Ras-related C3 botulinum toxin substrate 1

Overview
NameRas-related C3 botulinum toxin substrate 1
Smed IDSMED30016340
Length (bp)1042
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ras-related C3 botulinum toxin substrate 1 (SMED30016340) t-SNE clustered cells

Violin plots show distribution of expression levels for Ras-related C3 botulinum toxin substrate 1 (SMED30016340) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ras-related C3 botulinum toxin substrate 1 (SMED30016340) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ras-related C3 botulinum toxin substrate 1 (SMED30016340) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016340

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30016340h1SMcG0007881 Contig485GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30016340h1SMcG0022021 Contig485GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30016340h1SMcG0022021 dd_Smed_v4_913_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30016340h1SMcG0022021 dd_Smed_v4_913_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016340h1SMcG0022021 Contig39025newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016340h1SMcG0022021 Contig39025uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30016340h1SMcG0022021 SMED_02903_V2_1rGPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Human
Match: RAC1 (Rac family small GTPase 1 [Source:HGNC Symbol;Acc:HGNC:9801])

HSP 1 Score: 266.544 bits (680), Expect = 5.319e-89
Identity = 129/194 (66.49%), Postives = 156/194 (80.41%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPRFKFCSLL 668
            M++IKCVVVGDGAVGKTC+LISYTT+AFP  ++PTVFDN SANVM++G P+NLGLWDTAGQE+YDRLRPLSYP+TDVFLICFSLV+  SF NV+ KWY EV H    TPIILVGTKLDLR+++   E  K + + +P+TY QGLA+ +EIGAVKY+ECSA TQ  L+ VF+EAIR V+  P P   R + C LL
Sbjct:    1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEK-KLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLC-PPPVKKRKRKCLLL 192          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Human
Match: RAC2 (Rac family small GTPase 2 [Source:HGNC Symbol;Acc:HGNC:9802])

HSP 1 Score: 261.536 bits (667), Expect = 6.279e-87
Identity = 125/194 (64.43%), Postives = 157/194 (80.93%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPRFKFCSLL 668
            M++IKCVVVGDGAVGKTC+LISYTT+AFP  ++PTVFDN SANVM++  P+NLGLWDTAGQE+YDRLRPLSYP+TDVFLICFSLV+  S+ NV+ KW+ EV H    TPIILVGTKLDLR+++   E  K + + +P+TY QGLAL +EI +VKY+ECSA TQ  L+ VF+EAIR V+  P+P+  + + CSLL
Sbjct:    1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEK-KLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLC-PQPTRQQKRACSLL 192          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Human
Match: RAC3 (Rac family small GTPase 3 [Source:HGNC Symbol;Acc:HGNC:9803])

HSP 1 Score: 259.996 bits (663), Expect = 2.702e-86
Identity = 120/178 (67.42%), Postives = 150/178 (84.27%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVI 620
            M++IKCVVVGDGAVGKTC+LISYTT+AFP  ++PTVFDN SANVM++G P+NLGLWDTAGQE+YDRLRPLSYP+TDVFLICFSLV+  SF NV+ KWY EV H    TPI+LVGTKLDLR+++   E  +++ + +P+TY QGLA+ +EIG+VKY+ECSA TQ  L+ VF+EAIR V+
Sbjct:    1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDK-KLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVL 177          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Human
Match: RAC1 (Rac family small GTPase 1 [Source:HGNC Symbol;Acc:HGNC:9801])

HSP 1 Score: 255.373 bits (651), Expect = 3.238e-84
Identity = 129/213 (60.56%), Postives = 156/213 (73.24%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPET-------------------DVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPRFKFCSLL 668
            M++IKCVVVGDGAVGKTC+LISYTT+AFP  ++PTVFDN SANVM++G P+NLGLWDTAGQE+YDRLRPLSYP+T                   DVFLICFSLV+  SF NV+ KWY EV H    TPIILVGTKLDLR+++   E  K + + +P+TY QGLA+ +EIGAVKY+ECSA TQ  L+ VF+EAIR V+  P P   R + C LL
Sbjct:    1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTVGETYGKDITSRGKDKPIADVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEK-KLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLC-PPPVKKRKRKCLLL 211          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Human
Match: RAC2 (Rac family small GTPase 2 [Source:HGNC Symbol;Acc:HGNC:9802])

HSP 1 Score: 240.736 bits (613), Expect = 3.103e-79
Identity = 112/167 (67.07%), Postives = 138/167 (82.63%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLR 587
            M++IKCVVVGDGAVGKTC+LISYTT+AFP  ++PTVFDN SANVM++  P+NLGLWDTAGQE+YDRLRPLSYP+TDVFLICFSLV+  S+ NV+ KW+ EV H    TPIILVGTKLDLR+++   E  K + + +P+TY QGLAL +EI +VKY+ECSA TQ  L+
Sbjct:    1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEK-KLAPITYPQGLALAKEIDSVKYLECSALTQRGLK 166          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Celegans
Match: ced-10 (Ras-related protein ced-10 [Source:UniProtKB/Swiss-Prot;Acc:Q03206])

HSP 1 Score: 257.684 bits (657), Expect = 6.346e-86
Identity = 122/182 (67.03%), Postives = 146/182 (80.22%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPK 632
            M++IKCVVVGDGAVGKTC+LISYTT+AFP  ++PTVFDN SANVM++G PINLGLWDTAGQE+YDRLRPLSYP+TDVFL+CF+L N  SF NV+ KWY EVSH    TPIILVGTK DLRE+R   E  + + R  PV+  QG  + +EI AVKY+ECSA TQ  L+QVF+EAIR V+  P+
Sbjct:    1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGRPINLGLWDTAGQEDYDRLRPLSYPQTDVFLVCFALNNPASFENVRAKWYPEVSHHCPNTPIILVGTKADLREDRDTVERLRER-RLQPVSQTQGYVMAKEIKAVKYLECSALTQRGLKQVFDEAIRAVLTPPQ 181          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Celegans
Match: rac-2 (Ras-related protein rac-2 [Source:UniProtKB/Swiss-Prot;Acc:Q94124])

HSP 1 Score: 238.81 bits (608), Expect = 2.411e-78
Identity = 113/189 (59.79%), Postives = 143/189 (75.66%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPRFK 653
            M++IKCVVVGDGAVGKTC+L+SYTT+AFP  ++ TVFD  S NVM++G PINL LWDTAGQ++YD+ R LS+P+TDVFL+CF+L N  SF NV+ KWY EVSH    TPIILVGTK DLRE+R   E  + + R  PV++ QG  + +EI AVKY+ECSA TQ+ L+QVF+EAIR  +  P+    R K
Sbjct:    1 MQAIKCVVVGDGAVGKTCLLLSYTTNAFPGEYILTVFDTYSTNVMVDGRPINLSLWDTAGQDDYDQFRHLSFPQTDVFLVCFALNNPASFENVRAKWYPEVSHHCPNTPIILVGTKADLREDRDTIERLRER-RLQPVSHTQGYVMAKEIKAVKYLECSALTQIGLKQVFDEAIRTGLTPPQTPQTRAK 188          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Celegans
Match: mig-2 (Rac-like GTPase [Source:UniProtKB/TrEMBL;Acc:G5EBV3])

HSP 1 Score: 233.802 bits (595), Expect = 2.053e-76
Identity = 114/197 (57.87%), Postives = 146/197 (74.11%), Query Frame = 3
Query:   90 RSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREE----RALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPRFKFCSLL 668
            R IKCVVVGDG VGKTC+LISYTTD+FP  +VPTVFDN SA + ++G  +NLGLWDTAGQE+YDRLRPLSYP+TDVF++CFS+V+  SF NV  KW  E+     + P+ILVGTKLDLR+E    RAL    K     SP++  QG+ + Q+I AVKY+ECSA TQ  L QVFE+A+R +++ PKP   + K C+++
Sbjct:    6 RQIKCVVVGDGTVGKTCMLISYTTDSFPVQYVPTVFDNYSAQMSLDGNVVNLGLWDTAGQEDYDRLRPLSYPQTDVFILCFSVVSPVSFDNVASKWIPEIRQHCPDAPVILVGTKLDLRDEAEPMRALQAEGK-----SPISKTQGMKMAQKIKAVKYLECSALTQQGLTQVFEDAVRSILH-PKPQKKK-KSCNIM 195          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Celegans
Match: cdc-42 (Cell division control protein 42 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q05062])

HSP 1 Score: 225.713 bits (574), Expect = 2.161e-73
Identity = 111/195 (56.92%), Postives = 145/195 (74.36%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNEN-DKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPRFKFCSLL 668
            M++IKCVVVGDGAVGKTC+LISYTT+ FP+ +VPTVFDN +  VMI G P  LGL+DTAGQE+YDRLRPLSYP+TDVFL+CFS+V   SF NV+EKW  E+SH   +TP +LVGT++DLR++  + E   KN  +  PV+   G  L +E+ AVKY+ECSA TQ  L+ VF+EAI   ++ P+    + K C++L
Sbjct:    1 MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVAPASFENVREKWVPEISHHCSKTPFLLVGTQVDLRDDPGMLEKLAKN--KQKPVSTDVGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALDPPQ--QEKKKKCNIL 191          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Celegans
Match: rho-1 (Ras-like GTP-binding protein rhoA [Source:UniProtKB/Swiss-Prot;Acc:Q22038])

HSP 1 Score: 195.667 bits (496), Expect = 1.410e-61
Identity = 91/177 (51.41%), Postives = 126/177 (71.19%), Query Frame = 3
Query:   99 KCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREE-RALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINK 626
            K V+VGDGA GKTC+LI ++ D FP  +VPTVF+N  A++ ++G  + L LWDTAGQE+YDRLRPLSYP+TDV L+CFS+ + DS  N+ EKW  EV HF    PIILVG K DLR + + + E  K  ++  PV  +QG A+ ++IGA  Y+ECSA+T+  +R+VFE+A +  + +
Sbjct:    7 KLVIVGDGACGKTCLLIVFSKDQFPDVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVRHFCPNVPIILVGNKRDLRSDPQTVRELAK--MKQEPVKPEQGRAIAEQIGAFAYLECSAKTKDGIREVFEKATQAALQQ 181          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Fly
Match: Rac1 (gene:FBgn0010333 transcript:FBtr0072730)

HSP 1 Score: 263.462 bits (672), Expect = 4.722e-88
Identity = 123/178 (69.10%), Postives = 149/178 (83.71%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVI 620
            M++IKCVVVGDGAVGKTC+LISYTT+AFP  ++PTVFDN SANVM++  PINLGLWDTAGQE+YDRLRPLSYP+TDVFLICFSLVN  SF NV+ KWY EV H    TPIILVGTKLDLR+++   E  +++ + +P+TY QGLA+ +EIGAVKY+ECSA TQ  L+ VF+EAIR V+
Sbjct:    1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLRDDKNTIEKLRDK-KLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVL 177          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Fly
Match: Rac1 (gene:FBgn0010333 transcript:FBtr0331868)

HSP 1 Score: 263.462 bits (672), Expect = 4.722e-88
Identity = 123/178 (69.10%), Postives = 149/178 (83.71%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVI 620
            M++IKCVVVGDGAVGKTC+LISYTT+AFP  ++PTVFDN SANVM++  PINLGLWDTAGQE+YDRLRPLSYP+TDVFLICFSLVN  SF NV+ KWY EV H    TPIILVGTKLDLR+++   E  +++ + +P+TY QGLA+ +EIGAVKY+ECSA TQ  L+ VF+EAIR V+
Sbjct:    1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLRDDKNTIEKLRDK-KLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVL 177          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Fly
Match: Rac2 (gene:FBgn0014011 transcript:FBtr0076867)

HSP 1 Score: 261.151 bits (666), Expect = 4.356e-87
Identity = 126/194 (64.95%), Postives = 154/194 (79.38%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPRFKFCSLL 668
            M++IKCVVVGDGAVGKTC+LISYTT+AFP  ++PTVFDN SANVM++  PINLGLWDTAGQE+YDRLRPLSYP+TDVFLICFSLVN  SF NV+ KW+ EV H     PIILVGTKLDLR+++   E  K++ + +P+TY QGLA+ +EI AVKY+ECSA TQ  L+ VF+EAIR V+  P    P+   C+LL
Sbjct:    1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWFPEVRHHCPSVPIILVGTKLDLRDDKQTIEKLKDK-KLTPITYPQGLAMAKEIAAVKYLECSALTQKGLKTVFDEAIRSVLC-PVVRGPKRHKCALL 192          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Fly
Match: Rac2 (gene:FBgn0014011 transcript:FBtr0332800)

HSP 1 Score: 261.151 bits (666), Expect = 4.356e-87
Identity = 126/194 (64.95%), Postives = 154/194 (79.38%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPRFKFCSLL 668
            M++IKCVVVGDGAVGKTC+LISYTT+AFP  ++PTVFDN SANVM++  PINLGLWDTAGQE+YDRLRPLSYP+TDVFLICFSLVN  SF NV+ KW+ EV H     PIILVGTKLDLR+++   E  K++ + +P+TY QGLA+ +EI AVKY+ECSA TQ  L+ VF+EAIR V+  P    P+   C+LL
Sbjct:    1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWFPEVRHHCPSVPIILVGTKLDLRDDKQTIEKLKDK-KLTPITYPQGLAMAKEIAAVKYLECSALTQKGLKTVFDEAIRSVLC-PVVRGPKRHKCALL 192          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Fly
Match: Cdc42 (gene:FBgn0010341 transcript:FBtr0309215)

HSP 1 Score: 238.039 bits (606), Expect = 4.093e-78
Identity = 112/188 (59.57%), Postives = 146/188 (77.66%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERA-LNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPR 647
            M++IKCVVVGDGAVGKTC+LISYTT+ FP+ +VPTVFDN +  VMI G P  LGL+DTAGQE+YDRLRPLSYP+TDVFL+CFS+V+  SF NVKEKW  E++H  ++TP +LVGT++DLR+E + L +  KN  +  P+T +QG  L +E+ AVKY+ECSA TQ  L+ VF+EAI   +  P+P+  R
Sbjct:    1 MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDLRDENSTLEKLAKN--KQKPITMEQGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALEPPEPTKKR 186          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Zebrafish
Match: rac1b (Rac family small GTPase 1b [Source:ZFIN;Acc:ZDB-GENE-060312-45])

HSP 1 Score: 270.396 bits (690), Expect = 1.420e-90
Identity = 130/194 (67.01%), Postives = 158/194 (81.44%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPRFKFCSLL 668
            M++IKCVVVGDGAVGKTC+LISYTT+AFP  ++PTVFDN SANVM++G P+NLGLWDTAGQE+YDRLRPLSYP+TDVFLICFSLV+  SF NV+ KWY EV H  + TPIILVGTKLDLR+++   E  K + + +P+TY QGLA+ +EIGAVKY+ECSA TQ  L+ VF+EAIR V+  P P   R + CSLL
Sbjct:    1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCQTTPIILVGTKLDLRDDKDTIEKLKEK-KLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLC-PPPVKKRKRKCSLL 192          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Zebrafish
Match: rac3b (Rac family small GTPase 3b [Source:ZFIN;Acc:ZDB-GENE-080220-21])

HSP 1 Score: 268.085 bits (684), Expect = 1.066e-89
Identity = 129/194 (66.49%), Postives = 157/194 (80.93%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPRFKFCSLL 668
            M++IKCVVVGDGAVGKTC+LISYTT+AFP  ++PTVFDN SANVM++G P+NLGLWDTAGQE+YDRLRPLSYP+TDVFLICFSLV+  SF NV+ KWY EV H    TPIILVGTKLDLR+++   E  +++ + SP+TY QGLA+ +EIGAVKY+ECSA TQ  L+ VF+EAIR V+  P P   R K C+L 
Sbjct:    1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIERLRDK-KLSPITYPQGLAMAREIGAVKYLECSALTQRGLKTVFDEAIRAVLC-PPPVKKRGKRCTLF 192          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Zebrafish
Match: rac3a (Rac family small GTPase 3a [Source:ZFIN;Acc:ZDB-GENE-040718-256])

HSP 1 Score: 265.774 bits (678), Expect = 9.526e-89
Identity = 127/194 (65.46%), Postives = 157/194 (80.93%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPRFKFCSLL 668
            M++IKCVVVGDGAVGKTC+LISYTT+AFP  ++PTVFDN SANVM++G P+NLGLWDTAGQE+YDRLRPLSYP+TDVFLICFSLV+  SF NV+ KWY EV H    TPIILVGTKLDLR+++   E  +++ + +P+TY QGLA+ +EIGAVKY+ECSA TQ  L+ VF+EAIR V+  P P   R K C++ 
Sbjct:    1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIERLRDK-KLAPITYPQGLAMAREIGAVKYLECSALTQRGLKTVFDEAIRAVLC-PPPVKKRGKKCTVF 192          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Zebrafish
Match: rac2 (Rac family small GTPase 2 [Source:ZFIN;Acc:ZDB-GENE-040625-27])

HSP 1 Score: 265.003 bits (676), Expect = 1.380e-88
Identity = 128/194 (65.98%), Postives = 156/194 (80.41%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPRFKFCSLL 668
            M++IKCVVVGDGAVGKTC+LISYTT+AFP  ++PTVFDN SANVM++  P+NLGLWDTAGQE+YDRLRPLSYP+TDVFLICFSLV+  SF NV+ KWY EV H    TPIILVGTKLDLR+E+   E  K + + +P+TY QGLAL +EI AVKY+ECSA TQ  L+ VF+EAIR V+  P+P+  + K C +L
Sbjct:    1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLRDEKETIEKLKEK-KLAPITYPQGLALAKEIDAVKYLECSALTQRGLKTVFDEAIRAVLC-PQPTKVKKKGCVML 192          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Zebrafish
Match: rac2 (Rac family small GTPase 2 [Source:ZFIN;Acc:ZDB-GENE-040625-27])

HSP 1 Score: 265.003 bits (676), Expect = 1.380e-88
Identity = 128/194 (65.98%), Postives = 156/194 (80.41%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPRFKFCSLL 668
            M++IKCVVVGDGAVGKTC+LISYTT+AFP  ++PTVFDN SANVM++  P+NLGLWDTAGQE+YDRLRPLSYP+TDVFLICFSLV+  SF NV+ KWY EV H    TPIILVGTKLDLR+E+   E  K + + +P+TY QGLAL +EI AVKY+ECSA TQ  L+ VF+EAIR V+  P+P+  + K C +L
Sbjct:    1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLRDEKETIEKLKEK-KLAPITYPQGLALAKEIDAVKYLECSALTQRGLKTVFDEAIRAVLC-PQPTKVKKKGCVML 192          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Xenopus
Match: rac1 (Rac family small GTPase 1 [Source:NCBI gene;Acc:448118])

HSP 1 Score: 266.544 bits (680), Expect = 4.822e-89
Identity = 129/194 (66.49%), Postives = 156/194 (80.41%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPRFKFCSLL 668
            M++IKCVVVGDGAVGKTC+LISYTT+AFP  ++PTVFDN SANVM++G P+NLGLWDTAGQE+YDRLRPLSYP+TDVFLICFSLV+  SF NV+ KWY EV H    TPIILVGTKLDLR+++   E  K + + +P+TY QGLA+ +EIGAVKY+ECSA TQ  L+ VF+EAIR V+  P P   R + C LL
Sbjct:    1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEK-KLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLC-PPPVKKRKRKCLLL 192          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Xenopus
Match: nab2 (NGFI-A binding protein 2 (EGR1 binding protein 2) [Source:Xenbase;Acc:XB-GENE-957953])

HSP 1 Score: 265.388 bits (677), Expect = 1.923e-88
Identity = 124/181 (68.51%), Postives = 151/181 (83.43%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKP 629
            M++IKCVVVGDGAVGKTC+LISYTT+AFP  ++PTVFDN SANVM++G P+NLGLWDTAGQE+YDRLRPLSYP+TDVFLICFSLV+  SF NV+ KWY EV H    TPIILVGTKLDLR+++   E  +++ R SP+TY QGLA+ +EIG+VKY+ECSA TQ  L+ VF+EAIR V+  P
Sbjct:    1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIERLRDK-RLSPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPP 180          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Xenopus
Match: yju2 (YJU2 splicing factor homolog [Source:Xenbase;Acc:XB-GENE-5938025])

HSP 1 Score: 261.922 bits (668), Expect = 3.763e-87
Identity = 127/194 (65.46%), Postives = 154/194 (79.38%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPRFKFCSLL 668
            M++IKCVVVGDGAVGKTC+LISYTT+AFP  ++PTVFDN SANVM++  P+NLGLWDTAGQE+YDRLRPLSYP+TDVFLICFSLV+  S+ NV+ KWY EV H    TPIILVGTKLDLR+++   E  K + + SP++Y QGLAL +EI AVKY+ECSA TQ  L+ VF+EAIR V+  P PS P    C +L
Sbjct:    1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWYPEVRHHCPSTPIILVGTKLDLRDDKETIEKLKEK-KLSPISYPQGLALAKEIEAVKYLECSALTQRGLKTVFDEAIRAVLC-PPPSRPNKAKCVVL 192          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Xenopus
Match: nab2 (NGFI-A binding protein 2 (EGR1 binding protein 2) [Source:Xenbase;Acc:XB-GENE-957953])

HSP 1 Score: 252.677 bits (644), Expect = 1.627e-83
Identity = 118/179 (65.92%), Postives = 147/179 (82.12%), Query Frame = 3
Query:   93 SIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKP 629
            S++CV++  GAVGKTC+LISYTT+AFP  ++PTVFDN SANVM++G P+NLGLWDTAGQE+YDRLRPLSYP+TDVFLICFSLV+  SF NV+ KWY EV H    TPIILVGTKLDLR+++   E  +++ R SP+TY QGLA+ +EIG+VKY+ECSA TQ  L+ VF+EAIR V+  P
Sbjct:    3 SLRCVIICWGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIERLRDK-RLSPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPP 180          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Xenopus
Match: yju2 (YJU2 splicing factor homolog [Source:Xenbase;Acc:XB-GENE-5938025])

HSP 1 Score: 239.58 bits (610), Expect = 2.078e-78
Identity = 117/182 (64.29%), Postives = 142/182 (78.02%), Query Frame = 3
Query:  123 AVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPRFKFCSLL 668
            AVGKTC+LISYTT+AFP  ++PTVFDN SANVM++  P+NLGLWDTAGQE+YDRLRPLSYP+TDVFLICFSLV+  S+ NV+ KWY EV H    TPIILVGTKLDLR+++   E  K + + SP++Y QGLAL +EI AVKY+ECSA TQ  L+ VF+EAIR V+  P PS P    C +L
Sbjct:   12 AVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWYPEVRHHCPSTPIILVGTKLDLRDDKETIEKLKEK-KLSPISYPQGLALAKEIEAVKYLECSALTQRGLKTVFDEAIRAVLC-PPPSRPNKAKCVVL 191          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Mouse
Match: Rac1 (Rac family small GTPase 1 [Source:MGI Symbol;Acc:MGI:97845])

HSP 1 Score: 266.544 bits (680), Expect = 3.652e-89
Identity = 129/194 (66.49%), Postives = 156/194 (80.41%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPRFKFCSLL 668
            M++IKCVVVGDGAVGKTC+LISYTT+AFP  ++PTVFDN SANVM++G P+NLGLWDTAGQE+YDRLRPLSYP+TDVFLICFSLV+  SF NV+ KWY EV H    TPIILVGTKLDLR+++   E  K + + +P+TY QGLA+ +EIGAVKY+ECSA TQ  L+ VF+EAIR V+  P P   R + C LL
Sbjct:    1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEK-KLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLC-PPPVKKRKRKCLLL 192          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Mouse
Match: Rac3 (Rac family small GTPase 3 [Source:MGI Symbol;Acc:MGI:2180784])

HSP 1 Score: 259.996 bits (663), Expect = 1.855e-86
Identity = 120/178 (67.42%), Postives = 150/178 (84.27%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVI 620
            M++IKCVVVGDGAVGKTC+LISYTT+AFP  ++PTVFDN SANVM++G P+NLGLWDTAGQE+YDRLRPLSYP+TDVFLICFSLV+  SF NV+ KWY EV H    TPI+LVGTKLDLR+++   E  +++ + +P+TY QGLA+ +EIG+VKY+ECSA TQ  L+ VF+EAIR V+
Sbjct:    1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDK-KLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVL 177          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Mouse
Match: Rac2 (Rac family small GTPase 2 [Source:MGI Symbol;Acc:MGI:97846])

HSP 1 Score: 259.61 bits (662), Expect = 2.628e-86
Identity = 124/194 (63.92%), Postives = 157/194 (80.93%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPRFKFCSLL 668
            M++IKCVVVGDGAVGKTC+LISYTT+AFP  ++PTVFDN SANVM++  P+NLGLWDTAGQE+YDRLRPLSYP+TDVFLICFSLV+  S+ NV+ KW+ EV H    TPIILVGTKLDLR+++   E  K + + +P+TY QGLAL ++I +VKY+ECSA TQ  L+ VF+EAIR V+  P+P+  + + CSLL
Sbjct:    1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEK-KLAPITYPQGLALAKDIDSVKYLECSALTQRGLKTVFDEAIRAVLC-PQPTRQQKRPCSLL 192          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Mouse
Match: Rac1 (Rac family small GTPase 1 [Source:MGI Symbol;Acc:MGI:97845])

HSP 1 Score: 254.603 bits (649), Expect = 3.398e-84
Identity = 129/213 (60.56%), Postives = 156/213 (73.24%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPET-------------------DVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPRFKFCSLL 668
            M++IKCVVVGDGAVGKTC+LISYTT+AFP  ++PTVFDN SANVM++G P+NLGLWDTAGQE+YDRLRPLSYP+T                   DVFLICFSLV+  SF NV+ KWY EV H    TPIILVGTKLDLR+++   E  K + + +P+TY QGLA+ +EIGAVKY+ECSA TQ  L+ VF+EAIR V+  P P   R + C LL
Sbjct:    1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTVGDTCGKDRPSRGKDKPIADVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEK-KLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLC-PPPVKKRKRKCLLL 211          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Mouse
Match: Rac3 (Rac family small GTPase 3 [Source:MGI Symbol;Acc:MGI:2180784])

HSP 1 Score: 238.424 bits (607), Expect = 4.450e-78
Identity = 110/166 (66.27%), Postives = 138/166 (83.13%), Query Frame = 3
Query:  123 AVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVI 620
            AVGKTC+LISYTT+AFP  ++PTVFDN SANVM++G P+NLGLWDTAGQE+YDRLRPLSYP+TDVFLICFSLV+  SF NV+ KWY EV H    TPI+LVGTKLDLR+++   E  +++ + +P+TY QGLA+ +EIG+VKY+ECSA TQ  L+ VF+EAIR V+
Sbjct:    6 AVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDK-KLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVL 170          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. UniProt/SwissProt
Match: sp|Q6RUV5|RAC1_RAT (Ras-related C3 botulinum toxin substrate 1 OS=Rattus norvegicus OX=10116 GN=Rac1 PE=1 SV=1)

HSP 1 Score: 266.544 bits (680), Expect = 2.555e-88
Identity = 129/194 (66.49%), Postives = 156/194 (80.41%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPRFKFCSLL 668
            M++IKCVVVGDGAVGKTC+LISYTT+AFP  ++PTVFDN SANVM++G P+NLGLWDTAGQE+YDRLRPLSYP+TDVFLICFSLV+  SF NV+ KWY EV H    TPIILVGTKLDLR+++   E  K + + +P+TY QGLA+ +EIGAVKY+ECSA TQ  L+ VF+EAIR V+  P P   R + C LL
Sbjct:    1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEK-KLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLC-PPPVKKRKRKCLLL 192          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. UniProt/SwissProt
Match: sp|P63001|RAC1_MOUSE (Ras-related C3 botulinum toxin substrate 1 OS=Mus musculus OX=10090 GN=Rac1 PE=1 SV=1)

HSP 1 Score: 266.544 bits (680), Expect = 2.555e-88
Identity = 129/194 (66.49%), Postives = 156/194 (80.41%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPRFKFCSLL 668
            M++IKCVVVGDGAVGKTC+LISYTT+AFP  ++PTVFDN SANVM++G P+NLGLWDTAGQE+YDRLRPLSYP+TDVFLICFSLV+  SF NV+ KWY EV H    TPIILVGTKLDLR+++   E  K + + +P+TY QGLA+ +EIGAVKY+ECSA TQ  L+ VF+EAIR V+  P P   R + C LL
Sbjct:    1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEK-KLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLC-PPPVKKRKRKCLLL 192          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. UniProt/SwissProt
Match: sp|P63000|RAC1_HUMAN (Ras-related C3 botulinum toxin substrate 1 OS=Homo sapiens OX=9606 GN=RAC1 PE=1 SV=1)

HSP 1 Score: 266.544 bits (680), Expect = 2.555e-88
Identity = 129/194 (66.49%), Postives = 156/194 (80.41%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPRFKFCSLL 668
            M++IKCVVVGDGAVGKTC+LISYTT+AFP  ++PTVFDN SANVM++G P+NLGLWDTAGQE+YDRLRPLSYP+TDVFLICFSLV+  SF NV+ KWY EV H    TPIILVGTKLDLR+++   E  K + + +P+TY QGLA+ +EIGAVKY+ECSA TQ  L+ VF+EAIR V+  P P   R + C LL
Sbjct:    1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEK-KLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLC-PPPVKKRKRKCLLL 192          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. UniProt/SwissProt
Match: sp|P62999|RAC1_CANLF (Ras-related C3 botulinum toxin substrate 1 OS=Canis lupus familiaris OX=9615 GN=RAC1 PE=2 SV=1)

HSP 1 Score: 266.544 bits (680), Expect = 2.555e-88
Identity = 129/194 (66.49%), Postives = 156/194 (80.41%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPRFKFCSLL 668
            M++IKCVVVGDGAVGKTC+LISYTT+AFP  ++PTVFDN SANVM++G P+NLGLWDTAGQE+YDRLRPLSYP+TDVFLICFSLV+  SF NV+ KWY EV H    TPIILVGTKLDLR+++   E  K + + +P+TY QGLA+ +EIGAVKY+ECSA TQ  L+ VF+EAIR V+  P P   R + C LL
Sbjct:    1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEK-KLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLC-PPPVKKRKRKCLLL 192          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. UniProt/SwissProt
Match: sp|P62998|RAC1_BOVIN (Ras-related C3 botulinum toxin substrate 1 OS=Bos taurus OX=9913 GN=RAC1 PE=1 SV=1)

HSP 1 Score: 266.544 bits (680), Expect = 2.555e-88
Identity = 129/194 (66.49%), Postives = 156/194 (80.41%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPRFKFCSLL 668
            M++IKCVVVGDGAVGKTC+LISYTT+AFP  ++PTVFDN SANVM++G P+NLGLWDTAGQE+YDRLRPLSYP+TDVFLICFSLV+  SF NV+ KWY EV H    TPIILVGTKLDLR+++   E  K + + +P+TY QGLA+ +EIGAVKY+ECSA TQ  L+ VF+EAIR V+  P P   R + C LL
Sbjct:    1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEK-KLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLC-PPPVKKRKRKCLLL 192          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. TrEMBL
Match: A0A2R7WKM6 (Uncharacterized protein OS=Oncopeltus fasciatus OX=7536 GN=OFAS_OFAS012641 PE=4 SV=1)

HSP 1 Score: 277.33 bits (708), Expect = 1.207e-89
Identity = 133/194 (68.56%), Postives = 158/194 (81.44%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPRFKFCSLL 668
            M++IKCVVVGDGAVGKTC+LISYTT+AFP  ++PTVFDN SANVM++G PINLGLWDTAGQE+YDRLRPLSYP+TDVFLICFSLVN  SF NV+ KWY EV H   +TPIILVGTKLDLRE++   E  K + + +P+TY QGLA+ +EIGAVKY+ECSA TQ  L+ VF+EAIR V+    PS PR K C L+
Sbjct:   30 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPQTPIILVGTKLDLREDKETIEKLKEK-KLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPILPSRPRRKPCVLI 222          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. TrEMBL
Match: A0A2R5L5C2 (Putative ras-related c3 botulinum toxin substrate 1 OS=Ornithodoros turicata OX=34597 PE=4 SV=1)

HSP 1 Score: 276.174 bits (705), Expect = 1.411e-89
Identity = 132/194 (68.04%), Postives = 160/194 (82.47%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPRFKFCSLL 668
            M++IKCVVVGDGAVGKTC+LISYTT+AFP  ++PTVFDN SANVM++G PINLGLWDTAGQE+YDRLRPLSYP+TDVFLICFSLVN  SF NV+ KWY EVSH   +TPIILVGTKLDLRE++   E  + + + +P+TY QGLA+ +EIGAVKY+ECSA TQ  L+ VF+EAIR V+  P+P   + + CSLL
Sbjct:    1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVSHHCPQTPIILVGTKLDLREDKETVEKLRER-KLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKNVFDEAIRAVLC-PQPKPKKRRMCSLL 192          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. TrEMBL
Match: A0A293N098 (Ras-related C3 botulinum toxin substrate 1 (Fragment) OS=Ornithodoros erraticus OX=265619 PE=4 SV=1)

HSP 1 Score: 276.174 bits (705), Expect = 1.411e-89
Identity = 132/194 (68.04%), Postives = 160/194 (82.47%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPRFKFCSLL 668
            M++IKCVVVGDGAVGKTC+LISYTT+AFP  ++PTVFDN SANVM++G PINLGLWDTAGQE+YDRLRPLSYP+TDVFLICFSLVN  SF NV+ KWY EVSH   +TPIILVGTKLDLRE++   E  + + + +P+TY QGLA+ +EIGAVKY+ECSA TQ  L+ VF+EAIR V+  P+P   + + CSLL
Sbjct:    1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVSHHCPQTPIILVGTKLDLREDKETVEKLRER-KLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKNVFDEAIRAVLC-PQPKPKKRRMCSLL 192          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. TrEMBL
Match: A0A1Z5KWF4 (Uncharacterized protein (Fragment) OS=Ornithodoros moubata OX=6938 PE=4 SV=1)

HSP 1 Score: 276.174 bits (705), Expect = 1.699e-89
Identity = 132/194 (68.04%), Postives = 160/194 (82.47%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPRFKFCSLL 668
            M++IKCVVVGDGAVGKTC+LISYTT+AFP  ++PTVFDN SANVM++G PINLGLWDTAGQE+YDRLRPLSYP+TDVFLICFSLVN  SF NV+ KWY EVSH   +TPIILVGTKLDLRE++   E  + + + +P+TY QGLA+ +EIGAVKY+ECSA TQ  L+ VF+EAIR V+  P+P   + + CSLL
Sbjct:    1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVSHHCPQTPIILVGTKLDLREDKETVEKLRER-KLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKNVFDEAIRAVLC-PQPKPKKRRICSLL 192          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. TrEMBL
Match: A0A087UI47 (Ras-related C3 botulinum toxin substrate 1 (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_18775 PE=4 SV=1)

HSP 1 Score: 274.633 bits (701), Expect = 6.215e-89
Identity = 133/194 (68.56%), Postives = 158/194 (81.44%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPRFKFCSLL 668
            M++IKCVVVGDGAVGKTC+LISYTT+AFP  ++PTVFDN SANVM++G PINLGLWDTAGQE+YDRLRPLSYP+TDVFLICFSLVN  SF NV+ KWY EVSH    TPIILVGTKLDLRE++   E  K + + +P+TY QGLA+ +EIGAVKY+ECSA TQ  L+ VF+EAIR V+  P+P   + K C LL
Sbjct:    1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVSHHCPNTPIILVGTKLDLREDKETIEKLKER-KLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKNVFDEAIRAVLC-PQPKPKKRKHCRLL 192          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Cavefish
Match: rac1b (ras-related C3 botulinum toxin substrate 1-like [Source:NCBI gene;Acc:111192975])

HSP 1 Score: 268.085 bits (684), Expect = 8.557e-90
Identity = 129/194 (66.49%), Postives = 158/194 (81.44%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPRFKFCSLL 668
            M++IKCVVVGDGAVGKTC+LISYTT+AFP  ++PTVFDN SANVM++G P+NLGLWDTAGQE+YDRLRPLSYP+TDVFLICFSLV+  SF NV+ KWY EV H    TPIILVGTKLDLR+++   E  K + + +P+TY QGLA+ +EIGAVKY+ECSA TQ +L+ VF+EAIR V+  P P   R + C+LL
Sbjct:    1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDQDTIEKLKER-KLTPITYPQGLAMAKEIGAVKYLECSALTQRDLKTVFDEAIRAVLC-PPPVKSRKRKCTLL 192          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Cavefish
Match: rac1b (ras-related C3 botulinum toxin substrate 1-like [Source:NCBI gene;Acc:111192975])

HSP 1 Score: 268.085 bits (684), Expect = 8.557e-90
Identity = 129/194 (66.49%), Postives = 158/194 (81.44%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPRFKFCSLL 668
            M++IKCVVVGDGAVGKTC+LISYTT+AFP  ++PTVFDN SANVM++G P+NLGLWDTAGQE+YDRLRPLSYP+TDVFLICFSLV+  SF NV+ KWY EV H    TPIILVGTKLDLR+++   E  K + + +P+TY QGLA+ +EIGAVKY+ECSA TQ +L+ VF+EAIR V+  P P   R + C+LL
Sbjct:    1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDQDTIEKLKER-KLTPITYPQGLAMAKEIGAVKYLECSALTQRDLKTVFDEAIRAVLC-PPPVKSRKRKCTLL 192          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Cavefish
Match: rac3b (ras-related C3 botulinum toxin substrate 3-like [Source:NCBI gene;Acc:111192386])

HSP 1 Score: 268.085 bits (684), Expect = 9.036e-90
Identity = 129/194 (66.49%), Postives = 157/194 (80.93%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPRFKFCSLL 668
            M++IKCVVVGDGAVGKTC+LISYTT+AFP  ++PTVFDN SANVM++G P+NLGLWDTAGQE+YDRLRPLSYP+TDVFLICFSLV+  SF NV+ KWY EV H    TPIILVGTKLDLR+++   E  +++ + SP+TY QGLA+ +EIGAVKY+ECSA TQ  L+ VF+EAIR V+  P P   R K C+L 
Sbjct:    1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIERLRDK-KLSPITYPQGLAMAREIGAVKYLECSALTQRGLKTVFDEAIRAVLC-PPPVKKRGKRCTLF 192          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Cavefish
Match: rac1b (ras-related C3 botulinum toxin substrate 1-like [Source:NCBI gene;Acc:111192975])

HSP 1 Score: 267.7 bits (683), Expect = 1.309e-89
Identity = 129/194 (66.49%), Postives = 157/194 (80.93%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPRFKFCSLL 668
            M++IKCVVVGDGAVGKTC+LISYTT+AFP  ++PTVFDN SANVM++G P+NLGLWDTAGQE+YDRLRPLSYP+TDVFLICFSLV+  SF NV+ KWY EV H    TPIILVGTKLDLR+++   E  K + + +P+TY QGLA+ +EIGAVKY+ECSA TQ  L+ VF+EAIR V+  P P   R + C+LL
Sbjct:    1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDQDTIEKLKER-KLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLC-PPPVKSRKRKCTLL 192          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Cavefish
Match: rac1a (ras-related C3 botulinum toxin substrate 1 [Source:NCBI gene;Acc:103034053])

HSP 1 Score: 266.544 bits (680), Expect = 2.868e-89
Identity = 129/194 (66.49%), Postives = 156/194 (80.41%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPRFKFCSLL 668
            M++IKCVVVGDGAVGKTC+LISYTT+AFP  ++PTVFDN SANVM++G P+NLGLWDTAGQE+YDRLRPLSYP+TDVFLICFSLV+  SF NV+ KWY EV H    TPIILVGTKLDLR+++   E  K + + +P+TY QGLA+ +EIGAVKY+ECSA TQ  L+ VF+EAIR V+  P P   R + C LL
Sbjct:    1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEK-KLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLC-PPPVKKRKRKCLLL 192          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009835.1 (pep scaffold:Pmarinus_7.0:GL479385:19931:31465:1 gene:ENSPMAG00000008880.1 transcript:ENSPMAT00000009835.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 261.151 bits (666), Expect = 1.039e-87
Identity = 122/178 (68.54%), Postives = 149/178 (83.71%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVI 620
            M++IKCVVVGDGAVGKTC+LISYTT+AFP  ++PTVFDN SANVM++G P+NLGLWDTAGQE+YDRLRPLSYP+TDVFLICFSLV+  SF NV+ KWY EV H    TPIILVGTKLDLR+++   E  + + + +P+TY QGLA+ +EIGAVKY+ECSA TQ  L+ VF+EAIR V+
Sbjct:    1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTVEKLREK-KLAPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVL 177          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007368.1 (pep scaffold:Pmarinus_7.0:GL476419:214196:224439:-1 gene:ENSPMAG00000006646.1 transcript:ENSPMAT00000007368.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 239.58 bits (610), Expect = 3.087e-79
Identity = 115/195 (58.97%), Postives = 153/195 (78.46%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPR-FKFCSLL 668
            M++IKCVVVGDGAVGKTC+LIS++ + FP  ++PTVFDN + N+M++G  +NLGLWDTAGQE+YDRLRPLSYP+TD+FLICFS+V+  S+ NV+ KW+KEV H   ETPIILVGTK D RE++ + ++ + +    PVT  QGL+L +EIGA+KY+ECSA TQ  L+ VF+E +R VI+ P+P   R  K C+LL
Sbjct:    1 MQAIKCVVVGDGAVGKTCMLISFSNNTFPGEYIPTVFDNYAVNLMVDGKYVNLGLWDTAGQEDYDRLRPLSYPQTDIFLICFSVVSPSSYDNVRVKWFKEVRHHCPETPIILVGTKQDQREDKDILKHLEEK-SMQPVTNAQGLSLAKEIGAIKYLECSALTQRGLKNVFDETVRAVIS-PEPKIERKKKSCALL 193          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Sea Lamprey
Match: rhoj (ras homolog family member J [Source:ZFIN;Acc:ZDB-GENE-040724-272])

HSP 1 Score: 200.29 bits (508), Expect = 1.115e-63
Identity = 96/191 (50.26%), Postives = 137/191 (71.73%), Query Frame = 3
Query:   96 IKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPK-PSNPRFKFCSL 665
            +KCVVVGDGAVGKTC+++SY  DAFP  +VPTVFD+ + NV + G+   LGL+DTAGQE+Y +LRPLSYP TD+F+ICFS+VN  S+ NVKE+W  E+     + P +LVGT++DLR+        K +++  P+T+QQG+ L ++IGA  Y+ECSA TQ  L+ VF+EAI  ++ + K   + R + C++
Sbjct:   21 LKCVVVGDGAVGKTCLIMSYANDAFPEQYVPTVFDHYAVNVKVGGSCYLLGLYDTAGQEDYHQLRPLSYPNTDMFMICFSVVNPASYHNVKEEWVPELRACCPDVPYLLVGTQIDLRDATKTLMRLK-ELKEKPMTHQQGVKLAKQIGAHCYLECSALTQKGLKAVFDEAILTILQRKKCKRSTRCRCCTI 210          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001838.1 (pep scaffold:Pmarinus_7.0:GL478831:173097:182385:-1 gene:ENSPMAG00000001664.1 transcript:ENSPMAT00000001838.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 190.274 bits (482), Expect = 5.661e-60
Identity = 87/175 (49.71%), Postives = 119/175 (68.00%), Query Frame = 3
Query:   99 KCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVIN 623
            K V+VGDGA GKTC+LI ++ D FP  +VPTVF+N  A++ ++G  + L LWDTAGQE+YDRLRPLSYP+TDV L+CFS+ + DS  N+ EKW  EV HF    PIILVG K DLR + +    +  +++  PV  ++G  +   I A  Y+ECSA+T+  +R+VFE A R  + 
Sbjct:    7 KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDES-TRRELAKMKQEPVKSEEGRDMANRINAFGYMECSAKTKDGVREVFEMATRAALQ 180          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004439.1 (pep scaffold:Pmarinus_7.0:GL476335:1598569:1600956:1 gene:ENSPMAG00000004041.1 transcript:ENSPMAT00000004439.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 188.734 bits (478), Expect = 1.865e-59
Identity = 89/177 (50.28%), Postives = 120/177 (67.80%), Query Frame = 3
Query:   99 KCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQI---RSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVI 620
            K V+VGDGA GKTC+LI ++ D FP  +VPTVF+N  A++ ++G  + L LWDTAGQE+YDRLRPLSYP+TDV L+CFS+ + DS  N+ EKW  EV HF    PIILVG K DLR     ++N K ++   +  PV  ++G  +   I A  Y+ECSA+T+  +R+VFE A R  +
Sbjct:    7 KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRN----DDNTKRELAKMKQEPVRVEEGRDMANRINAFGYMECSAKTKDGVREVFEMATRAAL 179          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Yeast
Match: CDC42 (Small rho-like GTPase; essential for establishment and maintenance of cell polarity; plays a role late in cell fusion via activation of key cell fusion regulator Fus2p; mutants have defects in the organization of actin and septins; human homolog CDC42 can complement yeast cdc42 mutant [Source:SGD;Acc:S000004219])

HSP 1 Score: 224.942 bits (572), Expect = 9.435e-74
Identity = 105/181 (58.01%), Postives = 136/181 (75.14%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKP 629
            M+++KCVVVGDGAVGKTC+LISYTT+ FP  +VPTVFDN +  VMI   P  LGL+DTAGQE+YDRLRPLSYP TDVFL+CFS+++  SF NVKEKW+ EV H     P ++VGT++DLR+++ + E  + Q R  P+T +QG  L +E+ AVKY+ECSA TQ  L+ VF+EAI   +  P
Sbjct:    1 MQTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNYAVTVMIGDEPYTLGLFDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPGVPCLVVGTQIDLRDDKVIIEKLQRQ-RLRPITSEQGSRLARELKAVKYVECSALTQRGLKNVFDEAIVAALEPP 180          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Yeast
Match: RHO1 (GTP-binding protein of the rho subfamily of Ras-like proteins; involved in establishment of cell polarity; regulates protein kinase C (Pkc1p) and the cell wall synthesizing enzyme 1,3-beta-glucan synthase (Fks1p and Gsc2p) [Source:SGD;Acc:S000006369])

HSP 1 Score: 189.504 bits (480), Expect = 1.010e-59
Identity = 93/181 (51.38%), Postives = 122/181 (67.40%), Query Frame = 3
Query:   99 KCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSN 641
            K V+VGDGA GKTC+LI ++   FP  +VPTVF+N  A+V ++G  + L LWDTAGQE+YDRLRPLSYP+++V LICFS+   DS  NV+EKW  EV HF +  PIILVG K+DLR +    E  + Q    PVT Q+G ++  +IGA  Y ECSA+T   +R+VFE A R  +     +N
Sbjct:   12 KLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVADVEVDGRRVELALWDTAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAEVLHFCQGVPIILVGCKVDLRNDPQTIEQLR-QEGQQPVTSQEGQSVADQIGATGYYECSAKTGYGVREVFEAATRASLMGKSKTN 191          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Yeast
Match: RHO5 (Non-essential small GTPase of the Rho/Rac family of Ras-like proteins; RAC1 ortholog; regulated by phosphorylation and ubiquitination; likely involved in protein kinase C (Pkc1p)-dependent signal transduction pathway that controls cell integrity [Source:SGD;Acc:S000005124])

HSP 1 Score: 185.652 bits (470), Expect = 1.390e-56
Identity = 102/228 (44.74%), Postives = 133/228 (58.33%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMI----EGTPINL--------------------------GLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSK-----------ETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPR 647
            MRSIKCV++GDGAVGKT +LISYTT++FPT +VPTVFDN S  + I      +P+ L                           LWDTAGQE+YDRLRPL YP+TD+FLICFS+    SFANV EKW  E+   S            + PI+LVGTK DLR++ A  +    +  S  V+ ++   L Q  G + Y ECSA TQ  +R+VFE+A+R  I +P+  N +
Sbjct:    1 MRSIKCVIIGDGAVGKTSLLISYTTNSFPTDYVPTVFDNYSTTIAIPNGTASSPLELDNGNDKRGSLSSASSSPSTDRKLYKINLWDTAGQEDYDRLRPLCYPQTDIFLICFSVSEHASFANVTEKWLPELKQTSNIEGTSLYTKLGKYPILLVGTKSDLRDDPAT-QKKLQEANSDYVSQEEIDELVQRCGFMGYTECSAATQAGVREVFEQAVRYAIYEPESPNQK 227          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Yeast
Match: RHO4 (Non-essential small GTPase; member of the Rho/Rac subfamily of Ras-like proteins; likely to be involved in the establishment of cell polarity; has long N-terminal extension that plays an important role in Rho4p function and is shared with Rho4 homologs in other yeasts and filamentous fungi [Source:SGD;Acc:S000001763])

HSP 1 Score: 167.548 bits (423), Expect = 4.297e-50
Identity = 85/177 (48.02%), Postives = 112/177 (63.28%), Query Frame = 3
Query:   96 IKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANV-MIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVIN 623
            +K VVVGDGAVGKTC+LISY    FPT ++PT+F+N   N+    G  I L LWDTAGQEEY RLRPLSY   DV ++C+S+ +K S  NV++ W+ EV HF   TPI+LVG K DL E   L         S  V      +L + +GA  +I+CSAR + N+ +VFE AI  +++
Sbjct:   73 LKIVVVGDGAVGKTCLLISYVQGTFPTDYIPTIFENYVTNIEGPNGQIIELALWDTAGQEEYSRLRPLSYTNADVLMVCYSVGSKTSLKNVEDLWFPEVKHFCPSTPIMLVGLKSDLYEADNL---------SDLVEPSSAESLAKRLGAFAHIQCSARLKENIDEVFETAIHTLLS 240          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Yeast
Match: RHO3 (Non-essential small GTPase of the Rho/Rac family of Ras-like proteins; involved in the establishment of cell polarity; GTPase activity positively regulated by the GTPase activating protein (GAP) Rgd1p [Source:SGD;Acc:S000001380])

HSP 1 Score: 152.525 bits (384), Expect = 4.365e-45
Identity = 73/194 (37.63%), Postives = 118/194 (60.82%), Query Frame = 3
Query:   99 KCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLR---------------EERALNENDKNQIRSSP-----VTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVI 620
            K V++GDGA GKT +L  +T   FP  + PTVF+N   ++ ++   I L LWDTAGQEE+DRLR LSY +T   ++CFS+ ++DS  NV+ KW  E++   +   ++LV  K DLR               ++ +++ ++ N I S+      ++Y++GLA+ ++IGA++Y+ECSA+    + + F EA RV +
Sbjct:   18 KIVILGDGACGKTSLLNVFTRGYFPEVYEPTVFENYIHDIFVDSKHITLSLWDTAGQEEFDRLRSLSYSDTQCIMLCFSIDSRDSLENVQNKWVGEITDHCEGVKLVLVALKCDLRNNENESNAITPNNIQQDNSVSNDNGNNINSTSNGKNLISYEEGLAMAKKIGALRYLECSAKLNKGVNEAFTEAARVAL 211          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Nematostella
Match: EDO38536 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCK6])

HSP 1 Score: 266.544 bits (680), Expect = 1.263e-89
Identity = 127/195 (65.13%), Postives = 156/195 (80.00%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPS-NPRFKFCSLL 668
            M++IKCVVVGDGAVGKTC+LISYTT+AFP  ++PTVFDN SANVM++G PINLGLWDTAGQE+YDRLRPLSYP+TDVFLICFSL++  S+ NV+ KWY EVSH    TPI+LVGTKLDLR+++   +  K + +  P+ Y QGL + +EIGAVKY+ECSA TQ  L+ VF+EAIR V+   KP+  PR K C LL
Sbjct:    1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLISPASYENVRAKWYPEVSHHCPNTPIVLVGTKLDLRDDKETIDKLKEK-KLGPIGYTQGLQMAKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPTKPAKKPRNKGCKLL 194          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Nematostella
Match: EDO35019 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMN7])

HSP 1 Score: 248.825 bits (634), Expect = 1.282e-82
Identity = 116/178 (65.17%), Postives = 145/178 (81.46%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVI 620
            M++IKCVVVGDGAVGKTC+LISYTT+AFP  ++PTVFDN SANVM++G PINLGLWDTAGQE+YDRLRPLSYP+TDVFLICFS+++  SF NV+ KWY EVSH    TPIILVGTK DLRE++ + E  K + + +P++   GL + +EI A KY+ECSA TQ  L+ VF++AIR V+
Sbjct:    1 MQAIKCVVVGDGAVGKTCMLISYTTNAFPGEYIPTVFDNYSANVMVDGRPINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSVISPASFENVRAKWYPEVSHHCPGTPIILVGTKTDLREDKEMIEKLKEK-KLNPLSTSHGLQMAKEIKAAKYLECSALTQKGLKTVFDDAIRAVL 177          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Nematostella
Match: EDO37472 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFJ1])

HSP 1 Score: 228.024 bits (580), Expect = 1.464e-74
Identity = 111/195 (56.92%), Postives = 144/195 (73.85%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNEN-DKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPRFKFCSLL 668
            M++IKCVVVGDGAVGKTC+LISYTT+ FP+ +VPTVFDN +  VMI G P  LGL+DTAGQE+YDRLRPLSYP+TDVFL+CFS+V+  SF NVKEKW  E++H   +TP +LVGT++DLR+++   E   KN  +  P+  +    L +E+ AVKY+ECSA TQ  L+ VF+EAI   +  P+P   + K C LL
Sbjct:    1 MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQVDLRDDQGTIEKLSKN--KQKPIAVEAAEKLARELRAVKYVECSALTQKGLKNVFDEAILAALEPPEPQ--KKKKCRLL 191          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Nematostella
Match: EDO39465 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9Y5])

HSP 1 Score: 195.282 bits (495), Expect = 9.631e-62
Identity = 91/178 (51.12%), Postives = 123/178 (69.10%), Query Frame = 3
Query:   99 KCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQI---RSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVIN 623
            K V+VGDGA GKTC+LI ++ D FP  +VPTVF+N  A++ ++G  + L LWDTAGQE+YDRLRPLSYP+TDV L+CFS+ + DS  N+ EKW  EV HF    PIILVG K DLR    ++EN K ++   +  PV  ++G A+  +I A  Y+ECSA+T+  +R+VFE A R  + 
Sbjct:    7 KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLR----MDENTKRELQKMKQEPVKIEEGRAMADKISAYAYLECSAKTKDGVREVFETATRAALQ 180          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Nematostella
Match: EDO36553 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI94])

HSP 1 Score: 171.014 bits (432), Expect = 2.960e-48
Identity = 81/161 (50.31%), Postives = 112/161 (69.57%), Query Frame = 3
Query:  132 KTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRV 614
            K+  LI+ TT+AFP  ++PTVFDN S+N+M++G   N+GLWDTAGQE+YDRLRPLSYP TDVFL+CF + ++ SF N++ KW  E++H   ETP ILVG K DLR  +     D       P+TY++G AL + +G ++Y+E S+ TQ  ++ V   AIRV
Sbjct:   18 KSAFLITATTNAFPGEYIPTVFDNYSSNIMLDGKAYNVGLWDTAGQEDYDRLRPLSYPMTDVFLVCFDIGSRTSFENIESKWLPELNHHMPETPKILVGNKRDLRSAQQNTSRD-------PITYEEGKALAKRLG-MQYLENSSLTQDGVKDVMSAAIRV 170          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Medaka
Match: RAC1 (ras-related C3 botulinum toxin substrate 1 [Source:NCBI gene;Acc:101159016])

HSP 1 Score: 263.848 bits (673), Expect = 4.022e-88
Identity = 123/178 (69.10%), Postives = 149/178 (83.71%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVI 620
            M++IKCVVVGDGAVGKTC+LISYTT+AFP  ++PTVFDN SANVM++G P+NLGLWDTAGQE+YDRLRPLSYP+TDVFLICFSLV+  SF NV+ KWY EV H    TPIILVGTKLDLR+++   E  K + + SP+TY QGLA+ +EIG+VKY+ECSA TQ  L+ VF+EAIR V+
Sbjct:    1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKETTEKLKEK-KLSPITYPQGLAMAKEIGSVKYLECSALTQRGLKTVFDEAIRAVL 177          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Medaka
Match: RAC1 (ras-related C3 botulinum toxin substrate 1 [Source:NCBI gene;Acc:101159016])

HSP 1 Score: 263.848 bits (673), Expect = 4.022e-88
Identity = 123/178 (69.10%), Postives = 149/178 (83.71%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVI 620
            M++IKCVVVGDGAVGKTC+LISYTT+AFP  ++PTVFDN SANVM++G P+NLGLWDTAGQE+YDRLRPLSYP+TDVFLICFSLV+  SF NV+ KWY EV H    TPIILVGTKLDLR+++   E  K + + SP+TY QGLA+ +EIG+VKY+ECSA TQ  L+ VF+EAIR V+
Sbjct:    1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKETTEKLKEK-KLSPITYPQGLAMAKEIGSVKYLECSALTQRGLKTVFDEAIRAVL 177          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Medaka
Match: ENSORLT00000041989.1 (Rac family small GTPase 2 [Source:NCBI gene;Acc:101163549])

HSP 1 Score: 261.536 bits (667), Expect = 3.670e-87
Identity = 126/194 (64.95%), Postives = 155/194 (79.90%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPRFKFCSLL 668
            M++IKCVVVGDGAVGKTC+LISYTT+AFP  ++PTVFDN SANVM++  P+NLGLWDTAGQE+YDRLRPLSYP+TDVFLICFSLV+  S+ NV+ KWY EV H    TPIILVGTKLDLR+E+   E  K + + +P+TY QGLAL +EI AVKY+ECSA TQ  L+ VF+EAIR V+  P+P+  +   C +L
Sbjct:    1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWYPEVRHHCPSTPIILVGTKLDLRDEKDTIEKLKEK-KLAPITYPQGLALAKEIDAVKYLECSALTQRGLKTVFDEAIRAVLC-PQPAKVKKANCLML 192          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Medaka
Match: ENSORLT00000038381.1 (ras-related C3 botulinum toxin substrate 1 [Source:NCBI gene;Acc:101175028])

HSP 1 Score: 261.151 bits (666), Expect = 4.767e-87
Identity = 126/194 (64.95%), Postives = 154/194 (79.38%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPRFKFCSLL 668
            M++IKCVVVGDGAVGKTC+LISYTT+AFP  ++PTVFDN SANVM++G P+NLGLWDTAGQE+YDRLRPLSYP+TDVFLICFSLV+  SF NV+ KWY EV H    TPIILVGTKLDLR+++   E  K + + SP+ Y QGLA+ +EI AVKY+ECSA TQ  L+ VF+EAIR V+  P P   + + C +L
Sbjct:    1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPVTPIILVGTKLDLRDDKDTIEKLKEK-KLSPIIYPQGLAMAKEISAVKYLECSALTQRGLKTVFDEAIRAVLC-PPPDRKKKRKCRIL 192          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Medaka
Match: rac3b (ras-related C3 botulinum toxin substrate 3 [Source:NCBI gene;Acc:105354522])

HSP 1 Score: 245.358 bits (625), Expect = 7.052e-81
Identity = 118/182 (64.84%), Postives = 145/182 (79.67%), Query Frame = 3
Query:  123 AVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPRFKFCSLL 668
            AVGKTC+LISYTT+AFP  ++PTVFDN SANVM++G P+NLGLWDTAGQE+YDRLRPLSYP+TDVFLICFSLV+  SF NV+ KWY EV H    TPIILVGTKLDLR+++   E  +++ + SP+TY QGLA+ +EIGAVKY+ECSA TQ  L+ VF+EAIR V+  P P   R K C++ 
Sbjct:   18 AVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIERLRDK-KLSPITYPQGLAMAREIGAVKYLECSALTQRGLKTVFDEAIRAVLC-PPPVKKRGKRCTMF 197          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Planmine SMEST
Match: SMESG000005010.1 (SMESG000005010.1)

HSP 1 Score: 405.216 bits (1040), Expect = 6.710e-144
Identity = 194/194 (100.00%), Postives = 194/194 (100.00%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPRFKFCSLL 668
            MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPRFKFCSLL
Sbjct:    1 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPRFKFCSLL 194          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Planmine SMEST
Match: SMESG000005012.1 (SMESG000005012.1)

HSP 1 Score: 301.982 bits (772), Expect = 2.561e-103
Identity = 143/194 (73.71%), Postives = 170/194 (87.63%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPRFKFCSLL 668
            MRSIKCVV+GDGAVGKTCIL+S+TTD F ++ +PTVFDNMSAN+MI+G PINLGLWDTAGQ+++D +R +SYP+TDVFLICFSLVNK SF NVKEKW+KEVSH+S+ TPIILVGTKLDLR+ +  +E+DK Q+ SSPVTYQQGLALCQEIGAVKYIECSA+TQ NL+ VFEEA+R+V+NK K      KFCS L
Sbjct:    1 MRSIKCVVIGDGAVGKTCILVSFTTDVFSSSPIPTVFDNMSANMMIDGKPINLGLWDTAGQDDFDGIRVVSYPQTDVFLICFSLVNKVSFVNVKEKWFKEVSHYSENTPIILVGTKLDLRDNKDFDEHDKGQVFSSPVTYQQGLALCQEIGAVKYIECSAKTQENLKMVFEEAVRIVLNKTKKRKRT-KFCSFL 193          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Planmine SMEST
Match: SMESG000024961.1 (SMESG000024961.1)

HSP 1 Score: 268.855 bits (686), Expect = 2.891e-90
Identity = 129/194 (66.49%), Postives = 155/194 (79.90%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPRFKFCSLL 668
            M+ IKCVVVGDGAVGKTC+LISYTT+AFP  ++PTVFDN SANVM++  P+NLGLWDTAGQE+YDRLRPLSYP+TDVFLICFSL+N  S+ NV+ KWY E++H    TPIILVGTKLDLRE     E  K++ R++P++Y QGL L +EIGAVKY+ECSA TQ  L+ VF+EAIR V+  PKP  PR K C  L
Sbjct:    1 MQGIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDNKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLINSSSYENVRAKWYPEITHHCPNTPIILVGTKLDLRENHMNGEAGKDR-RNTPISYPQGLVLAKEIGAVKYLECSALTQKGLKSVFDEAIRAVLC-PKP--PRKKTCKFL 190          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Planmine SMEST
Match: SMESG000024968.1 (SMESG000024968.1)

HSP 1 Score: 249.21 bits (635), Expect = 1.171e-82
Identity = 121/194 (62.37%), Postives = 149/194 (76.80%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPRFKFCSLL 668
            M+ IKCVVVGDGAVGKTC+LISYTT AFP  ++PTVFDN SAN+M++  P+NLGLWDTAGQE+YDRLRPLSYP+TDVF+ICFSLVN  S+ NV+ KWY EV++    TPIILVGTKLDLR+E   N+   +      ++Y QGL L +EIGA KY+ECSA TQ  L+ VF+E+IRVV+   +  N   K CS+L
Sbjct:    1 MQGIKCVVVGDGAVGKTCLLISYTTSAFPGEYIPTVFDNYSANIMVDNKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFIICFSLVNPSSYENVRAKWYPEVNNHCPNTPIILVGTKLDLRDESQTNKTGGH------ISYPQGLILMKEIGAKKYLECSALTQTGLKTVFDESIRVVLCPKQKQNK--KRCSIL 186          
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Planmine SMEST
Match: SMESG000005013.1 (SMESG000005013.1)

HSP 1 Score: 226.098 bits (575), Expect = 1.516e-73
Identity = 111/195 (56.92%), Postives = 144/195 (73.85%), Query Frame = 3
Query:   87 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINK-PKPSNPRFKFCSLL 668
            M++IKCVVVGDG VGKTC LISYTT+ FP  +VPT+FDN  AN+M++G  INL LWDTAGQE YD+LR   Y  T VFL+CFS++++ ++ NVK  W KE+ ++  + PIILVGTK+DLR   A+ +N  N    S VTYQ+GL L ++I AVK++ECSA+++  L QVFEEAIR VIN+ PK   P+   CSLL
Sbjct:    1 MKAIKCVVVGDGQVGKTCTLISYTTNRFPNEYVPTMFDNWCANLMVDGIGINLSLWDTAGQETYDQLRVTCYQNTSVFLVCFSVMDRTTYENVKYTWAKEIRNYCPKIPIILVGTKVDLR-HLAIGDNTSNSTNVSYVTYQEGLILAKQINAVKFVECSAKSREGLSQVFEEAIRAVINQTPKRKKPK---CSLL 191          
The following BLAST results are available for this feature:
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RAC15.319e-8966.49Rac family small GTPase 1 [Source:HGNC Symbol;Acc:... [more]
RAC26.279e-8764.43Rac family small GTPase 2 [Source:HGNC Symbol;Acc:... [more]
RAC32.702e-8667.42Rac family small GTPase 3 [Source:HGNC Symbol;Acc:... [more]
RAC13.238e-8460.56Rac family small GTPase 1 [Source:HGNC Symbol;Acc:... [more]
RAC23.103e-7967.07Rac family small GTPase 2 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ced-106.346e-8667.03Ras-related protein ced-10 [Source:UniProtKB/Swis... [more]
rac-22.411e-7859.79Ras-related protein rac-2 [Source:UniProtKB/Swiss... [more]
mig-22.053e-7657.87Rac-like GTPase [Source:UniProtKB/TrEMBL;Acc:G5EB... [more]
cdc-422.161e-7356.92Cell division control protein 42 homolog [Source:... [more]
rho-11.410e-6151.41Ras-like GTP-binding protein rhoA [Source:UniProt... [more]
back to top
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rac14.722e-8869.10gene:FBgn0010333 transcript:FBtr0072730[more]
Rac14.722e-8869.10gene:FBgn0010333 transcript:FBtr0331868[more]
Rac24.356e-8764.95gene:FBgn0014011 transcript:FBtr0076867[more]
Rac24.356e-8764.95gene:FBgn0014011 transcript:FBtr0332800[more]
Cdc424.093e-7859.57gene:FBgn0010341 transcript:FBtr0309215[more]
back to top
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rac1b1.420e-9067.01Rac family small GTPase 1b [Source:ZFIN;Acc:ZDB-GE... [more]
rac3b1.066e-8966.49Rac family small GTPase 3b [Source:ZFIN;Acc:ZDB-GE... [more]
rac3a9.526e-8965.46Rac family small GTPase 3a [Source:ZFIN;Acc:ZDB-GE... [more]
rac21.380e-8865.98Rac family small GTPase 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
rac21.380e-8865.98Rac family small GTPase 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rac14.822e-8966.49Rac family small GTPase 1 [Source:NCBI gene;Acc:44... [more]
nab21.923e-8868.51NGFI-A binding protein 2 (EGR1 binding protein 2) ... [more]
yju23.763e-8765.46YJU2 splicing factor homolog [Source:Xenbase;Acc:X... [more]
nab21.627e-8365.92NGFI-A binding protein 2 (EGR1 binding protein 2) ... [more]
yju22.078e-7864.29YJU2 splicing factor homolog [Source:Xenbase;Acc:X... [more]
back to top
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rac13.652e-8966.49Rac family small GTPase 1 [Source:MGI Symbol;Acc:M... [more]
Rac31.855e-8667.42Rac family small GTPase 3 [Source:MGI Symbol;Acc:M... [more]
Rac22.628e-8663.92Rac family small GTPase 2 [Source:MGI Symbol;Acc:M... [more]
Rac13.398e-8460.56Rac family small GTPase 1 [Source:MGI Symbol;Acc:M... [more]
Rac34.450e-7866.27Rac family small GTPase 3 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6RUV5|RAC1_RAT2.555e-8866.49Ras-related C3 botulinum toxin substrate 1 OS=Ratt... [more]
sp|P63001|RAC1_MOUSE2.555e-8866.49Ras-related C3 botulinum toxin substrate 1 OS=Mus ... [more]
sp|P63000|RAC1_HUMAN2.555e-8866.49Ras-related C3 botulinum toxin substrate 1 OS=Homo... [more]
sp|P62999|RAC1_CANLF2.555e-8866.49Ras-related C3 botulinum toxin substrate 1 OS=Cani... [more]
sp|P62998|RAC1_BOVIN2.555e-8866.49Ras-related C3 botulinum toxin substrate 1 OS=Bos ... [more]
back to top
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2R7WKM61.207e-8968.56Uncharacterized protein OS=Oncopeltus fasciatus OX... [more]
A0A2R5L5C21.411e-8968.04Putative ras-related c3 botulinum toxin substrate ... [more]
A0A293N0981.411e-8968.04Ras-related C3 botulinum toxin substrate 1 (Fragme... [more]
A0A1Z5KWF41.699e-8968.04Uncharacterized protein (Fragment) OS=Ornithodoros... [more]
A0A087UI476.215e-8968.56Ras-related C3 botulinum toxin substrate 1 (Fragme... [more]
back to top
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rac1b8.557e-9066.49ras-related C3 botulinum toxin substrate 1-like [S... [more]
rac1b8.557e-9066.49ras-related C3 botulinum toxin substrate 1-like [S... [more]
rac3b9.036e-9066.49ras-related C3 botulinum toxin substrate 3-like [S... [more]
rac1b1.309e-8966.49ras-related C3 botulinum toxin substrate 1-like [S... [more]
rac1a2.868e-8966.49ras-related C3 botulinum toxin substrate 1 [Source... [more]
back to top
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009835.11.039e-8768.54pep scaffold:Pmarinus_7.0:GL479385:19931:31465:1 g... [more]
ENSPMAT00000007368.13.087e-7958.97pep scaffold:Pmarinus_7.0:GL476419:214196:224439:-... [more]
rhoj1.115e-6350.26ras homolog family member J [Source:ZFIN;Acc:ZDB-G... [more]
ENSPMAT00000001838.15.661e-6049.71pep scaffold:Pmarinus_7.0:GL478831:173097:182385:-... [more]
ENSPMAT00000004439.11.865e-5950.28pep scaffold:Pmarinus_7.0:GL476335:1598569:1600956... [more]
back to top
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CDC429.435e-7458.01Small rho-like GTPase; essential for establishment... [more]
RHO11.010e-5951.38GTP-binding protein of the rho subfamily of Ras-li... [more]
RHO51.390e-5644.74Non-essential small GTPase of the Rho/Rac family o... [more]
RHO44.297e-5048.02Non-essential small GTPase; member of the Rho/Rac ... [more]
RHO34.365e-4537.63Non-essential small GTPase of the Rho/Rac family o... [more]
back to top
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO385361.263e-8965.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO350191.282e-8265.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374721.464e-7456.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO394659.631e-6251.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO365532.960e-4850.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RAC14.022e-8869.10ras-related C3 botulinum toxin substrate 1 [Source... [more]
RAC14.022e-8869.10ras-related C3 botulinum toxin substrate 1 [Source... [more]
ENSORLT00000041989.13.670e-8764.95Rac family small GTPase 2 [Source:NCBI gene;Acc:10... [more]
ENSORLT00000038381.14.767e-8764.95ras-related C3 botulinum toxin substrate 1 [Source... [more]
rac3b7.052e-8164.84ras-related C3 botulinum toxin substrate 3 [Source... [more]
back to top
BLAST of Ras-related C3 botulinum toxin substrate 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005010.16.710e-144100.00SMESG000005010.1[more]
SMESG000005012.12.561e-10373.71SMESG000005012.1[more]
SMESG000024961.12.891e-9066.49SMESG000024961.1[more]
SMESG000024968.11.171e-8262.37SMESG000024968.1[more]
SMESG000005013.11.516e-7356.92SMESG000005013.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016340 ID=SMED30016340|Name=Ras-related C3 botulinum toxin substrate 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1042bp
CATCAATTTACTTATATTGACAATAATTGTTATTTCTAAAATTTGTAACT
ACATATTTTAAAATTAAATTTTACTTTTGTTAATAAATGCGTAGTATTAA
ATGTGTTGTTGTCGGTGACGGAGCTGTTGGTAAAACATGTATATTAATTA
GCTATACAACCGACGCATTTCCAACTACCCACGTACCAACAGTGTTTGAT
AACATGTCTGCCAATGTCATGATAGAAGGAACTCCAATAAATCTCGGTTT
GTGGGACACTGCAGGCCAGGAAGAATACGACCGTCTTCGTCCATTATCTT
ACCCAGAAACTGACGTATTTCTAATTTGTTTCTCTTTAGTCAATAAAGAT
TCATTTGCAAATGTCAAAGAGAAATGGTACAAAGAGGTGTCACATTTTTC
AAAAGAGACTCCCATAATACTAGTTGGCACAAAACTTGATTTACGAGAAG
AACGAGCTCTCAATGAAAATGACAAAAATCAAATCCGATCATCTCCAGTT
ACATATCAGCAAGGTCTAGCTTTATGCCAAGAAATCGGAGCCGTGAAATA
CATCGAATGTTCAGCGAGAACTCAAGTAAACCTAAGGCAAGTTTTCGAAG
AAGCGATTCGAGTTGTCATTAACAAACCAAAGCCGTCCAATCCTCGATTC
AAATTCTGTTCACTTTTGTGAATTATTTAAAATTTTTAATTTCAATGATT
ATCTGATTTTCAAATTACTGTCATTGATTTTTGTGCTATGTTTTTAATTG
AGTTATCATTTGTTTTAGTCACGTTATTTTTGTCAACTGTCACTTTACAT
AGGATATACGAAGAGACTTTTGATAAAAAATATATATTTTTGTTGAATTT
CTCTCATTCCATTCATTTTCAATAAAGAAATCATCATATCAAACAATAAA
ATCGTATCGTAGAATTTTTATGAAAATTAACCAATAGAAATAATGGAAAT
TGCGCAAAAAATATAAATTGGCAACAACTAAATAATTCCATATCGAGAGT
ATTGATTTGTTTGACTATTCGCTGTTATCGATTGGTTCACCG
back to top

protein sequence of SMED30016340-orf-1

>SMED30016340-orf-1 ID=SMED30016340-orf-1|Name=SMED30016340-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=195bp
MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTP
INLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKE
VSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEI
GAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPRFKFCSLL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000429neoblast
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR005225Small_GTP-bd_dom
IPR003578Small_GTPase_Rho
IPR001806Small_GTPase
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0017137Rab GTPase binding
GO:0019899enzyme binding
GO:0019901protein kinase binding
GO:0030742GTP-dependent protein binding
GO:0031996thioesterase binding
GO:0042826histone deacetylase binding
GO:0051022Rho GDP-dissociation inhibitor binding
GO:0051117ATPase binding
GO:0000166nucleotide binding
GO:0003924GTPase activity
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0007264small GTPase mediated signal transduction
GO:0006897endocytosis
GO:0006911phagocytosis, engulfment
GO:0006935chemotaxis
GO:0006972hyperosmotic response
GO:0007010cytoskeleton organization
GO:0007015actin filament organization
GO:0007155cell adhesion
GO:0007186G-protein coupled receptor signaling pathway
GO:0007411axon guidance
GO:0008283cell proliferation
GO:0008361regulation of cell size
GO:0010592positive regulation of lamellipodium assembly
GO:0010762regulation of fibroblast migration
GO:0010811positive regulation of cell-substrate adhesion
GO:0014041regulation of neuron maturation
GO:0016358dendrite development
GO:0016477cell migration
GO:0016601Rac protein signal transduction
GO:0021799cerebral cortex radially oriented cell migration
GO:0021831embryonic olfactory bulb interneuron precursor migration
GO:0021894cerebral cortex GABAergic interneuron development
GO:0022604regulation of cell morphogenesis
GO:0030032lamellipodium assembly
GO:0030036actin cytoskeleton organization
GO:0030041actin filament polymerization
GO:0030334regulation of cell migration
GO:0030838positive regulation of actin filament polymerization
GO:0031529ruffle organization
GO:0032707negative regulation of interleukin-23 production
GO:0034446substrate adhesion-dependent cell spreading
GO:0035567non-canonical Wnt signaling pathway
GO:0043552positive regulation of phosphatidylinositol 3-kinase activity
GO:0043652engulfment of apoptotic cell
GO:0045216cell-cell junction organization
GO:0045453bone resorption
GO:0045740positive regulation of DNA replication
GO:0048168regulation of neuronal synaptic plasticity
GO:0048532anatomical structure arrangement
GO:0048812neuron projection morphogenesis
GO:0048813dendrite morphogenesis
GO:0048870cell motility
GO:0048873homeostasis of number of cells within a tissue
GO:0051496positive regulation of stress fiber assembly
GO:0051668localization within membrane
GO:0051894positive regulation of focal adhesion assembly
GO:0051932synaptic transmission, GABAergic
GO:0060071Wnt signaling pathway, planar cell polarity pathway
GO:0060263regulation of respiratory burst
GO:0060999positive regulation of dendritic spine development
GO:0071260cellular response to mechanical stimulus
GO:0071526semaphorin-plexin signaling pathway
GO:0071542dopaminergic neuron differentiation
GO:0072659protein localization to plasma membrane
GO:0090023positive regulation of neutrophil chemotaxis
GO:0090103cochlea morphogenesis
GO:0097178ruffle assembly
GO:1900026positive regulation of substrate adhesion-dependent cell spreading
GO:1904948midbrain dopaminergic neuron differentiation
GO:0001934positive regulation of protein phosphorylation
GO:0002093auditory receptor cell morphogenesis
GO:0002551mast cell chemotaxis
GO:0003382epithelial cell morphogenesis
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005802trans-Golgi network
GO:0005829cytosol
GO:0005884actin filament
GO:0005886plasma membrane
GO:0005925focal adhesion
GO:0016020membrane
GO:0019897extrinsic component of plasma membrane
GO:0030027lamellipodium
GO:0031012extracellular matrix
GO:0031410cytoplasmic vesicle
GO:0031901early endosome membrane
GO:0032587ruffle membrane
GO:0036464cytoplasmic ribonucleoprotein granule
GO:0042470melanosome
GO:0042995cell projection
GO:0043197dendritic spine
GO:0060091kinocilium
GO:0070062extracellular exosome
GO:0000139Golgi membrane
GO:0000242pericentriolar material
GO:0001891phagocytic cup
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00449RASTRNSFRMNGcoord: 155..177
score: 33.29
coord: 27..43
score: 24.47
coord: 4..25
score: 46.34
coord: 106..119
score: 47.76
coord: 44..66
score: 46.1
NoneNo IPR availableSMARTSM00175rab_sub_5coord: 4..180
e-value: 1.6E-23
score: 94.2
NoneNo IPR availableSMARTSM00174rho_sub_3coord: 6..180
e-value: 4.5E-117
score: 404.9
NoneNo IPR availableSMARTSM00173ras_sub_4coord: 1..180
e-value: 2.0E-22
score: 90.5
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1..182
e-value: 2.7E-68
score: 230.8
NoneNo IPR availablePANTHERPTHR24072:SF291coord: 1..184
NoneNo IPR availablePANTHERPTHR24072RHO FAMILY GTPASEcoord: 1..184
NoneNo IPR availableCDDcd00157Rhocoord: 4..176
e-value: 1.77944E-109
score: 308.319
IPR005225Small GTP-binding protein domainTIGRFAMTIGR00231TIGR00231coord: 1..133
e-value: 8.0E-34
score: 114.7
IPR001806Small GTPasePFAMPF00071Rascoord: 5..177
e-value: 7.0E-54
score: 181.8
IPR003578Small GTPase RhoPROSITEPS51420RHOcoord: 1..177
score: 26.479
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 3..177