TNF receptor associated factor-2

Overview
NameTNF receptor associated factor-2
Smed IDSMED30016342
Length (bp)3191
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor associated factor-2 (SMED30016342) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor associated factor-2 (SMED30016342) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor associated factor-2 (SMED30016342) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor associated factor-2 (SMED30016342) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016342

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30016342 SmedASXL_069754SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30016342 SmedASXL_069754SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30016342 dd_Smed_v4_4528_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30016342 dd_Smed_v4_4528_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30016342 dd_Smed_v4_4528_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30016342 dd_Smed_v4_4528_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30016342 dd_Smed_v4_4528_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30016342 dd_Smed_v4_4528_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30016342 dd_Smed_v4_4528_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30016342 dd_Smed_v4_4528_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor associated factor-2 vs. TrEMBL
Match: I1ZID8 (TNF receptor associated factor-2 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 5.839e-23
Identity = 60/173 (34.68%), Postives = 97/173 (56.07%), Query Frame = 3
Query: 1992 ACNSPCGCRFCFDCIEHYLNGNNKFCPGAARFCHLQTINFEKNISEDHPANFRISETVVKCPRENCQFTDELGMIESHMKMCNKGRISCPFLGIGCGKNEIINEEMQAHLNEDNYCHSKLLIDLINNLLSVMESM*N*IFELKRENSLFKQQIVHIELQSTI-KLIDWDFELI 2507
            AC S CGCRFC  CI  Y++  N +CPG    C  + +    NI  D+  N +I++  VKCP E C+   EL  IE H+++C     +CPF  +GC + +++ +++  HL    + HSKL+ID+I+N+ +    +     EL+ + +L K    H + Q+ I  LI+ + E+I
Sbjct:   37 ACQSRCGCRFCSKCIMEYVSRGNLYCPGGTSECKEENLTICSNIHTDYRVNRKIAKMRVKCPEETCKVYCELVDIEEHLRLCTMKSQNCPFFVLGCNQPKMVIQDLTNHLQNGTFQHSKLIIDIISNMRNDFFGLTTKEVELREDINLIKN---HFQSQNEIMMLINSEIEII 206          
BLAST of TNF receptor associated factor-2 vs. TrEMBL
Match: T1E101 (TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 6.675e-19
Identity = 51/157 (32.48%), Postives = 80/157 (50.96%), Query Frame = 3
Query: 1992 ACNSPCGCRFCFDCIEHYLNGNNKFCPGAARFCHLQTINFEKNISEDHPANFRISETVVKCPRENCQFTDELGMIESHMKMCNKGRISCPFLGIGCGKNEIINEEMQAHLNEDNYCHSKLLIDLINNLLSVMESM*N*IFELKRENSLFKQQIVHIE 2462
            AC S CGC +C+ CI  YL+ N+ +CPG    C    +N E ++  +   + RIS  VVKCP   C +T EL  ++ H+  C    + CP + IGC +  ++ +EM  HL +    H++L++   N L S          E+   N   K+ I H++
Sbjct:   41 ACESACGCHYCYTCIRIYLSQNHNYCPGDKTECKEDYLNLEGDVFRNIRLSTRISRIVVKCPNIRCNYTSELLRLKEHLDKCTPESVECPCVTIGCEEEPLLKDEMAKHLTDQVLRHTQLIMSFCNELKS----------EINHNNETTKEDISHLK 187          
BLAST of TNF receptor associated factor-2 vs. TrEMBL
Match: A0A0F7GWW3 (TNF receptor associated factor 4 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 2.700e-12
Identity = 51/174 (29.31%), Postives = 87/174 (50.00%), Query Frame = 3
Query: 2091 HLQTIN---FEKNISEDHPANFRISETVVKCPRENCQFTDELGMIESHMKMCNKGRISCPFLGIGCGKNEIINEEMQAHLNEDNYCHSKLLIDLINNLLSVMESM*N*IFELKRENSLFKQQIVHIELQSTIKLIDWDFELIFVIQKIFNIESNEMNNNGEIEQANEDMIASKN 2603
             +QT N     +NI  D+P N +I++  VKC  ++C + DEL  +E H + C    ++CP+  IGC K  I  +++  HL  + + H+KLL+D + N  + ME +      L   N L + +I  ++L    + ++           I +++    N   EIE  NED+ A +N
Sbjct:    3 RMQTXNAPILNENICVDYPMNMKIAKLQVKCKEKSCDYVDELRKMEDHSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFVHTKLLMDFVVNFNNEMEMLKANNNGLSPVNELLRNEINELKLDGDRRRVE-----------IGDLQRKCANQAEEIELLNEDIPALRN 165          
BLAST of TNF receptor associated factor-2 vs. TrEMBL
Match: A0A3P7NHM8 (Reverse transcriptase domain-containing protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS18020 PE=4 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 5.373e-8
Identity = 46/104 (44.23%), Postives = 63/104 (60.58%), Query Frame = -2
Query: 1283 LKVTSLFTNVXXXXXXXXXXXLWRENMFEYQTLEEVVFCELLMFATYNVAFLFNDK*YQ*VDGVDKGSSLAPILASIFLSKLEK-QISEFPFIKPKIYKRYVDD 1591
            L V+SLFTNV + +T +  C+    N  E   +   V  ELL+  T NV FLF+ + Y+ +DGV  GS L P+LA IF+ KLEK Q+++   +  K Y RYVDD
Sbjct:    4 LDVSSLFTNVMVTETIEYLCEFLVSNQLEI-GIPTNVLKELLLKCTLNVQFLFDSQIYRQIDGVAMGSPLGPLLADIFIGKLEKFQLNDQIHML-KHYGRYVDD 105          
BLAST of TNF receptor associated factor-2 vs. TrEMBL
Match: A0A5J4NL57 (Reverse transcriptase domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0004707 PE=4 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.024e-7
Identity = 33/64 (51.56%), Postives = 46/64 (71.88%), Query Frame = -2
Query: 1283 ELLMFATYNVAFLFNDK*YQ*VDGVDKGSSLAPILASIFLSKLEKQISEFPFIKPKIYKRYVDD 1474
            +LL+  T NV+F+F D  Y+ +DGV  GS L PILA IF++KLE+Q++E      ++YKRYVDD
Sbjct:   90 QLLLLCTKNVSFVFQDSAYRQIDGVAMGSPLGPILADIFVAKLEQQVTER-LSSVQLYKRYVDD 152          
BLAST of TNF receptor associated factor-2 vs. Planmine SMEST
Match: SMESG000015001.1 (SMESG000015001.1)

HSP 1 Score: 312.768 bits (800), Expect = 9.734e-97
Identity = 178/238 (74.79%), Postives = 195/238 (81.93%), Query Frame = 3
Query: 1887 MFTSLWKMMKENKFEFDNEISSDXXXXXXXXXXXXACNSPCGCRFCFDCIEHYLNGNNKFCPGAARFCHLQTINFEKNISEDHPANFRISETVVKCPRENCQFTDELGMIESHMKMCNKGRISCPFLGIGCGKNEIINEEMQAHLNEDNYCHSKLLIDLINNLLSVMESM*N*IFELKR-------ENSLFKQQIVHIEL---------QSTIKLIDWDFELIFVIQKIF--NIESNE 2546
            MF SLWK+MKENKFEFD+EISSDLICKICKCLIIKACNSPCGCRFCFDCIEHYLNGNNKFCPGAARFCHLQTI+FEKNISEDHPANFRISETVVKCPRENCQFTDELGMIESHMKMCNKGRISCPFLGIGCGKNEIINEEMQAHLNEDNY H+KLLIDLINNL + MESM   I E++R       E +  K++I+ ++          ++ +KLID     I  IQ  F   IE N+
Sbjct:    1 MFASLWKVMKENKFEFDDEISSDLICKICKCLIIKACNSPCGCRFCFDCIEHYLNGNNKFCPGAARFCHLQTIHFEKNISEDHPANFRISETVVKCPRENCQFTDELGMIESHMKMCNKGRISCPFLGIGCGKNEIINEEMQAHLNEDNYYHTKLLIDLINNLRNEMESMKLNICEMERKEIESKGEIAKLKKEILAVKDENRFFRSGNEANVKLIDEMRRQIETIQTKFQPQIEDNQ 238          
BLAST of TNF receptor associated factor-2 vs. Planmine SMEST
Match: SMESG000015001.1 (SMESG000015001.1)

HSP 1 Score: 297.36 bits (760), Expect = 4.100e-91
Identity = 172/230 (74.78%), Postives = 188/230 (81.74%), Query Frame = 3
Query: 1911 MKENKFEFDNEISSDXXXXXXXXXXXXACNSPCGCRFCFDCIEHYLNGNNKFCPGAARFCHLQTINFEKNISEDHPANFRISETVVKCPRENCQFTDELGMIESHMKMCNKGRISCPFLGIGCGKNEIINEEMQAHLNEDNYCHSKLLIDLINNLLSVMESM*N*IFELKR-------ENSLFKQQIVHIEL---------QSTIKLIDWDFELIFVIQKIF--NIESNE 2546
            MKENKFEFD+EISSDLICKICKCLIIKACNSPCGCRFCFDCIEHYLNGNNKFCPGAARFCHLQTI+FEKNISEDHPANFRISETVVKCPRENCQFTDELGMIESHMKMCNKGRISCPFLGIGCGKNEIINEEMQAHLNEDNY H+KLLIDLINNL + MESM   I E++R       E +  K++I+ ++          ++ +KLID     I  IQ  F   IE N+
Sbjct:    1 MKENKFEFDDEISSDLICKICKCLIIKACNSPCGCRFCFDCIEHYLNGNNKFCPGAARFCHLQTIHFEKNISEDHPANFRISETVVKCPRENCQFTDELGMIESHMKMCNKGRISCPFLGIGCGKNEIINEEMQAHLNEDNYYHTKLLIDLINNLRNEMESMKLNICEMERKEIESKGEIAKLKKEILAVKDENRFFRSGNEANVKLIDEMRRQIETIQTKFQPQIEDNQ 230          
BLAST of TNF receptor associated factor-2 vs. Planmine SMEST
Match: SMESG000049503.1 (SMESG000049503.1)

HSP 1 Score: 266.159 bits (679), Expect = 7.711e-79
Identity = 143/246 (58.13%), Postives = 180/246 (73.17%), Query Frame = 3
Query: 1887 MFTSLWKMMKENKFEFDNEISSDXXXXXXXXXXXXACNSPCGCRFCFDCIEHYLNGNNKFCPGAARFCHLQTINFEKNISEDHPANFRISETVVKCPRENCQFTDELGMIESHMKMCNKGRISCPFLGIGCGKNEIINEEMQAHLNEDNYCHSKLLIDLINNLLSVMESM*N-------*IFELKRENSLFKQQIVHIELQSTIKLIDWDFELIFVIQKIFNIESNEMNNNGEIEQANEDMIASKN 2603
            MFT+LWKMM+ENKFE DNEISS+L CKIC  L+IKACN+PCGCRFC +CIE YL+GN+ FCPG A++C +Q INF +N+SEDHP N RISE +VKCPR+NC+   EL M+E HM+ C+K  ISCPF  IGC  NEI+NEEM AHLNE NY HSKL+IDLINN  + MES+ N        + ELKR+N  FKQQI +IE+ S ++ +           KI  +E+ E+ N G+IE+ NE+M+A KN
Sbjct:    1 MFTNLWKMMRENKFESDNEISSELKCKICNRLMIKACNAPCGCRFCSNCIEQYLDGNDNFCPGEAKYCQVQMINFTRNVSEDHPINLRISEVIVKCPRQNCETKTELSMMEEHMRTCDKRPISCPFNSIGCEMNEIVNEEMNAHLNESNYWHSKLIIDLINNFRNEMESLKNENMELRKEMTELKRQNRQFKQQIDNIEMSSNMQKL-----------KICEMETKELENTGKIEEINEEMVAVKN 235          
BLAST of TNF receptor associated factor-2 vs. Planmine SMEST
Match: SMESG000049663.1 (SMESG000049663.1)

HSP 1 Score: 253.447 bits (646), Expect = 1.381e-76
Identity = 136/245 (55.51%), Postives = 178/245 (72.65%), Query Frame = 3
Query: 1887 MFTSLWKMMKENKFEFDNEISSDXXXXXXXXXXXXACNSPCGCRFCFDCIEHYLNGNNKFCPGAARFCHLQTINFEKNISEDHPANFRISETVVKCPRENCQFTDELGMIESHMKMCNKGRISCPFLGIGCGKNEIINEEMQAHLNEDNYCHSKLLIDLINNLLSVMES-------M*N*IFELKRENSLFKQQIVHIELQSTIKLIDWDFELIFVIQKIFNIESNEMNNNGEIEQANEDMIASK 2600
            MFT+LWKMM+ENKFE DNEISSDL+C+ICK L+IKACN+PCGCRFC DCIE YL  N+ FCPG A++C +Q INF +N+SEDHPAN RISE +VKCP +NC+   EL M+E H++ C+K  ISCPF+ IGC  NEI NEE++AHLN+ NY HSKL+IDLINN  + MES       + N + ELK++N   KQQI +IE QST +            QK+  +E+ ++ N  EI++ N++++A K
Sbjct:    1 MFTNLWKMMRENKFESDNEISSDLLCRICKRLMIKACNAPCGCRFCSDCIEQYLKENDNFCPGVAKYCQVQKINFTRNVSEDHPANLRISEVIVKCPTQNCETKTELSMMEEHIRTCDKRPISCPFISIGCEINEIANEEIKAHLNDSNYSHSKLIIDLINNFHNEMESLKNENMELRNEMTELKKKNRQSKQQIDNIEFQSTNQY-----------QKMSEMEAKQLENTEEIKKINKEIVAVK 234          
BLAST of TNF receptor associated factor-2 vs. Planmine SMEST
Match: SMESG000015086.1 (SMESG000015086.1)

HSP 1 Score: 248.44 bits (633), Expect = 3.439e-75
Identity = 152/258 (58.91%), Postives = 190/258 (73.64%), Query Frame = 3
Query: 1887 MFTSLWKMMKENKFEFDNEISSDXXXXXXXXXXXXACNSPCGCRFCFDCIEHYLNGNNKFCPGAARFCHLQTINFEKNISEDHPANFRISETVVKCPRENCQFTDELGMIESHMKMCNKGRISCPFLGIGCGKNEIINEEMQAHLNEDNYCHSKLLIDLINNLLSVMESM*N*IFELKRENSLFKQQIVHIELQSTIKLIDWDFELIFVIQKIFNIESNEMNNNGEIEQANEDMIASKN*N*ML*RERQTNNGSIKDV 2660
            M  S+WK+MKENKF+  NE+S+DLIC ICKCL+IKACN+PCGC FC DCIEHYL+GN+KFCPG A++C  + IN+  +I  D+P N RISE +VKCPR++CQF  ELG+IE+HMK C+K  ISCPF+ +GC KNE++N+EM+AH NEDNY HSKLLIDLINNLLS MESM N I E KREN  FKQQ  +IELQ T              QKI  I+  E NN   IE++NE++ A K+ N  L RE +TN  SI+++
Sbjct:    1 MSESIWKVMKENKFQVGNEVSNDLICGICKCLMIKACNTPCGCCFCSDCIEHYLDGNDKFCPGVAKYCRKKKINYSSDIVIDNPINIRISEEIVKCPRQSCQFKTELGLIENHMKTCDKRPISCPFVEMGCEKNEVMNDEMKAHFNEDNYVHSKLLIDLINNLLSEMESMKNEIIEFKRENMQFKQQTDNIELQITNHK-----------QKIIEIKMKETNNRRRIEESNEEIAALKDENQSLRRETETNVKSIQEI 247          
The following BLAST results are available for this feature:
BLAST of TNF receptor associated factor-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor associated factor-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor associated factor-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZID85.839e-2334.68TNF receptor associated factor-2 (Fragment) OS=Sch... [more]
T1E1016.675e-1932.48TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
A0A0F7GWW32.700e-1229.31TNF receptor associated factor 4 (Fragment) OS=Sch... [more]
A0A3P7NHM85.373e-844.23Reverse transcriptase domain-containing protein OS... [more]
A0A5J4NL571.024e-751.56Reverse transcriptase domain-containing protein OS... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor associated factor-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000015001.19.734e-9774.79SMESG000015001.1[more]
SMESG000015001.14.100e-9174.78SMESG000015001.1[more]
SMESG000049503.17.711e-7958.13SMESG000049503.1[more]
SMESG000049663.11.381e-7655.51SMESG000049663.1[more]
SMESG000015086.13.439e-7558.91SMESG000015086.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016342 ID=SMED30016342|Name=TNF receptor associated factor-2|organism=Schmidtea mediterranea sexual|type=transcript|length=3191bp
CACATCTTAAATTTTGTATTTTTCAACATAATTTTATACCAATTTCAGCC
TTCCAGGGCCTCCTTTTTAATACACGTTTTCTCATACGATATTACAGTGC
AGCATTACAACTAAATACATAACGAAATGTCAATACAGTGATTTGAAACA
TGCTCATTTCCAAATATGAGTTTTTAGGGGGACTAAAGATTTGTGACGTT
TTGCGACGACTTGGCGAGGGGTGAGGGGGGGGGGTAAAAATCAGGCAAAA
TCGCGTTATGAACGGCCCTTTAATTTATTAATTTTGTTCAATTTACCAAT
AATTATATAATTTTTTTTATGTTATAATTTTATTACACCATTGACACCCA
TTTAAAAGAAAGCGTAGATTCCTAGATTTGGAAAACACGAAGCAATTAAA
AAGGGATAGAAGATAATGAATCCATCAACAGCTTGGCCAAAGAACAGCTA
AGAAGCCTAAAACGAATCTCTTGAAAAATCTTTGTGGCTATGTTTTGCAC
AGAAATGGCAAAAGACTCTCAGCTCACACAAAATGTGGAATATATGGACT
ATTTTTGGCCAATGATAGATGGCTAACGCGCTGAAATATTACCGGCAATT
TGGATCTCTACAGTGGTATTTATGCAAGAATTTAGGAAAATAACTAATGA
AGAGAAATACAAATATATGATTTAGATAAAACTGGTAACAATGAAGACAT
TTGAAACTCCATAAGAAAACTGCAACAGAAAGGAAAGAATAACTGCGGAC
AGGAATAAAAATTCTAAGGAAATAATAACTTGATATAGTGTATTAACCTA
AGAATTCATATGTTGTTTTAATTGGAGATTTCTGGACAGGCTAAAAAAGA
TAAAATCAACAAACAAATATTTAGAAAACTAAACTCCTAGATGAAAACGA
TGATATTTGCTTGAATGGATGTCAAGAAGCAATTATTTTCAACAGTCAAT
TGATTCACCAGAGCTAAATTATTATAATATTTCCCTTGTTATATTTATTT
TTTGCATTATTGAGAGAAGATTTTGGAAAGCTACAACCAATTTTGGCCAA
TAGTATTTTGTTCATCTTTTCAAACTCGGTAGTTATAAAAATGAAGATAG
ATCTCCTATAAACTTTTAACATTAATCAAAATTATGATTTCCTGGAACCC
AAATCGTATTTAAATGAAATTGTTAAAGTTTACAGTTGGAAGTTTGATAT
AAAAATAAATAGTTGATTTGGCCATTAAAAGACAATTTTCTCGCATTTCT
ATAATTTATTCATGTCGCAAAAACGGTGTACGATCATCAACGTAACGTTT
ATATATTTTAGGCTTAATAAAAGGAAATTCCGAAATCTGTTTCTCTAATT
TTGAAAGAAAGATTGATGCAAGAATTGGAGCTAAAGATGATCCCTTATCT
ACTCCATCAACTTATTGATACTACTTATCATTAAAAAGAAATGCAACATT
ATAAGTAGCAAACATCAACAATTCACAAAATACAACTTCTTCTAATGTCT
GATACTCAAACATATTCTCTCTCCACAAATCACAACAAAGATCAAAAGTA
TCATCTAGTGTAACATTTGTAAACAAACTAGTTACCTTCAAAAGAATATT
CAGATTAATCTACATCTTGGTTAGTAAAAATAAAATTTTCCACTGACCAA
TGTAAATTTGACCAGCATTTTACGTTCAAGTAGAATGCGGTTATGTGCTT
TGAGCAGTTGCAAGTCGGATTTCTATTCATTGGTTGTATCTGATAGACCA
ATGTTTTGACTTTGGGCGTTGCGGAAAAATTCTGATATTGTAAAATGTAT
GAGAATCCCTTAATGTAAACATTTTAATACTAATTGCAAAAATTCATTTT
CTTATCAGAAATTAATTGTTTTATTTATTTTAGAAAATGTTTACAAGCCT
TTGGAAAATGATGAAAGAAAATAAATTTGAATTTGATAATGAAATCAGCA
GTGATTTAATATGCAAAATTTGCAAATGTTTAATAATAAAAGCCTGCAAC
TCTCCTTGTGGTTGTCGTTTTTGTTTCGATTGCATAGAACATTATTTAAA
TGGAAATAATAAATTCTGTCCTGGAGCAGCGAGATTTTGCCATTTGCAAA
CGATAAATTTTGAGAAAAACATTTCTGAAGATCATCCAGCGAACTTTAGA
ATATCGGAAACCGTTGTAAAATGCCCACGGGAAAATTGTCAATTCACAGA
TGAGTTGGGGATGATTGAGAGCCACATGAAGATGTGTAACAAGGGCCGAA
TCAGTTGCCCATTTCTTGGAATCGGATGTGGAAAAAATGAAATAATTAAT
GAAGAAATGCAAGCCCATCTCAACGAGGACAATTACTGCCATAGCAAATT
ATTGATTGATCTGATCAATAATTTACTAAGTGTGATGGAATCAATGTAAA
ATTAAATTTTTGAATTGAAGAGAGAAAACAGCCTATTCAAACAACAAATT
GTTCATATCGAGTTGCAATCAACAATTAAATTGATTGATTGGGATTTCGA
ATTGATATTTGTGATTCAGAAAATATTCAATATAGAAAGTAATGAGATGA
ACAATAATGGAGAAATAGAGCAAGCGAATGAAGACATGATTGCATCGAAG
AATTAGAATTGAATGTTATGAAGAGAGAGGCAGACAAATAACGGATCAAT
CAAGGATGTTTGATTATTTTTTTCAAACAAAATCGAGCAAGCTTTTTAAT
GAAATAATGGGCAATGGAGTCGACAAAAATTTGTTTAAAATTATTTTATT
GATTTATTTGAATTTAATATTTTCAGGTCGAGGTGAAACTATCCGCAAGT
AAAATTCAACAAATTTAAACAAACTTTAAAATGTTTTTAAAATACTGATT
GGTTCAGACATCTGCAGCATGCGGATTATTTCGGGGCAATCTGGATACAA
AACGTGTTTGTGTGTGTGTGTAATTGATTTCTTGTAATAAGTGTGAATAA
TTGGCGGTTTAAATATGCCGTGACAATTGATGTGATCGGATCAGGAAACG
GAACTGAATAATGACGTTGGAAATATTAAATTGTGTTAATAGTTCAATTA
TATAGAGCCCTCTCTTTAATTTTCATTATATCTCAACAATATATAACCGA
CTGACCTAAAACTCAGGATGATGTTAGAATATGACTATTTACATGTTTTT
GTTTAACTTTAGCTATATAATATGTTCAGATTATTGTTATG
back to top

protein sequence of SMED30016342-orf-1

>SMED30016342-orf-1 ID=SMED30016342-orf-1|Name=SMED30016342-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=171bp
MFTSLWKMMKENKFEFDNEISSDLICKICKCLIIKACNSPCGCRFCFDCI
EHYLNGNNKFCPGAARFCHLQTINFEKNISEDHPANFRISETVVKCPREN
CQFTDELGMIESHMKMCNKGRISCPFLGIGCGKNEIINEEMQAHLNEDNY
CHSKLLIDLINNLLSVMESM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR000477RT_dom
IPR013083Znf_RING/FYVE/PHD
IPR001841Znf_RING
IPR008974TRAF-like
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0004842ubiquitin-protein transferase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006955immune response
GO:0007165signal transduction
GO:0016567protein ubiquitination
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 15..32