSIGVFFTHVRLLARAFTLRTVGFNHLTLGHNQRMEFLGDSIMQLVATEYLFIHFPDHHEGHLTLLRSSLVNNRTQAKVAEELGMQEF 1142          
BLAST of Endoribonuclease Dicer vs. Ensembl Medaka
Match: drosha (drosha ribonuclease III [Source:NCBI gene;Acc:101175032])

HSP 1 Score: 79.337 bits (194), Expect = 2.668e-14
Identity = 72/273 (26.37%), Postives = 124/273 (45.42%), Query Frame = 2
Query: 3065 EQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVVKNSDESVEVNNSREFILIKNKNLADCCEAIIGSILTNYGID----------YSIQYLQ--WLNLPLVP--------DNELNADIEISPKLAFQNISMDTDIPQSINDLEKILNYHFKNKGYIVQAITHPSSIANR-KFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKY 3820
            E+ E LGD+ ++F+TS +L++     + EG L   R+ ++ N++L  LA +  LD++  Y +  P         + + SD                  +A+C EA+IG++    G+D          ++ + L+  WLN P  P        D +L   IE SP L            Q +   E  +   F +   + +A T  +   N       QR+EFLGDS++  + T Y+ ++    + G +T LRS+LVNN T A ++ + G  ++
Sbjct:  909 ERLEFLGDAVVEFLTSVHLYYLFPSLE-EGGLATYRTAIVQNQHLAMLAKKLELDRFMLYAH-GPD--------LCRESD--------------LRHAMANCFEALIGAVYLEGGLDEARLLFGRLLFNSEDLREVWLNYPAHPLQVQEPQTDRQL---IETSPVL------------QKLTSFEDSIGVFFTHVRLLARAFTLRTVGFNHLTLGHNQRMEFLGDSIMQLVATEYLFIHFPDHHEGHLTLLRSSLVNNRTQAKVAEELGMQEF 1142          
BLAST of Endoribonuclease Dicer vs. Ensembl Medaka
Match: drosha (drosha ribonuclease III [Source:NCBI gene;Acc:101175032])

HSP 1 Score: 79.337 bits (194), Expect = 2.668e-14
Identity = 72/273 (26.37%), Postives = 124/273 (45.42%), Query Frame = 2
Query: 3065 EQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVVKNSDESVEVNNSREFILIKNKNLADCCEAIIGSILTNYGID----------YSIQYLQ--WLNLPLVP--------DNELNADIEISPKLAFQNISMDTDIPQSINDLEKILNYHFKNKGYIVQAITHPSSIANR-KFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKY 3820
            E+ E LGD+ ++F+TS +L++     + EG L   R+ ++ N++L  LA +  LD++  Y +  P         + + SD                  +A+C EA+IG++    G+D          ++ + L+  WLN P  P        D +L   IE SP L            Q +   E  +   F +   + +A T  +   N       QR+EFLGDS++  + T Y+ ++    + G +T LRS+LVNN T A ++ + G  ++
Sbjct:  909 ERLEFLGDAVVEFLTSVHLYYLFPSLE-EGGLATYRTAIVQNQHLAMLAKKLELDRFMLYAH-GPD--------LCRESD--------------LRHAMANCFEALIGAVYLEGGLDEARLLFGRLLFNSEDLREVWLNYPAHPLQVQEPQTDRQL---IETSPVL------------QKLTSFEDSIGVFFTHVRLLARAFTLRTVGFNHLTLGHNQRMEFLGDSIMQLVATEYLFIHFPDHHEGHLTLLRSSLVNNRTQAKVAEELGMQEF 1142          
BLAST of Endoribonuclease Dicer vs. Planmine SMEST
Match: SMESG000073604.1 (SMESG000073604.1)

HSP 1 Score: 2480.67 bits (6428), Expect = 0.000e+0
Identity = 1257/1257 (100.00%), Postives = 1257/1257 (100.00%), Query Frame = 2
Query:  140 MLIKDYLNVKSDKKIFFLVKNSSLVHQHTNSLKDYLFLKDEIGYFYGQMENSWVDNWTXXXXXXXXXXXXXXVMTAKVFLDILNHNKYNLSQVCYLIFDEVHHLTKSDDYSQISEHVIRTTSDIKILGLTACLIKGVKHVKDIEFAVKQLEHKLNCKVITSMDNIAREFCGNIKETIINYETESFPDLVAIFKSAIEKIESFIPVDGHHSNDNSGSLNAEQNNFKTLKKYLSESFSVLSTLGLVPCKLITDMFIEDLHGAVNNDSMFFDEKTKLYLDEFLSCLKFINSNIESYISKSDMLMCSEKCKKLINLILDLKSKNEDFKNTISILIFINEKIHVLALNVLLGILPKINKAFDFINSNFIIGHSTSQYPKKLQMSVTKQXXXXXXXXXXXXXXXXATNVIEEGLDVSHCNIVVKFDPPQDFRSYLQSKGRARAQNSQYIVFTHETQKTEAQIQKFNLINEELNKILKSRVIEDELNKDDSERNVTPSEDDKYDYVPYGENGPRITLNSASSVLNRYLGKLRCNSISEPKIIYTYFQDEFNFHHVSLLLPMPAPYLEEIKGLPCSNKRRAKQFVNLEACKILHKYDELDSSLLPYNRFDNNLVIQESNDIEIIKYEKYTATKLSTKFQNLSIPANKLYLYSIKYTPSVFLKLGINDISMFDVSTYLGILLPNPIHQNKDFMKFPIYLVGGMTSVEIKFEYNLPVNSINYSLLLKCHKILFNIYSERIRRFDKNIFFDPSKAKSSIILTILKDNKIDFNKIKEIITNPIVDNLIKNDQSSWVGSVIRPNYITNEFGAFVISKVCHDMNADSIFKNDMTYEKFLNKKYNIILSPNEKLSPLIKVIRLTTIQSCVNKERRFLRNNRKLQRINESECYFVPSLTECISLSSSLWTQLCIFPTIHHRMNQILSIEDFAHDLEFMNLIENSDCFEINFDDCYNIENIESSIYDPNVLKFINNIFPCFMAKTCNDRTNLEQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVVKNSDESVEVNNSREFILIKNKNLADCCEAIIGSILTNYGIDYSIQYLQWLNLPLVPDNELNADIEISPKLAFQNISMDTDIPQSINDLEKILNYHFKNKGYIVQAITHPSSIANRKFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYLNYFDSKMFHILPKVVEELLNNQLQCEHSY 3910
            MLIKDYLNVKSDKKIFFLVKNSSLVHQHTNSLKDYLFLKDEIGYFYGQMENSWVDNWTKDKWSKKISKYKIIVMTAKVFLDILNHNKYNLSQVCYLIFDEVHHLTKSDDYSQISEHVIRTTSDIKILGLTACLIKGVKHVKDIEFAVKQLEHKLNCKVITSMDNIAREFCGNIKETIINYETESFPDLVAIFKSAIEKIESFIPVDGHHSNDNSGSLNAEQNNFKTLKKYLSESFSVLSTLGLVPCKLITDMFIEDLHGAVNNDSMFFDEKTKLYLDEFLSCLKFINSNIESYISKSDMLMCSEKCKKLINLILDLKSKNEDFKNTISILIFINEKIHVLALNVLLGILPKINKAFDFINSNFIIGHSTSQYPKKLQMSVTKQLEILKLFKEKKFNILIATNVIEEGLDVSHCNIVVKFDPPQDFRSYLQSKGRARAQNSQYIVFTHETQKTEAQIQKFNLINEELNKILKSRVIEDELNKDDSERNVTPSEDDKYDYVPYGENGPRITLNSASSVLNRYLGKLRCNSISEPKIIYTYFQDEFNFHHVSLLLPMPAPYLEEIKGLPCSNKRRAKQFVNLEACKILHKYDELDSSLLPYNRFDNNLVIQESNDIEIIKYEKYTATKLSTKFQNLSIPANKLYLYSIKYTPSVFLKLGINDISMFDVSTYLGILLPNPIHQNKDFMKFPIYLVGGMTSVEIKFEYNLPVNSINYSLLLKCHKILFNIYSERIRRFDKNIFFDPSKAKSSIILTILKDNKIDFNKIKEIITNPIVDNLIKNDQSSWVGSVIRPNYITNEFGAFVISKVCHDMNADSIFKNDMTYEKFLNKKYNIILSPNEKLSPLIKVIRLTTIQSCVNKERRFLRNNRKLQRINESECYFVPSLTECISLSSSLWTQLCIFPTIHHRMNQILSIEDFAHDLEFMNLIENSDCFEINFDDCYNIENIESSIYDPNVLKFINNIFPCFMAKTCNDRTNLEQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVVKNSDESVEVNNSREFILIKNKNLADCCEAIIGSILTNYGIDYSIQYLQWLNLPLVPDNELNADIEISPKLAFQNISMDTDIPQSINDLEKILNYHFKNKGYIVQAITHPSSIANRKFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYLNYFDSKMFHILPKVVEELLNNQLQCEHSY
Sbjct:    1 MLIKDYLNVKSDKKIFFLVKNSSLVHQHTNSLKDYLFLKDEIGYFYGQMENSWVDNWTKDKWSKKISKYKIIVMTAKVFLDILNHNKYNLSQVCYLIFDEVHHLTKSDDYSQISEHVIRTTSDIKILGLTACLIKGVKHVKDIEFAVKQLEHKLNCKVITSMDNIAREFCGNIKETIINYETESFPDLVAIFKSAIEKIESFIPVDGHHSNDNSGSLNAEQNNFKTLKKYLSESFSVLSTLGLVPCKLITDMFIEDLHGAVNNDSMFFDEKTKLYLDEFLSCLKFINSNIESYISKSDMLMCSEKCKKLINLILDLKSKNEDFKNTISILIFINEKIHVLALNVLLGILPKINKAFDFINSNFIIGHSTSQYPKKLQMSVTKQLEILKLFKEKKFNILIATNVIEEGLDVSHCNIVVKFDPPQDFRSYLQSKGRARAQNSQYIVFTHETQKTEAQIQKFNLINEELNKILKSRVIEDELNKDDSERNVTPSEDDKYDYVPYGENGPRITLNSASSVLNRYLGKLRCNSISEPKIIYTYFQDEFNFHHVSLLLPMPAPYLEEIKGLPCSNKRRAKQFVNLEACKILHKYDELDSSLLPYNRFDNNLVIQESNDIEIIKYEKYTATKLSTKFQNLSIPANKLYLYSIKYTPSVFLKLGINDISMFDVSTYLGILLPNPIHQNKDFMKFPIYLVGGMTSVEIKFEYNLPVNSINYSLLLKCHKILFNIYSERIRRFDKNIFFDPSKAKSSIILTILKDNKIDFNKIKEIITNPIVDNLIKNDQSSWVGSVIRPNYITNEFGAFVISKVCHDMNADSIFKNDMTYEKFLNKKYNIILSPNEKLSPLIKVIRLTTIQSCVNKERRFLRNNRKLQRINESECYFVPSLTECISLSSSLWTQLCIFPTIHHRMNQILSIEDFAHDLEFMNLIENSDCFEINFDDCYNIENIESSIYDPNVLKFINNIFPCFMAKTCNDRTNLEQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVVKNSDESVEVNNSREFILIKNKNLADCCEAIIGSILTNYGIDYSIQYLQWLNLPLVPDNELNADIEISPKLAFQNISMDTDIPQSINDLEKILNYHFKNKGYIVQAITHPSSIANRKFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYLNYFDSKMFHILPKVVEELLNNQLQCEHSY 1257          

HSP 2 Score: 100.138 bits (248), Expect = 8.226e-21
Identity = 49/56 (87.50%), Postives = 50/56 (89.29%), Query Frame = 3
Query: 3885 ISCNASIHIKSEQYKVVVKVLGDIFESIAGAIFVDSNYDLKAVWTVYKVFMEEPLK 4052
            + C  S   KSEQYKVVVKVLGDIFESIAGAIFVDSNYDLKAVWTVYKVFMEEPLK
Sbjct: 1251 LQCEHSYLRKSEQYKVVVKVLGDIFESIAGAIFVDSNYDLKAVWTVYKVFMEEPLK 1306          
BLAST of Endoribonuclease Dicer vs. Planmine SMEST
Match: SMESG000073604.1 (SMESG000073604.1)

HSP 1 Score: 2431.37 bits (6300), Expect = 0.000e+0
Identity = 1234/1235 (99.92%), Postives = 1235/1235 (100.00%), Query Frame = 2
Query:  140 MLIKDYLNVKSDKKIFFLVKNSSLVHQHTNSLKDYLFLKDEIGYFYGQMENSWVDNWTXXXXXXXXXXXXXXVMTAKVFLDILNHNKYNLSQVCYLIFDEVHHLTKSDDYSQISEHVIRTTSDIKILGLTACLIKGVKHVKDIEFAVKQLEHKLNCKVITSMDNIAREFCGNIKETIINYETESFPDLVAIFKSAIEKIESFIPVDGHHSNDNSGSLNAEQNNFKTLKKYLSESFSVLSTLGLVPCKLITDMFIEDLHGAVNNDSMFFDEKTKLYLDEFLSCLKFINSNIESYISKSDMLMCSEKCKKLINLILDLKSKNEDFKNTISILIFINEKIHVLALNVLLGILPKINKAFDFINSNFIIGHSTSQYPKKLQMSVTKQXXXXXXXXXXXXXXXXATNVIEEGLDVSHCNIVVKFDPPQDFRSYLQSKGRARAQNSQYIVFTHETQKTEAQIQKFNLINEELNKILKSRVIEDELNKDDSERNVTPSEDDKYDYVPYGENGPRITLNSASSVLNRYLGKLRCNSISEPKIIYTYFQDEFNFHHVSLLLPMPAPYLEEIKGLPCSNKRRAKQFVNLEACKILHKYDELDSSLLPYNRFDNNLVIQESNDIEIIKYEKYTATKLSTKFQNLSIPANKLYLYSIKYTPSVFLKLGINDISMFDVSTYLGILLPNPIHQNKDFMKFPIYLVGGMTSVEIKFEYNLPVNSINYSLLLKCHKILFNIYSERIRRFDKNIFFDPSKAKSSIILTILKDNKIDFNKIKEIITNPIVDNLIKNDQSSWVGSVIRPNYITNEFGAFVISKVCHDMNADSIFKNDMTYEKFLNKKYNIILSPNEKLSPLIKVIRLTTIQSCVNKERRFLRNNRKLQRINESECYFVPSLTECISLSSSLWTQLCIFPTIHHRMNQILSIEDFAHDLEFMNLIENSDCFEINFDDCYNIENIESSIYDPNVLKFINNIFPCFMAKTCNDRTNLEQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVVKNSDESVEVNNSREFILIKNKNLADCCEAIIGSILTNYGIDYSIQYLQWLNLPLVPDNELNADIEISPKLAFQNISMDTDIPQSINDLEKILNYHFKNKGYIVQAITHPSSIANRKFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYLNYFDSKM 3844
            MLIKDYLNVKSDKKIFFLVKNSSLVHQHTNSLKDYLFLKDEIGYFYGQMENSWVDNWTKDKWSKKISKYKIIVMTAKVFLDILNHNKYNLSQVCYLIFDEVHHLTKSDDYSQISEHVIRTTSDIKILGLTACLIKGVKHVKDIEFAVKQLEHKLNCKVITSMDNIAREFCGNIKETIINYETESFPDLVAIFKSAIEKIESFIPVDGHHSNDNSGSLNAEQNNFKTLKKYLSESFSVLSTLGLVPCKLITDMFIEDLHGAVNNDSMFFDEKTKLYLDEFLSCLKFINSNIESYISKSDMLMCSEKCKKLINLILDLKSKNEDFKNTISILIFINEKIHVLALNVLLGILPKINKAFDFINSNFIIGHSTSQYPKKLQMSVTKQLEILKLFKEKKFNILIATNVIEEGLDVSHCNIVVKFDPPQDFRSYLQSKGRARAQNSQYIVFTHETQKTEAQIQKFNLINEELNKILKSRVIEDELNKDDSERNVTPSEDDKYDYVPYGENGPRITLNSASSVLNRYLGKLRCNSISEPKIIYTYFQDEFNFHHVSLLLPMPAPYLEEIKGLPCSNKRRAKQFVNLEACKILHKYDELDSSLLPYNRFDNNLVIQESNDIEIIKYEKYTATKLSTKFQNLSIPANKLYLYSIKYTPSVFLKLGINDISMFDVSTYLGILLPNPIHQNKDFMKFPIYLVGGMTSVEIKFEYNLPVNSINYSLLLKCHKILFNIYSERIRRFDKNIFFDPSKAKSSIILTILKDNKIDFNKIKEIITNPIVDNLIKNDQSSWVGSVIRPNYITNEFGAFVISKVCHDMNADSIFKNDMTYEKFLNKKYNIILSPNEKLSPLIKVIRLTTIQSCVNKERRFLRNNRKLQRINESECYFVPSLTECISLSSSLWTQLCIFPTIHHRMNQILSIEDFAHDLEFMNLIENSDCFEINFDDCYNIENIESSIYDPNVLKFINNIFPCFMAKTCNDRTNLEQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVVKNSDESVEVNNSREFILIKNKNLADCCEAIIGSILTNYGIDYSIQYLQWLNLPLVPDNELNADIEISPKLAFQNISMDTDIPQSINDLEKILNYHFKNKGYIVQAITHPSSIANRKFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYLNYFDSK+
Sbjct:    1 MLIKDYLNVKSDKKIFFLVKNSSLVHQHTNSLKDYLFLKDEIGYFYGQMENSWVDNWTKDKWSKKISKYKIIVMTAKVFLDILNHNKYNLSQVCYLIFDEVHHLTKSDDYSQISEHVIRTTSDIKILGLTACLIKGVKHVKDIEFAVKQLEHKLNCKVITSMDNIAREFCGNIKETIINYETESFPDLVAIFKSAIEKIESFIPVDGHHSNDNSGSLNAEQNNFKTLKKYLSESFSVLSTLGLVPCKLITDMFIEDLHGAVNNDSMFFDEKTKLYLDEFLSCLKFINSNIESYISKSDMLMCSEKCKKLINLILDLKSKNEDFKNTISILIFINEKIHVLALNVLLGILPKINKAFDFINSNFIIGHSTSQYPKKLQMSVTKQLEILKLFKEKKFNILIATNVIEEGLDVSHCNIVVKFDPPQDFRSYLQSKGRARAQNSQYIVFTHETQKTEAQIQKFNLINEELNKILKSRVIEDELNKDDSERNVTPSEDDKYDYVPYGENGPRITLNSASSVLNRYLGKLRCNSISEPKIIYTYFQDEFNFHHVSLLLPMPAPYLEEIKGLPCSNKRRAKQFVNLEACKILHKYDELDSSLLPYNRFDNNLVIQESNDIEIIKYEKYTATKLSTKFQNLSIPANKLYLYSIKYTPSVFLKLGINDISMFDVSTYLGILLPNPIHQNKDFMKFPIYLVGGMTSVEIKFEYNLPVNSINYSLLLKCHKILFNIYSERIRRFDKNIFFDPSKAKSSIILTILKDNKIDFNKIKEIITNPIVDNLIKNDQSSWVGSVIRPNYITNEFGAFVISKVCHDMNADSIFKNDMTYEKFLNKKYNIILSPNEKLSPLIKVIRLTTIQSCVNKERRFLRNNRKLQRINESECYFVPSLTECISLSSSLWTQLCIFPTIHHRMNQILSIEDFAHDLEFMNLIENSDCFEINFDDCYNIENIESSIYDPNVLKFINNIFPCFMAKTCNDRTNLEQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVVKNSDESVEVNNSREFILIKNKNLADCCEAIIGSILTNYGIDYSIQYLQWLNLPLVPDNELNADIEISPKLAFQNISMDTDIPQSINDLEKILNYHFKNKGYIVQAITHPSSIANRKFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYLNYFDSKI 1235          

HSP 2 Score: 113.62 bits (283), Expect = 7.387e-27
Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = 3
Query: 3891 CNASIHIKSEQYKVVVKVLGDIFESIAGAIFVDSNYDLKAVWTVYKVFMEEPLK 4052
            CNASIHIKSEQYKVVVKVLGDIFESIAGAIFVDSNYDLKAVWTVYKVFMEEPLK
Sbjct: 1236 CNASIHIKSEQYKVVVKVLGDIFESIAGAIFVDSNYDLKAVWTVYKVFMEEPLK 1289          

HSP 3 Score: 28.4906 bits (62), Expect = 7.387e-27
Identity = 12/13 (92.31%), Postives = 13/13 (100.00%), Query Frame = 1
Query: 4075 EIKYQCYMKNILK 4113
            +IKYQCYMKNILK
Sbjct: 1289 KIKYQCYMKNILK 1301          
BLAST of Endoribonuclease Dicer vs. Planmine SMEST
Match: SMESG000069643.1 (SMESG000069643.1)

HSP 1 Score: 160.614 bits (405), Expect = 8.299e-50
Identity = 99/298 (33.22%), Postives = 163/298 (54.70%), Query Frame = 2
Query: 3044 CNDRTNLEQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNF-VVKNSDESVEVNNS------REFILIKNKNLADCCEAIIGSILTNYGIDYSIQYLQWLNLPLVPDNELN--------ADIEISPKLAFQNISMDTD--------IPQSINDLEKILNYHFKNKGYIVQAITHPSSIANRKFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYLNYFDSKMFHILPKVV 3868
             +D  NLE+ E +GDSFLK+ ++ Y F       +EG+L+  RS+ +SN NL+  A +K L  +     FNP+ N++ P +   +N D S  +N +      R    + +KNLAD  E++ G  L   G   +++ LQW N+  +P +E          +D+ I P+     + ++TD        + + +  LE ++ Y F+ K Y++QA+TH S   N    CYQRLE LGD+V+D+ +T ++  +  + +PG +T+LRSALVNNN FA L V++  H+Y       ++ ++ K V
Sbjct: 1333 ASDFINLERMETVGDSFLKYASTVYNF-LRYPYAHEGRLSYLRSKQVSNSNLYLRAKEKNLAGFLNSQKFNPQDNWMLPGYKYTENIDVSQIINENYSNFCPRIQHFLTDKNLADVVESLTGCYLATRGEISALRLLQWFNINCIPIDEKATPGDTGKVSDLWIKPESPI-TVKLETDNDKICYNNLIKDVIGLEAVIGYRFREKAYLLQAMTHSSYYLNVFTDCYQRLELLGDAVLDYTITRFLYEDCMRHSPGDLTDLRSALVNNNIFASLVVRYNIHQYFKCMSPVLWKLIDKFV 1628          

HSP 2 Score: 58.5362 bits (140), Expect = 8.299e-50
Identity = 25/61 (40.98%), Postives = 40/61 (65.57%), Query Frame = 3
Query: 3933 VVKVLGDIFESIAGAIFVDSNYDLKAVWTVYKVFMEEPLKKFFNNIPRNKISMLHEKYPQM 4115
            + K LGD+FES+AGAIF+DS  DL  VW V+     E ++++ + IP++ +  L E  P++
Sbjct: 1665 IPKCLGDVFESLAGAIFLDSGMDLNIVWKVFHPLFHERIERYTSLIPKSPVRQLLEAMPEI 1725          

HSP 3 Score: 75.485 bits (184), Expect = 3.415e-13
Identity = 135/608 (22.20%), Postives = 248/608 (40.79%), Query Frame = 2
Query: 1361 LDVSHCNIVVKFDPPQDFRSYLQSKGRA-----------RAQNSQYIVFTHETQKTEAQIQKFNLINEE-----LNKILKSRVIE----DELNKDDSERNVTPSEDDKYDYVPY---------------GENGPRITLNSASSVLNRYLGKLRCNSISE--PKI-IYTYFQDEFNFHHVSLLLPMPAPYLEEIKGLPCSNKRRAKQFVNLEACKILHKYDELDSSLLPYNRFDNNLV--IQESNDIE-------------IIKYEKYTATKLSTKFQNLSIPANKLYLYSI-----KYTPSVFLKLGINDISMFDVSTYLGILLPNPIHQNKDFMKFPIYLVGGMTSVEIKFEYNLPVNSIN---------YSLLLKCHKILFNIYSERIRRFDKNIFFDPSKAKSSIILTILKDN---KIDFNKIKEII-------------TNPIVDNLIKNDQSSWVGSVIRPNYIT-NEFGAFVISKVCHDMNADSIFKND--MTYEKFLNKKYNIILSPNEK--LSPLIKVIRLT-TIQSCVN-----------KERRFLRNNRKLQRINESECYFVPSLTECISLSSSLWTQLCIFPTIHHRMNQILSIEDF 2884
             D+  CN+V++FDP  + + Y   K R            +A +S     +H + +++A++   ++I++E     L+ +   R +E    + +NK  S ++     DD  +  P                G +   +TL+ A +++N Y  +L  +S ++  P++ I      +   +   L LP+ +P+    KG        AK    L+  K L+   ELD+   P+N+ DN  V  I ESN ++                YE+  A  +ST   + + P    Y+YSI     +  P      G   +   D +   GI+           +KFPI+   G   V+IK    LP+NS +         +  +L+ H IL  I S    + DK +  D   A   ++L  L  N    +D+  I  +I             T    + + + ++  +  +V+ P+Y   +    + ++ +C +M   + F  +   T+ ++  KKY   ++  ++  L     V+RL  TI   VN            +++F R +      N  + + +P L       ++ W +    PTI HR+NQ+L  E+ 
Sbjct:  587 FDLQKCNLVIRFDPVLNLQQYFSCKSRVGIITNAASMLRKANSSVADAISHLSDRSKAKL--IHMISKEDKHSILSHLEDYRKVETGIINRINKVSSHKS-----DDHMNQNPVVNIDVNSLENPIQSTGIDSQEVTLSQAIALVNLYCARLPTDSFTKLTPELSIECDKNSQKALYRCQLRLPINSPHRLVTKGKWMPTISTAKMSSALQTLKQLYDLRELDNHFYPWNKEDNREVVSIAESNKLDENIGGMLMGSSKCRYCYERQFAKCISTTPISPNTPC---YMYSINLELSRKIPDEQNLKGRKIMISADEAKDFGIICGQTGLDKT--LKFPIFTRSGEEEVQIK--QLLPLNSCDETWTFNEKEFQKILEFHHIL--ITSVFRLKLDKGMVLDLEDAVIKLLLVPLNKNVPGHVDWEFIDLVIRSYNSVENVCRLETRRKPNGMFEFNELDYQNAVVMPSYRNFDHRQYYYVADICWNMRPTTDFPGEHFSTFAEYYTKKYGAKITNYQQPLLDADFSVMRLNLTIPRHVNFKGVPLPVPSAAKKKFFRES------NSQKQFLIPELCYIHPFPATFWHKAASMPTIMHRINQLLLAEEL 1172          
BLAST of Endoribonuclease Dicer vs. Planmine SMEST
Match: SMESG000016950.1 (SMESG000016950.1)

HSP 1 Score: 85.5001 bits (210), Expect = 2.019e-16
Identity = 146/573 (25.48%), Postives = 257/573 (44.85%), Query Frame = 2
Query:   47 RDYQIEIYNKAKNENVIIKLNTGSGKTFIASMLIKDYLNVKSDKKIFFLVKNSSLVHQHTNSLKDYLFLKDEIGYFYGQMEN--------SWVDNWTXXXXXXXXXXXXXXVMTAKVFLDILNHNKYNLSQVCYLIFDEVHHLTKSDDYSQI-------SEHVIR------TTSDI-------------------KILGLTACLIKGVKHVKDIEFAVKQLEHKL-NCKVITSMDNIAR--EFCG--NIKETIINYETESFPDLVAIFKS----AIEKIESFIPVDGHH---SNDNSGSLNAEQNNFKTLKKYLSESFSVLSTLGLVPCKLITDMF-IEDLHGAVNN----------DSMFFDEKTKLYLDEFLSCLKFINSNIESYISKSDMLMCSEKCKKLINLIL-DLKSKNEDFKNTISILIFINEKIHVLALNVLLGILPKINKAFDFINSNFIIGHSTSQYPKKLQ-MSVTKQXXXXXXXXXXXXXXXXATNVIEEGLDVSHCNIVVKFDPPQDFRSYLQSKGRARAQNSQYIVFTHETQKTEAQIQKFNLINEELNKILKSRVIED 1570
            R YQ+EIY KA  ++ +I L TG+GKTFIA+ML+   L      ++ FLV    LV Q + S K   F    +  F  Q +         S  +          I  + +I+ TA  F +ILN  +   +    ++ DE HH  K   Y+++        +HV+       + SDI                   KI+GLTA     +   K  E  +K L H L +  ++T  +NI    EF    N++  I++Y  ES  DL  +  +     ++K E  +   G+    S+D S ++  E NN K      S+   +L  +  +   ++  +  + D+  A++N          D +  +E   ++ D  +   K I+   +       +L   ++   +IN I+ + KS  ++ +   +IL+ + E+            L K    F+F     I+GH       K + MSV +Q + L   +EKK  I+IAT+V++EG+D+  C++V+  +PP   ++ +Q +GRAR ++S+ ++   + QKT   + +     E +NK ++  + E+
Sbjct:  278 RKYQLEIYEKANGKDCVIFLPTGTGKTFIAAMLMLKMLEENPFHRVAFLVDKVLLVMQQSKSFKGQ-FEDICLERFESQEKTVTRKLKLISLANELIDSDHKCSIRDHDVIIATADFFKNILNKQQIYWTDFSLVVLDEAHHCVKEHPYNKLLFEYHLYPQHVLLNKNELLSVSDIQSPPEIISSELEEWKIRRCKIIGLTASPSGELDFDKTYEL-LKALLHSLGDVGIVTVTENIDELNEFTSLTNMESRIVSY-GESEKDLRKLMTTNFVFLLKKFERRVNGIGNGLILSSDTSLTI-EEINNLK------SQLSGLLVDVQEIQKSILNHILALVDIIEAIDNIGYTIAKKKFDEILENENETVWYDNNIFNFKTISKEFQ-------LLHQEQENSSIINEIVKECKSLQDENR---TILVLVEERRDAREYK---NSLEKEKLNFEF---QLIVGHGGKGAKSKHKGMSVGEQKKALDFIREKKSQIIIATSVVDEGIDLPQCDLVITVNPPASVQALVQIRGRARKKDSRLLMLCRD-QKTIDILHELMKKEENINKAIEKLISEN 823          
BLAST of Endoribonuclease Dicer vs. Planmine SMEST
Match: SMESG000014289.1 (SMESG000014289.1)

HSP 1 Score: 73.9442 bits (180), Expect = 8.329e-13
Identity = 73/264 (27.65%), Postives = 123/264 (46.59%), Query Frame = 2
Query: 3065 EQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLISNKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVVKNSDESVEVNNSREF----ILIKNKNLADCCEAIIGSILTNYGIDYSIQYLQWLNLPLVPDNE--LNADIEISPKLAFQNISMDTDIPQSINDLEKILNYHFKNKGYIVQAITHPSSIANRKFSCY-----QRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYL 3823
            E+ E LGD+ ++ ITS +LF+   +  +EG L   R  L+ N  L  L+ + G   Y  YT+ N  ++Y          D ++    S  F      I      D  + I GS L  +  D  I  + W  +PL P  E  LN D         +++  ++ + +++  LE  L   FK+   + +A+T    I    ++ +     QRLEFLGDS++ +L T Y+  +  + + G I+ LR+ LVN  T A +  + G  +++
Sbjct: 1104 ERLECLGDAVIELITSVHLFYMFPEL-SEGHLDAFRQSLVQNHYLAELSVRLGFHNYILYTH-NMDFSY----------DSTITHARSDGFEAVMAAITLDGGLDEADRIFGSAL--FADDPRIHKV-WCEIPLHPLQEQFLNGD---------RHVIRNSPLFENLTKLEDRLGIRFKHIRLLAKAMT----IRKTGYNLFTLGDNQRLEFLGDSLLKYLTTDYLFKHFPRHHEGHISLLRNTLVNRYTQATVCTELGLDEFI 1339          

HSP 2 Score: 53.9138 bits (128), Expect = 1.246e-6
Identity = 33/112 (29.46%), Postives = 59/112 (52.68%), Query Frame = 2
Query: 3578 FKNKGY--IVQAITHPSSIANRKFSCY--QRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFAYLSVKFGFHKYLNY-------FDSKMFHILPKVVEELL 3880
            F+ KG   +VQ ++H       + + +  +RLE LGD+VI+ + ++++     +L+ G +   R +LV N+  A LSV+ GFH Y+ Y       +DS + H      E ++
Sbjct: 1075 FRKKGLSKMVQVMSHLPYWHETRSNIFGNERLECLGDAVIELITSVHLFYMFPELSEGHLDAFRQSLVQNHYLAELSVRLGFHNYILYTHNMDFSYDSTITHARSDGFEAVM 1186          
The following BLAST results are available for this feature:
BLAST of Endoribonuclease Dicer vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DICER13.091e-5625.40dicer 1, ribonuclease III [Source:HGNC Symbol;Acc:... [more]
DICER17.918e-5625.47dicer 1, ribonuclease III [Source:HGNC Symbol;Acc:... [more]
DICER17.918e-5625.47dicer 1, ribonuclease III [Source:HGNC Symbol;Acc:... [more]
DICER17.918e-5625.47dicer 1, ribonuclease III [Source:HGNC Symbol;Acc:... [more]
DICER17.918e-5625.47dicer 1, ribonuclease III [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Endoribonuclease Dicer vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dcr-16.052e-4827.15Endoribonuclease dcr-1 Death-promoting deoxyribonu... [more]
dcr-16.052e-4827.15Endoribonuclease dcr-1 Death-promoting deoxyribonu... [more]
drsh-13.536e-924.44Ribonuclease 3 [Source:UniProtKB/Swiss-Prot;Acc:O... [more]
drsh-13.653e-924.44Ribonuclease 3 [Source:UniProtKB/Swiss-Prot;Acc:O... [more]
drh-11.678e-626.67Dicer Related Helicase [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of Endoribonuclease Dicer vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Dcr-14.164e-4133.50gene:FBgn0039016 transcript:FBtr0084324[more]
Dcr-23.994e-3123.95gene:FBgn0034246 transcript:FBtr0340217[more]
Dcr-24.385e-3123.95gene:FBgn0034246 transcript:FBtr0086904[more]
drosha3.078e-1125.00gene:FBgn0026722 transcript:FBtr0088850[more]
back to top
BLAST of Endoribonuclease Dicer vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dicer15.062e-5825.30dicer 1, ribonuclease type III [Source:NCBI gene;A... [more]
dicer11.376e-5725.21dicer 1, ribonuclease type III [Source:NCBI gene;A... [more]
dicer12.259e-5425.98dicer 1, ribonuclease type III [Source:NCBI gene;A... [more]
drosha2.486e-1524.91drosha ribonuclease III [Source:ZFIN;Acc:ZDB-GENE-... [more]
drosha2.486e-1524.91drosha ribonuclease III [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Endoribonuclease Dicer vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cox6b12.627e-5725.12cytochrome c oxidase subunit VIb polypeptide 1 (ub... [more]
cox6b13.064e-5725.12cytochrome c oxidase subunit VIb polypeptide 1 (ub... [more]
cox6b13.226e-5725.12cytochrome c oxidase subunit VIb polypeptide 1 (ub... [more]
cox6b11.670e-5624.95cytochrome c oxidase subunit VIb polypeptide 1 (ub... [more]
cox6b13.841e-5424.75cytochrome c oxidase subunit VIb polypeptide 1 (ub... [more]
back to top
BLAST of Endoribonuclease Dicer vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dicer17.994e-6025.33dicer 1, ribonuclease type III [Source:MGI Symbol;... [more]
Dicer13.171e-2026.33dicer 1, ribonuclease type III [Source:MGI Symbol;... [more]
Drosha1.047e-1527.04drosha, ribonuclease type III [Source:MGI Symbol;A... [more]
Drosha1.047e-1527.04drosha, ribonuclease type III [Source:MGI Symbol;A... [more]
Ddx581.873e-1122.28DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 [Source:... [more]
back to top
BLAST of Endoribonuclease Dicer vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P84634|DCL4_ARATH7.337e-7425.20Dicer-like protein 4 OS=Arabidopsis thaliana OX=37... [more]
sp|A2RAF3|DCL1_ASPNC1.726e-6124.35Dicer-like protein 1 OS=Aspergillus niger (strain ... [more]
sp|Q4WVE3|DCL1_ASPFU1.605e-6024.06Dicer-like protein 1 OS=Neosartorya fumigata (stra... [more]
sp|A1CBC9|DCL1_ASPCL5.124e-6023.14Dicer-like protein 1 OS=Aspergillus clavatus (stra... [more]
sp|Q6TUI4|DICER_BOVIN5.230e-5925.64Endoribonuclease Dicer OS=Bos taurus OX=9913 GN=DI... [more]
back to top
BLAST of Endoribonuclease Dicer vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2S1PRV82.210e-11627.77Putative dicerB OS=Actinia equina OX=6106 PE=2 SV=... [more]
A0A131YTU71.065e-11227.02Endoribonuclease Dicer OS=Rhipicephalus appendicul... [more]
H6WZT12.843e-11227.75Dicer-2 OS=Penaeus japonicus OX=27405 GN=Dcr2 PE=2... [more]
R9R7R63.740e-11227.83Dicer 2 OS=Penaeus monodon OX=6687 PE=2 SV=1[more]
U3MHS92.470e-11026.28Dicer 1 OS=Nematostella vectensis OX=45351 PE=2 SV... [more]
back to top
BLAST of Endoribonuclease Dicer vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dicer12.562e-5925.43dicer 1, ribonuclease III [Source:NCBI gene;Acc:10... [more]
drosha3.436e-1524.91drosha ribonuclease III [Source:NCBI gene;Acc:1030... [more]
drosha3.524e-1525.28drosha ribonuclease III [Source:NCBI gene;Acc:1030... [more]
drosha3.836e-1525.28drosha ribonuclease III [Source:NCBI gene;Acc:1030... [more]
drosha1.116e-1324.51drosha ribonuclease III [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of Endoribonuclease Dicer vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dicer11.435e-2826.22dicer 1, ribonuclease type III [Source:NCBI gene;A... [more]
DDX586.622e-723.43DExD/H-box helicase 58 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Endoribonuclease Dicer vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
MPH12.011e-824.573'-5' DNA helicase involved in error-free bypass o... [more]
back to top
BLAST of Endoribonuclease Dicer vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO356511.332e-2554.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO365598.708e-2338.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO327462.868e-1825.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO323674.737e-1124.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471776.060e-927.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Endoribonuclease Dicer vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dicer11.009e-5224.25dicer 1, ribonuclease III [Source:NCBI gene;Acc:10... [more]
dicer11.770e-4236.60dicer 1, ribonuclease III [Source:NCBI gene;Acc:10... [more]
drosha2.668e-1426.37drosha ribonuclease III [Source:NCBI gene;Acc:1011... [more]
drosha2.668e-1426.37drosha ribonuclease III [Source:NCBI gene;Acc:1011... [more]
drosha2.668e-1426.37drosha ribonuclease III [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Endoribonuclease Dicer vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000073604.18.226e-21100.00SMESG000073604.1[more]
SMESG000073604.17.387e-2799.92SMESG000073604.1[more]
SMESG000069643.18.299e-5033.22SMESG000069643.1[more]
SMESG000016950.12.019e-1625.48SMESG000016950.1[more]
SMESG000014289.18.329e-1327.65SMESG000014289.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016368 ID=SMED30016368|Name=Endoribonuclease Dicer|organism=Schmidtea mediterranea sexual|type=transcript|length=4352bp
CTAAGAATAAAATATAATTTCGTAAAATTTTAGTTTTATGAAAACTAGGG
ATTATCAAATTGAAATATACAATAAAGCAAAAAATGAAAATGTAATAATT
AAATTAAACACTGGATCGGGCAAAACGTTTATCGCATCAATGCTTATTAA
AGATTATTTAAATGTAAAATCAGATAAAAAGATATTTTTCCTTGTTAAAA
ATTCATCGCTAGTACATCAACATACTAATTCATTGAAAGATTACTTATTT
TTAAAAGATGAAATAGGTTATTTTTATGGTCAAATGGAAAATTCATGGGT
AGATAATTGGACAAAGGATAAATGGTCCAAAAAAATTTCCAAATATAAAA
TTATAGTAATGACAGCTAAAGTTTTTTTAGACATACTTAATCATAATAAG
TATAACTTAAGTCAAGTTTGCTATTTAATATTTGATGAAGTTCATCATTT
AACAAAGTCAGATGATTATTCACAGATTTCGGAGCATGTAATTAGAACAA
CAAGTGATATAAAAATTTTAGGCTTAACTGCATGTTTAATAAAAGGAGTG
AAACATGTTAAGGACATTGAATTTGCAGTTAAGCAGCTTGAACATAAATT
AAATTGTAAAGTTATAACATCTATGGACAATATTGCACGCGAATTTTGTG
GGAATATTAAAGAAACTATTATCAATTATGAAACAGAAAGTTTTCCAGAT
TTAGTTGCTATATTCAAATCAGCAATAGAGAAAATAGAAAGCTTTATTCC
AGTCGACGGACATCATTCCAATGATAATTCAGGATCTCTAAATGCTGAAC
AAAATAATTTTAAAACACTTAAAAAGTATTTAAGTGAAAGTTTTTCTGTG
CTTAGTACATTGGGTCTTGTACCATGCAAGTTGATAACTGACATGTTTAT
TGAAGATTTACACGGAGCCGTTAATAATGATAGCATGTTCTTCGATGAGA
AAACTAAATTATACTTGGATGAATTTTTATCATGTTTAAAGTTTATCAAT
TCCAATATAGAGTCCTATATATCGAAATCTGATATGCTTATGTGTTCAGA
AAAATGTAAAAAATTAATAAATTTGATTTTGGATTTGAAATCCAAGAATG
AAGATTTTAAAAATACAATTTCTATTTTGATTTTTATTAATGAAAAGATA
CATGTACTAGCATTGAATGTACTACTTGGTATTTTGCCAAAAATAAACAA
AGCTTTTGATTTTATAAATTCAAATTTTATTATTGGACATTCAACCAGCC
AGTATCCAAAAAAGTTACAAATGTCTGTCACTAAACAACTAGAGATATTA
AAACTTTTCAAAGAAAAAAAATTTAATATACTTATTGCTACAAATGTGAT
TGAAGAAGGTCTTGACGTATCTCATTGTAATATTGTGGTTAAATTTGACC
CACCACAGGATTTTCGATCATATTTACAATCTAAAGGTAGAGCTCGTGCG
CAGAATTCCCAATACATTGTTTTTACTCACGAAACACAGAAAACAGAGGC
TCAAATACAAAAATTTAACCTAATAAACGAAGAACTGAATAAAATTTTAA
AGTCCAGAGTTATTGAAGATGAATTAAATAAAGATGATAGTGAAAGAAAT
GTTACTCCTTCTGAAGATGATAAATATGATTATGTTCCTTATGGTGAAAA
TGGACCTAGAATTACTCTGAATAGCGCTTCTAGTGTTTTAAATAGATATC
TTGGAAAGCTAAGATGTAATAGTATAAGTGAACCAAAAATCATCTATACA
TATTTTCAAGATGAATTTAATTTTCATCATGTCTCACTTCTTTTACCAAT
GCCTGCCCCTTATTTAGAAGAAATAAAAGGTTTACCATGTTCCAATAAAA
GAAGAGCTAAGCAATTCGTTAATTTAGAAGCATGTAAAATATTGCATAAA
TATGATGAACTTGACTCGTCATTATTACCATATAATAGATTTGATAACAA
TTTAGTTATTCAAGAAAGTAATGACATCGAAATCATTAAATATGAGAAAT
ATACGGCCACAAAACTAAGCACGAAATTTCAAAATTTATCTATCCCAGCA
AATAAATTGTATTTATATTCAATAAAATACACTCCTTCTGTGTTTTTGAA
ACTTGGAATCAATGATATATCTATGTTTGATGTTTCTACATATTTAGGAA
TATTATTACCGAATCCTATTCATCAAAATAAAGATTTTATGAAATTTCCA
ATTTATCTTGTTGGTGGGATGACTTCGGTTGAAATTAAATTCGAATATAA
CTTACCAGTAAATTCTATAAATTATTCATTACTTTTAAAGTGTCATAAAA
TTTTGTTTAATATATATTCGGAACGGATTAGAAGATTTGATAAAAACATA
TTTTTTGATCCTTCCAAAGCTAAAAGTTCAATCATTCTTACTATATTAAA
AGATAATAAAATTGATTTTAATAAAATTAAAGAAATTATAACAAATCCAA
TTGTGGATAATTTGATTAAAAATGACCAAAGTTCTTGGGTTGGTTCAGTT
ATTAGACCTAATTATATAACTAATGAATTTGGTGCATTTGTCATATCAAA
GGTTTGCCATGATATGAATGCTGATTCTATTTTTAAAAATGATATGACTT
ATGAAAAATTTTTAAATAAAAAATATAATATAATTTTAAGCCCCAATGAA
AAGTTATCACCACTCATTAAAGTTATTAGATTAACTACTATTCAAAGTTG
TGTTAACAAAGAGAGGAGATTTTTAAGAAATAATAGGAAACTGCAAAGAA
TTAATGAAAGTGAATGTTATTTCGTTCCTTCATTAACTGAATGTATCTCA
TTATCTTCAAGTTTATGGACACAGTTATGTATCTTTCCTACAATTCATCA
TCGAATGAATCAAATCCTCTCCATTGAAGACTTCGCACATGATTTAGAAT
TTATGAATTTAATAGAAAATTCAGATTGCTTTGAAATAAACTTTGATGAT
TGTTACAATATAGAAAATATTGAATCATCCATATATGATCCAAATGTTTT
AAAATTTATCAATAATATTTTCCCGTGTTTTATGGCCAAGACTTGTAATG
ATAGAACAAATTTGGAACAATTTGAAATATTAGGAGATAGTTTCTTAAAA
TTTATTACTTCAAAATATCTCTTTCATTTTTCTAATGATACTGATAATGA
AGGCAAATTGACTCAAAAACGATCTCAGTTAATTTCTAATAAAAATTTAT
TTCATTTGGCAACTCAAAAAGGATTGGACAAATACTTTTGTTACACTAAC
TTCAATCCAAAATATAATTATTTGCCTCCTAACTTTGTTGTTAAAAATTC
TGATGAATCTGTTGAAGTTAATAATAGTAGGGAGTTTATTTTAATTAAAA
ACAAAAATCTGGCTGACTGTTGTGAAGCTATTATTGGATCAATACTTACT
AATTATGGAATCGATTACTCAATTCAATATCTTCAATGGTTAAATTTACC
GTTAGTACCTGATAATGAATTGAATGCCGATATTGAAATCTCGCCAAAAT
TGGCTTTCCAAAATATTTCCATGGACACCGATATTCCACAATCTATTAAT
GATTTAGAAAAAATTCTTAATTATCATTTTAAAAACAAAGGTTATATAGT
TCAAGCCATCACCCACCCTTCATCAATTGCAAACCGGAAGTTTTCTTGTT
ATCAAAGATTAGAGTTTCTTGGCGATTCCGTGATTGACTTTTTGGTGACT
ATATATATTATGCTGAATAATAAAAAGTTGAATCCAGGAAAAATTACAAA
TCTTCGATCAGCTCTAGTTAACAACAATACATTTGCTTATTTATCAGTCA
AATTCGGATTTCATAAATATTTGAATTATTTTGATTCAAAAATGTTTCAT
ATTTTGCCTAAAGTGGTTGAAGAACTGTTAAACAATCAGTTGCAATGCGA
GCATTCATATAAAGAGTGAACAATATAAAGTAGTCGTTAAAGTGCTTGGT
GACATATTTGAATCGATTGCAGGAGCAATATTTGTTGATAGTAATTATGA
TTTAAAAGCTGTGTGGACAGTTTATAAAGTTTTTATGGAAGAACCATTGA
AAAAATTTTTCAATAATATTCCAAGAAATAAAATATCAATGCTACATGAA
AAATATCCTCAAATGAAATGCACATTCGAAAATCAAGAATTCAGTAATCT
GATAAAATTAACTGCTATTCTTCCCAATGGCTCTGTAATAGAGAAATACG
AAAGAAACAAAATACTTTGTAAACTGTCACTGGCTGAAGAATTAAATATT
TAATACTTTCTTTTTATTTTATTACGATTAATACATTTTAGAAAATGTTT
CTGTATTCATATTATTAAGAAAAAATAATCAATATAAATATGTATGTAGT
GG
back to top

protein sequence of SMED30016368-orf-1

>SMED30016368-orf-1 ID=SMED30016368-orf-1|Name=SMED30016368-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1294bp
MKTRDYQIEIYNKAKNENVIIKLNTGSGKTFIASMLIKDYLNVKSDKKIF
FLVKNSSLVHQHTNSLKDYLFLKDEIGYFYGQMENSWVDNWTKDKWSKKI
SKYKIIVMTAKVFLDILNHNKYNLSQVCYLIFDEVHHLTKSDDYSQISEH
VIRTTSDIKILGLTACLIKGVKHVKDIEFAVKQLEHKLNCKVITSMDNIA
REFCGNIKETIINYETESFPDLVAIFKSAIEKIESFIPVDGHHSNDNSGS
LNAEQNNFKTLKKYLSESFSVLSTLGLVPCKLITDMFIEDLHGAVNNDSM
FFDEKTKLYLDEFLSCLKFINSNIESYISKSDMLMCSEKCKKLINLILDL
KSKNEDFKNTISILIFINEKIHVLALNVLLGILPKINKAFDFINSNFIIG
HSTSQYPKKLQMSVTKQLEILKLFKEKKFNILIATNVIEEGLDVSHCNIV
VKFDPPQDFRSYLQSKGRARAQNSQYIVFTHETQKTEAQIQKFNLINEEL
NKILKSRVIEDELNKDDSERNVTPSEDDKYDYVPYGENGPRITLNSASSV
LNRYLGKLRCNSISEPKIIYTYFQDEFNFHHVSLLLPMPAPYLEEIKGLP
CSNKRRAKQFVNLEACKILHKYDELDSSLLPYNRFDNNLVIQESNDIEII
KYEKYTATKLSTKFQNLSIPANKLYLYSIKYTPSVFLKLGINDISMFDVS
TYLGILLPNPIHQNKDFMKFPIYLVGGMTSVEIKFEYNLPVNSINYSLLL
KCHKILFNIYSERIRRFDKNIFFDPSKAKSSIILTILKDNKIDFNKIKEI
ITNPIVDNLIKNDQSSWVGSVIRPNYITNEFGAFVISKVCHDMNADSIFK
NDMTYEKFLNKKYNIILSPNEKLSPLIKVIRLTTIQSCVNKERRFLRNNR
KLQRINESECYFVPSLTECISLSSSLWTQLCIFPTIHHRMNQILSIEDFA
HDLEFMNLIENSDCFEINFDDCYNIENIESSIYDPNVLKFINNIFPCFMA
KTCNDRTNLEQFEILGDSFLKFITSKYLFHFSNDTDNEGKLTQKRSQLIS
NKNLFHLATQKGLDKYFCYTNFNPKYNYLPPNFVVKNSDESVEVNNSREF
ILIKNKNLADCCEAIIGSILTNYGIDYSIQYLQWLNLPLVPDNELNADIE
ISPKLAFQNISMDTDIPQSINDLEKILNYHFKNKGYIVQAITHPSSIANR
KFSCYQRLEFLGDSVIDFLVTIYIMLNNKKLNPGKITNLRSALVNNNTFA
YLSVKFGFHKYLNYFDSKMFHILPKVVEELLNNQLQCEHSYKE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0031047gene silencing by RNA
GO:0006396RNA processing
GO:0090501RNA phosphodiester bond hydrolysis
GO:0090502RNA phosphodiester bond hydrolysis, endonucleolytic
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR036389RNase_III_sf
IPR038248Dicer_dimer_sf
IPR000999RNase_III_dom
IPR001650Helicase_C
IPR014001Helicase_ATP-bd
IPR011545DEAD/DEAH_box_helicase_dom
IPR003100PAZ_dom
IPR005034Dicer_dimerisation_dom
IPR027417P-loop_NTPase
IPR000299FERM_domain
Vocabulary: molecular function
TermDefinition
GO:0004525ribonuclease III activity
GO:0005524ATP binding
GO:0003676nucleic acid binding
GO:0005515protein binding
GO:0016891endoribonuclease activity, producing 5'-phosphomonoesters
GO:0003677DNA binding
GO:0003723RNA binding
GO:0016787hydrolase activity
Vocabulary: cellular component
TermDefinition
GO:0005856cytoskeleton
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR014001Helicase superfamily 1/2, ATP-binding domainSMARTSM00487ultradead3coord: 2..210
e-value: 1.3E-15
score: 67.9
IPR014001Helicase superfamily 1/2, ATP-binding domainPROSITEPS51192HELICASE_ATP_BIND_1coord: 10..185
score: 19.381
IPR001650Helicase, C-terminalSMARTSM00490helicmild6coord: 377..472
e-value: 1.1E-14
score: 64.8
IPR001650Helicase, C-terminalPFAMPF00271Helicase_Ccoord: 340..471
e-value: 4.3E-17
score: 62.4
IPR001650Helicase, C-terminalPROSITEPS51194HELICASE_CTERcoord: 342..512
score: 14.388
IPR000999Ribonuclease III domainSMARTSM00535riboneu5coord: 1185..1290
e-value: 4.2E-11
score: 52.9
coord: 992..1145
e-value: 1.2E-11
score: 54.7
IPR000999Ribonuclease III domainPFAMPF00636Ribonuclease_3coord: 1206..1264
e-value: 8.5E-14
score: 52.1
coord: 1010..1124
e-value: 6.4E-24
score: 84.6
IPR000999Ribonuclease III domainPROSITEPS00517RNASE_3_1coord: 1206..1214
IPR000999Ribonuclease III domainPROSITEPS50142RNASE_3_2coord: 1004..1124
score: 18.556
IPR000999Ribonuclease III domainPROSITEPS50142RNASE_3_2coord: 1170..1262
score: 27.098
IPR000999Ribonuclease III domainCDDcd00593RIBOccoord: 1186..1264
e-value: 8.15748E-26
score: 101.921
IPR000999Ribonuclease III domainCDDcd00593RIBOccoord: 997..1145
e-value: 1.71913E-21
score: 89.5942
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1..236
e-value: 3.0E-51
score: 176.1
NoneNo IPR availableGENE3DG3DSA:2.170.260.10coord: 794..924
e-value: 7.0E-8
score: 34.4
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 329..505
e-value: 7.2E-34
score: 118.6
NoneNo IPR availablePANTHERPTHR14950:SF37ENDORIBONUCLEASE DICERcoord: 3..1265
NoneNo IPR availablePANTHERPTHR14950HELICASE-RELATEDcoord: 3..1265
NoneNo IPR availableCDDcd18034DEXHc_dicercoord: 4..194
e-value: 2.31795E-50
score: 174.762
NoneNo IPR availableCDDcd18802SF2_C_dicercoord: 337..480
e-value: 6.81561E-41
score: 145.427
IPR005034Dicer dimerisation domainPFAMPF03368Dicer_dimercoord: 547..633
e-value: 4.7E-14
score: 52.3
IPR005034Dicer dimerisation domainPROSITEPS51327DICER_DSRBFcoord: 547..639
score: 12.285
IPR003100PAZ domainPFAMPF02170PAZcoord: 806..943
e-value: 4.3E-10
score: 39.5
IPR011545DEAD/DEAH box helicase domainPFAMPF00270DEADcoord: 5..173
e-value: 2.5E-20
score: 73.0
IPR036389Ribonuclease III, endonuclease domain superfamilyGENE3DG3DSA:1.10.1520.10coord: 1164..1293
e-value: 2.6E-40
score: 140.0
IPR036389Ribonuclease III, endonuclease domain superfamilyGENE3DG3DSA:1.10.1520.10coord: 979..1134
e-value: 3.5E-23
score: 83.7
IPR036389Ribonuclease III, endonuclease domain superfamilySUPERFAMILYSSF69065RNase III domain-likecoord: 1168..1276
IPR036389Ribonuclease III, endonuclease domain superfamilySUPERFAMILYSSF69065RNase III domain-likecoord: 995..1143
IPR038248Dicer dimerisation domain superfamilyGENE3DG3DSA:3.30.160.380coord: 542..640
e-value: 5.4E-13
score: 50.7
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 15..479